F353212

General Info

Members Datasets Scaffolds Average Seq Length
240 159 480 235

Family's Representative Sequence

Representative Sequence 3300047471|Ga0495684_0344452|Ga0495684_0344452_159_992
Length 277
Sequence VSSHAVIQSDQFSRELRARRSAFSESPVETTSCPLVYNEEVVHMIRFYFHPTPNPAKVALFLEEANVPYETVPVDTSKGEQHLPAFRKINPNGKVPAIVDTEGPGGREARIFDSSAIVLYLAEKTGKFLGSPEDRPELLSWLFFIASGLGPFSGQAVHFQFAAPEGLDYARNRYRREAERHYQVLEDHLAGRDYFVGNSYTIADMSTWGWIDRASRVLKGEGDPLAPYPNIKRWFEAIEARPAVARARAVGAEHSFKQERDEEALRALFPSNYPAVA

Samples

Sample ID Description Type Environment
1 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
12 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
37 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
38 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
39 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
43 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
44 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
46 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
47 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
48 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
52 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
62 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
63 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
64 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
65 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
66 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
67 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
68 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
69 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
70 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
72 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
73 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
74 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
75 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
76 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
77 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
78 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
79 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
80 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
81 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
82 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
83 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
84 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
85 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
86 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
87 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
88 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
89 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
90 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
91 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
92 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
93 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
94 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
95 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
96 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
97 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
98 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
99 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
100 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
101 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
102 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
103 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
104 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
105 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
106 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
107 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
108 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
109 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
110 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
111 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
112 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
113 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
114 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
115 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
116 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
117 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
118 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
119 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
120 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
121 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
122 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
123 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
124 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
125 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
126 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
127 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
140 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
141 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
142 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
143 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
144 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
145 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
146 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
147 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
148 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
149 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
150 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
151 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
152 2855730933 Achromobacter sp. HZ28 Isolate Nodule
153 2855767633 Achromobacter sp. HZ34 Isolate Nodule
154 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
155 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
156 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
157 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
158 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
159 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.92
Metatranscriptomes 0.42
Isolates 6.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15
Nodule 2.5
Rhizoplane 4.58
Rhizosphere 55.42
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495684_0344452 3300047471 Bacteria 1060
2 JGI25155J39150_1000109 3300002704 Bacteria 43954
3 JGI25156J39149_1000106 3300002705 Bacteria 60506
4 JGI25154J39366_1000038 3300002738 Bacteria 155793
5 JGI25157J39369_1000676 3300002741 Bacteria 18747
6 JGI25151J46595_10000550 3300003187 Bacteria 34188
7 JGI25151J46595_10001882 3300003187 Bacteria 13378
8 JGI25165J46597_1000626 3300003214 Bacteria 29548
9 rootH2_10045615 3300003320 Bacteria 1920
10 rootL2_10236768 3300003322 Bacteria 1925
11 rootH1_10101301 3300003323 Bacteria 1438
12 Ga0055532_1000023 3300003758 Bacteria 248212
13 Ga0055529_1003464 3300003763 Bacteria 2608
14 Ga0055526_1001949 3300003771 Bacteria 14276
15 Ga0055524_1001353 3300003775 Bacteria 14276
16 Ga0055534_1018723 3300003784 Bacteria 1200
17 Ga0055528_1000185 3300003790 Bacteria 52750
18 Ga0070660_100329770 3300005339 Bacteria 1255
19 Ga0070671_100537456 3300005355 Bacteria 1007
20 Ga0070713_100229529 3300005436 Bacteria 1687
21 Ga0070710_10116090 3300005437 Bacteria 1614
22 Ga0070711_100653561 3300005439 Bacteria 882
23 Ga0070693_100275707 3300005547 Bacteria 1124
24 Ga0068855_100031481 3300005563 Bacteria 6335
25 Ga0068857_100040746 3300005577 Bacteria 4118
26 Ga0068856_100197295 3300005614 Bacteria 2027
27 Ga0068856_100513565 3300005614 Bacteria 1219
28 Ga0068861_100015755 3300005719 Bacteria 5337
29 Ga0081455_10004415 3300005937 Bacteria 15796
30 Ga0081455_10320425 3300005937 Bacteria 1104
31 Ga0070717_10285256 3300006028 Bacteria 1465
32 Ga0075367_10033873 3300006178 Bacteria 2947
33 Ga0105240_10014007 3300009093 Bacteria 10969
34 Ga0105240_10129609 3300009093 Bacteria 3027
35 Ga0105243_10018537 3300009148 Bacteria 5274
36 Ga0105248_10057182 3300009177 Bacteria 4377
37 Ga0105237_10000111 3300009545 Bacteria 114572
38 Ga0105237_10000579 3300009545 Bacteria 51228
39 Ga0105238_10341815 3300009551 Bacteria 1485
40 Ga0105238_10756654 3300009551 Bacteria 986
41 Ga0105239_10000443 3300010375 Bacteria 60452
42 Ga0105239_10000602 3300010375 Bacteria 51318
43 Ga0105239_10218738 3300010375 Bacteria 2136
44 Ga0105239_10322507 3300010375 Bacteria 1742
45 Ga0157376_10166883 3300014969 Bacteria 2001
46 Ga0213872_10150062 3300021361 Bacteria 1019
47 Ga0209435_100013 3300025206 Bacteria 366789
48 Ga0209672_108089 3300025228 Bacteria 1579
49 Ga0209147_100030 3300025229 Bacteria 366789
50 Ga0209258_100429 3300025242 Bacteria 49055
51 Ga0209646_1000034 3300025246 Bacteria 366789
52 Ga0209026_1000022 3300025250 Bacteria 366789
53 Ga0209148_1000501 3300025254 Bacteria 39942
54 Ga0209148_1017539 3300025254 Bacteria 1214
55 Ga0209759_1000018 3300025256 Bacteria 366789
56 Ga0209129_1000097 3300025258 Bacteria 165504
57 Ga0209233_1000322 3300025261 Bacteria 51917
58 Ga0209233_1000438 3300025261 Bacteria 29102
59 Ga0209455_1000456 3300025272 Bacteria 31128
60 Ga0209455_1000913 3300025272 Bacteria 15334
61 Ga0209455_1002237 3300025272 Bacteria 7616
62 Ga0209673_1000595 3300025273 Bacteria 56286
63 Ga0209673_1009646 3300025273 Bacteria 4151
64 Ga0209675_1001364 3300025291 Bacteria 14307
65 Ga0209025_1000003 3300025294 Bacteria 1366495
66 Ga0209025_1000163 3300025294 Bacteria 165492
67 Ga0209564_1001616 3300025295 Bacteria 21865
68 Ga0209564_1002385 3300025295 Bacteria 15051
69 Ga0209564_1002518 3300025295 Bacteria 14175
70 Ga0209256_1000532 3300025299 Bacteria 55253
71 Ga0209256_1000567 3300025299 Bacteria 52801
72 Ga0209256_1002599 3300025299 Bacteria 14328
73 Ga0207695_10108721 3300025913 Bacteria 2756
74 Ga0207671_10000045 3300025914 Bacteria 201245
75 Ga0207671_10000087 3300025914 Bacteria 141774
76 Ga0207657_10027041 3300025919 Bacteria 5260
77 Ga0207709_10026840 3300025935 Bacteria 3311
78 Ga0207711_10069647 3300025941 Bacteria 3050
79 Ga0207711_10162220 3300025941 Bacteria 2024
80 Ga0207702_10362805 3300026078 Bacteria 1389
81 Ga0207674_10024840 3300026116 Bacteria 6396
82 Ga0307509_10117711 3300031507 Bacteria 2643
83 Ga0265313_10052148 3300031595 Bacteria 1954
84 Ga0307412_10001028 3300031911 Bacteria 15952
85 Ga0307414_10022617 3300032004 Bacteria 3970
86 Ga0307414_10113512 3300032004 Bacteria 2068
87 Ga0373935_0064706 3300035692 Bacteria 2345
88 Ga0373927_0229790 3300035695 Bacteria 1219
89 Ga0373933_0038926 3300035724 Bacteria 2796
90 Ga0373947_0055147 3300035725 Bacteria 2400
91 Ga0373937_0073992 3300036401 Bacteria 3143
92 Ga0373937_0140283 3300036401 Bacteria 2261
93 Ga0265778_009666 3300036457 Bacteria 1089
94 Ga0373925_0071626 3300037068 Bacteria 2622
95 Ga0395898_0156358 3300037466 Bacteria 2181
96 Ga0395905_0001297 3300037471 Bacteria 30740
97 Ga0436360_1209148 3300039438 Bacteria 2540
98 Ga0436360_1350355 3300039438 Bacteria 2017
99 Ga0436361_0166895 3300039447 Bacteria 4975
100 Ga0436361_0169117 3300039447 Bacteria 2453
101 Ga0436361_0379818 3300039447 Bacteria 2233
102 Ga0436361_0583690 3300039447 Bacteria 1518
103 Ga0436361_0710463 3300039447 Bacteria 1394
104 Ga0439445_0004141 3300042004 Bacteria 3277
105 Ga0450911_000107 3300042115 Bacteria 34252
106 Ga0466970_0285891 3300044765 Bacteria 928
107 Ga0466959_0288529 3300045049 Bacteria 1125
108 Ga0466967_0042954 3300045976 Bacteria 3911
109 Ga0495653_0020038 3300046463 Bacteria 5420
110 Ga0495650_0008533 3300046471 Bacteria 5961
111 Ga0495606_0154638 3300046507 Bacteria 1343
112 Ga0495606_0169803 3300046507 Bacteria 1266
113 Ga0495628_0087753 3300046516 Bacteria 2411
114 Ga0495630_0029614 3300046517 Bacteria 4069
115 Ga0495666_0078490 3300046526 Bacteria 1564
116 Ga0495652_0001649 3300046529 Bacteria 24303
117 Ga0495665_0000390 3300046531 Bacteria 22237
118 Ga0495640_0083854 3300046533 Bacteria 2115
119 Ga0495587_0196041 3300046536 Bacteria 1143
120 Ga0495645_0027544 3300046543 Bacteria 4130
121 Ga0495635_0001420 3300046663 Bacteria 15970
122 Ga0495599_0121389 3300046678 Bacteria 1624
123 Ga0495599_0136232 3300046678 Bacteria 1524
124 Ga0495623_0009897 3300046679 Bacteria 6175
125 Ga0495646_0003962 3300046680 Bacteria 9260
126 Ga0495646_0173455 3300046680 Bacteria 1187
127 Ga0495613_0204806 3300046689 Bacteria 1390
128 Ga0495624_0004566 3300046690 Bacteria 10105
129 Ga0495671_0173949 3300046692 Bacteria 1046
130 Ga0495649_0096702 3300046694 Bacteria 1571
131 Ga0495604_0002640 3300047317 Bacteria 14385
132 Ga0495674_0004466 3300047319 Bacteria 13461
133 Ga0495674_0080400 3300047319 Bacteria 2797
134 Ga0495674_0096713 3300047319 Bacteria 2516
135 Ga0495674_0111064 3300047319 Bacteria 2324
136 Ga0495672_0010114 3300047320 Bacteria 6750
137 Ga0495676_0070289 3300047321 Bacteria 2697
138 Ga0495680_0001628 3300047322 Bacteria 23858
139 Ga0495675_0065276 3300047444 Bacteria 2302
140 Ga0495673_0068250 3300047469 Bacteria 1503
141 Ga0495686_0007083 3300047472 Bacteria 8452
142 Ga0495686_0022324 3300047472 Bacteria 4189
143 Ga0495686_0136254 3300047472 Bacteria 1452
144 Ga0495593_0000753 3300047673 Bacteria 18798
145 Ga0495602_0002724 3300048088 Bacteria 18048
146 Ga0496100_0037543 3300048903 Bacteria 3063
147 Ga0496100_0088749 3300048903 Bacteria 2105
148 Ga0496100_0089224 3300048903 Bacteria 2100
149 Ga0496100_0099550 3300048903 Bacteria 2000
150 Ga0496101_0202429 3300048904 Bacteria 1535
151 Ga0496104_0042088 3300048907 Bacteria 4285
152 Ga0496104_0202375 3300048907 Bacteria 1897
153 Ga0496105_0002399 3300048908 Bacteria 13560
154 Ga0496105_0012217 3300048908 Bacteria 6798
155 Ga0496109_0209600 3300048912 Bacteria 1833
156 Ga0496113_0874521 3300048916 Bacteria 712
157 Ga0496116_0000393 3300048919 Bacteria 63922
158 Ga0496116_0114932 3300048919 Bacteria 1571
159 Ga0496117_0000661 3300048920 Bacteria 55121
160 Ga0496117_0002643 3300048920 Bacteria 22213
161 Ga0496117_0010280 3300048920 Bacteria 8559
162 Ga0496118_0000853 3300048921 Bacteria 48346
163 Ga0496118_0010248 3300048921 Bacteria 9302
164 Ga0496118_0022085 3300048921 Bacteria 5577
165 Ga0496118_0311930 3300048921 Bacteria 858
166 Ga0496119_0000408 3300048922 Bacteria 58851
167 Ga0496119_0000827 3300048922 Bacteria 41250
168 Ga0496119_0000987 3300048922 Bacteria 36571
169 Ga0496119_0034319 3300048922 Bacteria 3344
170 Ga0496120_0000959 3300048923 Bacteria 39312
171 Ga0496120_0001158 3300048923 Bacteria 33792
172 Ga0496120_0179277 3300048923 Bacteria 1041
173 Ga0496121_0000339 3300048924 Bacteria 97504
174 Ga0496121_0001529 3300048924 Bacteria 38730
175 Ga0496121_0005578 3300048924 Bacteria 16071
176 Ga0496121_0015065 3300048924 Bacteria 8136
177 Ga0496121_0024087 3300048924 Bacteria 5833
178 Ga0496121_0135279 3300048924 Bacteria 1837
179 Ga0496121_0192328 3300048924 Bacteria 1462
180 Ga0496122_0001094 3300048925 Bacteria 46993
181 Ga0496122_0007932 3300048925 Bacteria 11619
182 Ga0496123_0001198 3300048926 Bacteria 38067
183 Ga0496124_0003523 3300048927 Bacteria 19064
184 Ga0496124_0010935 3300048927 Bacteria 9130
185 Ga0496125_0017874 3300048928 Bacteria 6745
186 Ga0496126_0001434 3300048929 Bacteria 37437
187 Ga0496126_0007114 3300048929 Bacteria 12327
188 Ga0496126_0129807 3300048929 Bacteria 2179
189 Ga0496126_0595749 3300048929 Bacteria 871
190 Ga0496126_0607856 3300048929 Bacteria 860
191 Ga0496126_0607860 3300048929 Bacteria 860
192 Ga0501031_0007514 3300049568 Bacteria 7096
193 Ga0501031_0019531 3300049568 Bacteria 4414
194 Ga0501031_0076068 3300049568 Bacteria 2186
195 Ga0501032_0001898 3300049569 Bacteria 16499
196 Ga0501032_0032258 3300049569 Bacteria 3590
197 Ga0501033_0005344 3300049570 Bacteria 10179
198 Ga0501034_0181930 3300049571 Bacteria 2067
199 Ga0501034_0328013 3300049571 Bacteria 1462
200 Ga0501036_0000319 3300049572 Bacteria 33522
201 Ga0501037_0001674 3300049573 Bacteria 16119
202 Ga0501037_0014136 3300049573 Bacteria 5879
203 Ga0501038_0001134 3300049574 Bacteria 24160
204 Ga0501039_0323859 3300049575 Bacteria 1211
205 Ga0501043_0013116 3300049579 Bacteria 6478
206 Ga0501046_0016700 3300049580 Bacteria 6140
207 Ga0501047_0013601 3300049581 Bacteria 7718
208 Ga0501047_0086051 3300049581 Bacteria 3020
209 Ga0501047_0556237 3300049581 Bacteria 971
210 Ga0501047_0749527 3300049581 Bacteria 793
211 Ga0501035_0002071 3300049822 Bacteria 19950
212 Ga0501035_0015727 3300049822 Bacteria 6983
213 Ga0501035_0018350 3300049822 Bacteria 6447
214 Ga0501035_0052279 3300049822 Bacteria 3656
215 Ga0501035_0122933 3300049822 Bacteria 2267
216 Ga0501044_0000045 3300049823 Bacteria 148353
217 Ga0501044_0000322 3300049823 Bacteria 60519
218 Ga0501044_0009905 3300049823 Bacteria 10357
219 Ga0501044_0133959 3300049823 Bacteria 2470
220 Ga0501044_0501921 3300049823 Bacteria 1114
221 nmdc:mga06z11_21691_c1 3300050494 Bacteria 2988
222 Ga0500556_0000124 3300053104 Bacteria 67080
223 Ga0500618_001518 3300053125 Bacteria 10218
224 Ga0500645_001678 3300053730 Bacteria 10851
225 2501070393 2501025501 Bacteria 7768574
226 2511109312 2510917015 Bacteria 7950052
227 2585281870 2582581308 Bacteria 7413247
228 2585535286 2585427527 Bacteria 7273426
229 2596374696 2595698237 Bacteria 6712432
230 2616310907 2615840626 Bacteria 7921970
231 2644039970 2643221605 Bacteria 4772303
232 2723875938 2721755763 Bacteria 4464185
233 2855733929 2855730933 Bacteria 7047938
234 2855769519 2855767633 Bacteria 7049357
235 2857576920 2857576091 Bacteria 5465855
236 2871453357 2871451962 Bacteria 7336357
237 641336714 641228493 Bacteria 3999591
238 8005486264 8005484373 Bacteria 6297373
239 8055911815 8055909800 Bacteria 7278581
240 8057581852 8057575449 Bacteria 7367519
241 Ga0495684_0344452
242 JGI25155J39150_1000109
243 JGI25156J39149_1000106
244 JGI25154J39366_1000038
245 JGI25157J39369_1000676
246 JGI25151J46595_10000550
247 JGI25151J46595_10001882
248 JGI25165J46597_1000626
249 rootH2_10045615
250 rootL2_10236768
251 rootH1_10101301
252 Ga0055532_1000023
253 Ga0055529_1003464
254 Ga0055526_1001949
255 Ga0055524_1001353
256 Ga0055534_1018723
257 Ga0055528_1000185
258 Ga0070660_100329770
259 Ga0070671_100537456
260 Ga0070713_100229529
261 Ga0070710_10116090
262 Ga0070711_100653561
263 Ga0070693_100275707
264 Ga0068855_100031481
265 Ga0068857_100040746
266 Ga0068856_100197295
267 Ga0068856_100513565
268 Ga0068861_100015755
269 Ga0081455_10004415
270 Ga0081455_10320425
271 Ga0070717_10285256
272 Ga0075367_10033873
273 Ga0105240_10014007
274 Ga0105240_10129609
275 Ga0105243_10018537
276 Ga0105248_10057182
277 Ga0105237_10000111
278 Ga0105237_10000579
279 Ga0105238_10341815
280 Ga0105238_10756654
281 Ga0105239_10000443
282 Ga0105239_10000602
283 Ga0105239_10218738
284 Ga0105239_10322507
285 Ga0157376_10166883
286 Ga0213872_10150062
287 Ga0209435_100013
288 Ga0209672_108089
289 Ga0209147_100030
290 Ga0209258_100429
291 Ga0209646_1000034
292 Ga0209026_1000022
293 Ga0209148_1000501
294 Ga0209148_1017539
295 Ga0209759_1000018
296 Ga0209129_1000097
297 Ga0209233_1000322
298 Ga0209233_1000438
299 Ga0209455_1000456
300 Ga0209455_1000913
301 Ga0209455_1002237
302 Ga0209673_1000595
303 Ga0209673_1009646
304 Ga0209675_1001364
305 Ga0209025_1000003
306 Ga0209025_1000163
307 Ga0209564_1001616
308 Ga0209564_1002385
309 Ga0209564_1002518
310 Ga0209256_1000532
311 Ga0209256_1000567
312 Ga0209256_1002599
313 Ga0207695_10108721
314 Ga0207671_10000045
315 Ga0207671_10000087
316 Ga0207657_10027041
317 Ga0207709_10026840
318 Ga0207711_10069647
319 Ga0207711_10162220
320 Ga0207702_10362805
321 Ga0207674_10024840
322 Ga0307509_10117711
323 Ga0265313_10052148
324 Ga0307412_10001028
325 Ga0307414_10022617
326 Ga0307414_10113512
327 Ga0373935_0064706
328 Ga0373927_0229790
329 Ga0373933_0038926
330 Ga0373947_0055147
331 Ga0373937_0073992
332 Ga0373937_0140283
333 Ga0265778_009666
334 Ga0373925_0071626
335 Ga0395898_0156358
336 Ga0395905_0001297
337 Ga0436360_1209148
338 Ga0436360_1350355
339 Ga0436361_0166895
340 Ga0436361_0169117
341 Ga0436361_0379818
342 Ga0436361_0583690
343 Ga0436361_0710463
344 Ga0439445_0004141
345 Ga0450911_000107
346 Ga0466970_0285891
347 Ga0466959_0288529
348 Ga0466967_0042954
349 Ga0495653_0020038
350 Ga0495650_0008533
351 Ga0495606_0154638
352 Ga0495606_0169803
353 Ga0495628_0087753
354 Ga0495630_0029614
355 Ga0495666_0078490
356 Ga0495652_0001649
357 Ga0495665_0000390
358 Ga0495640_0083854
359 Ga0495587_0196041
360 Ga0495645_0027544
361 Ga0495635_0001420
362 Ga0495599_0121389
363 Ga0495599_0136232
364 Ga0495623_0009897
365 Ga0495646_0003962
366 Ga0495646_0173455
367 Ga0495613_0204806
368 Ga0495624_0004566
369 Ga0495671_0173949
370 Ga0495649_0096702
371 Ga0495604_0002640
372 Ga0495674_0004466
373 Ga0495674_0080400
374 Ga0495674_0096713
375 Ga0495674_0111064
376 Ga0495672_0010114
377 Ga0495676_0070289
378 Ga0495680_0001628
379 Ga0495675_0065276
380 Ga0495673_0068250
381 Ga0495686_0007083
382 Ga0495686_0022324
383 Ga0495686_0136254
384 Ga0495593_0000753
385 Ga0495602_0002724
386 Ga0496100_0037543
387 Ga0496100_0088749
388 Ga0496100_0089224
389 Ga0496100_0099550
390 Ga0496101_0202429
391 Ga0496104_0042088
392 Ga0496104_0202375
393 Ga0496105_0002399
394 Ga0496105_0012217
395 Ga0496109_0209600
396 Ga0496113_0874521
397 Ga0496116_0000393
398 Ga0496116_0114932
399 Ga0496117_0000661
400 Ga0496117_0002643
401 Ga0496117_0010280
402 Ga0496118_0000853
403 Ga0496118_0010248
404 Ga0496118_0022085
405 Ga0496118_0311930
406 Ga0496119_0000408
407 Ga0496119_0000827
408 Ga0496119_0000987
409 Ga0496119_0034319
410 Ga0496120_0000959
411 Ga0496120_0001158
412 Ga0496120_0179277
413 Ga0496121_0000339
414 Ga0496121_0001529
415 Ga0496121_0005578
416 Ga0496121_0015065
417 Ga0496121_0024087
418 Ga0496121_0135279
419 Ga0496121_0192328
420 Ga0496122_0001094
421 Ga0496122_0007932
422 Ga0496123_0001198
423 Ga0496124_0003523
424 Ga0496124_0010935
425 Ga0496125_0017874
426 Ga0496126_0001434
427 Ga0496126_0007114
428 Ga0496126_0129807
429 Ga0496126_0595749
430 Ga0496126_0607856
431 Ga0496126_0607860
432 Ga0501031_0007514
433 Ga0501031_0019531
434 Ga0501031_0076068
435 Ga0501032_0001898
436 Ga0501032_0032258
437 Ga0501033_0005344
438 Ga0501034_0181930
439 Ga0501034_0328013
440 Ga0501036_0000319
441 Ga0501037_0001674
442 Ga0501037_0014136
443 Ga0501038_0001134
444 Ga0501039_0323859
445 Ga0501043_0013116
446 Ga0501046_0016700
447 Ga0501047_0013601
448 Ga0501047_0086051
449 Ga0501047_0556237
450 Ga0501047_0749527
451 Ga0501035_0002071
452 Ga0501035_0015727
453 Ga0501035_0018350
454 Ga0501035_0052279
455 Ga0501035_0122933
456 Ga0501044_0000045
457 Ga0501044_0000322
458 Ga0501044_0009905
459 Ga0501044_0133959
460 Ga0501044_0501921
461 nmdc:mga06z11_21691_c1
462 Ga0500556_0000124
463 Ga0500618_001518
464 Ga0500645_001678
465 2501070393
466 2511109312
467 2585281870
468 2585535286
469 2596374696
470 2616310907
471 2644039970
472 2723875938
473 2855733929
474 2855769519
475 2857576920
476 2871453357
477 641336714
478 8005486264
479 8055911815
480 8057581852

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

43

123

0.92

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

168

237

0.92

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

154

242

0.91

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

155

248

0.91

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

52

124

0.9

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

47

131

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hfk-assembly1.cif.gz_B crystal structure of a glutathione s-transferase protein from escherichia coli och 157:h7 str. sakai (ecs3186, target efi-507414) with bound glutathione 0.9625 1 205
3gx0-assembly1.cif.gz_A-2 crystal structure of gsh-dependent disulfide bond oxidoreductase 0.96 1 204
4l8e-assembly1.cif.gz_A-2 crystal structure of a glutathione transferase family member from xenorhabdus nematophila, target efi-507418, with two gsh per subunit 0.954 3 204
6tah-assembly1.cif.gz_CAA crystal structure of a nu-class glutathione-s-transferase from pseudomonas aeruginosa pacs2 bound to glutathione 0.9515 1 207
4ikh-assembly1.cif.gz_A-2 crystal structure of a glutathione transferase family member from pseudomonas fluorescens pf-5, target efi-900003, with two glutathione bound 0.951 2 205
ID Description Score Start End Superfamily
4l8eA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9905 3 85 3.40.30.10
af_P77526_1_85_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9892 1 83 3.40.30.10
4mf6A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.986 2 86 3.40.30.10
4ikhA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9839 2 83 3.40.30.10
af_Q5AFB4_1_94_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9679 2 84 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A523FIZ1-F1-model_v4 Glutathione S-transferase family protein 0.9957 1 71 GO:0016740
AF-A0A382M8K8-F1-model_v4 GST N-terminal domain-containing protein 0.9944 1 85
AF-A0A519KSC6-F1-model_v4 Glutathione S-transferase 0.9939 2 73 GO:0016740
AF-A0A158I931-F1-model_v4 Glutathione S-transferase like protein 0.9938 1 233 GO:0016740
AF-A0A258D0G9-F1-model_v4 Glutathione S-transferase 0.992 2 85 GO:0016740

Map