F353188

General Info

Members Datasets Scaffolds Average Seq Length
240 142 225 297

Family's Representative Sequence

Representative Sequence 3300046615|Ga0495656_0058979|Ga0495656_0058979_348_1382
Length 331
Sequence LIDLQLSLVEYSGSFAIPLEKSMRKLFAACLFLILPFTAPALADDKPAVPTMTKESFLASLHFQQGDIVLPGNIATLKLPASFRYLAPADAERVLVDAWGNPPGAKTLGMIVPAAAGPLDEQGWGVVITYDKDGHVKDGDADSIKYDELLKEMQESIAESNAARKEKGYGTMALLGWAEAPRYDKASHKLNSLNYNIRVLGREGVLVLNAVAGMDQIGHIRGEMQTVTAFTEFNPGNRYADFDSKTDKVAEYGLAALVAGGVAAKLGFFGKLFALLLAFKKLIFVGLAVAGTSLFKLFGRKKEAAMPPVEFADDPVPDAPVSLEKKVDLTK

Samples

Sample ID Description Type Environment
1 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
2 2738541297 Duganella sp. GV083 Isolate Unclassified
3 2738541357 Duganella sp. GV053 Isolate Unclassified
4 2738543003 Duganella sp. GV066 Isolate Unclassified
5 2738543026 Duganella sp. GV089 Isolate Unclassified
6 2738543029 Duganella sp. GV039 Isolate Unclassified
7 2842711865 Duganella sp. R-73148 Isolate Unclassified
8 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
9 2857553236 Duganella sp. R-74557 Isolate Unclassified
10 2857558681 Duganella sp. R-74565 Isolate Unclassified
11 2857564685 Duganella sp. R-74599 Isolate Unclassified
12 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
13 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
14 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
38 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
39 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
40 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
41 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
42 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
43 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
44 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
45 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
46 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
48 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
50 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
59 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
60 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
61 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
62 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
63 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
64 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
65 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
66 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
67 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
68 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
69 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
70 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
71 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
72 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
73 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
74 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
75 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
76 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
77 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
78 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
79 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
80 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
81 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
82 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
83 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
84 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
85 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
86 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
87 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
88 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
89 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
90 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
91 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
92 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
93 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
94 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
95 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
96 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
97 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
98 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
99 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
100 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
101 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
102 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
103 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
104 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
105 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
106 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
107 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
108 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
109 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
110 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
111 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
112 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
113 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
114 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
115 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
116 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
117 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
118 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
119 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
120 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
121 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
122 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
123 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
124 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
127 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
128 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
129 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
130 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
131 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
132 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
133 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
134 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
135 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
136 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
137 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
138 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
139 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
140 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
141 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
142 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.75
Metatranscriptomes 0
Isolates 6.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.83
Nodule 0
Rhizoplane 2.5
Rhizosphere 78.75
Stem 0
Stem Tuber 0
Unclassified 12.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10044693 3300003322 Bacteria 5765
2 rootL2_10044694 3300003322 Bacteria 5673
3 rootH1_10106063 3300003323 Bacteria 2124
4 rootH1_10347125 3300003323 Bacteria 1909
5 Ga0055529_1000152 3300003763 Bacteria 98133
6 Ga0055526_1000025 3300003771 Bacteria 154279
7 Ga0055526_1000079 3300003771 Bacteria 89698
8 Ga0065715_10022449 3300005293 Bacteria 1672
9 Ga0070690_100074001 3300005330 Bacteria 2217
10 Ga0070689_100000752 3300005340 Bacteria 19801
11 Ga0070688_100113910 3300005365 Bacteria 1802
12 Ga0070701_10007084 3300005438 Bacteria 4763
13 Ga0070705_100062270 3300005440 Bacteria 2221
14 Ga0070694_100016769 3300005444 Bacteria 4615
15 Ga0070686_100015477 3300005544 Bacteria 4420
16 Ga0070696_100105039 3300005546 Bacteria 2029
17 Ga0070702_100001985 3300005615 Bacteria 8614
18 Ga0070702_100185995 3300005615 Bacteria 1363
19 Ga0068859_100013256 3300005617 Bacteria 8272
20 Ga0068864_100006517 3300005618 Bacteria 9568
21 Ga0068863_100077600 3300005841 Bacteria 3144
22 Ga0068860_100120483 3300005843 Bacteria 2512
23 Ga0068862_100011762 3300005844 Bacteria 7223
24 Ga0097620_100013256 3300006931 Bacteria 8272
25 Ga0105244_10000891 3300009036 Bacteria 25233
26 Ga0105244_10085440 3300009036 Bacteria 1557
27 Ga0157375_10016357 3300013308 Bacteria 6660
28 Ga0182008_10001391 3300014497 Bacteria 16347
29 Ga0182006_1000010 3300015261 Bacteria 413414
30 Ga0182007_10000021 3300015262 Bacteria 193408
31 Ga0182005_1000009 3300015265 Bacteria 455334
32 Ga0163161_10014883 3300017792 Bacteria 5419
33 Ga0163161_10200309 3300017792 Bacteria 1538
34 Ga0213872_10000400 3300021361 Bacteria 36083
35 Ga0213872_10006612 3300021361 Bacteria 5784
36 Ga0209437_107045 3300025233 Bacteria 1849
37 Ga0207425_1000433 3300025245 Bacteria 27674
38 Ga0209233_1041113 3300025261 Bacteria 1001
39 Ga0209455_1000070 3300025272 Bacteria 307867
40 Ga0209025_1006403 3300025294 Bacteria 9155
41 Ga0209564_1000027 3300025295 Bacteria 518458
42 Ga0209564_1000047 3300025295 Bacteria 368031
43 Ga0209758_1000436 3300025297 Bacteria 70342
44 Ga0207681_10280028 3300025923 Unclassified 1313
45 Ga0207670_10012094 3300025936 Bacteria 5035
46 Ga0207691_10063169 3300025940 Bacteria 3359
47 Ga0207641_10072230 3300026088 Bacteria 2971
48 Ga0207676_10009441 3300026095 Bacteria 6944
49 Ga0207675_100003324 3300026118 Bacteria 15743
50 Ga0268266_10364287 3300028379 Unclassified 1361
51 Ga0268265_10035781 3300028380 Bacteria 3632
52 Ga0307513_10038588 3300031456 Bacteria 5302
53 Ga0307509_10101550 3300031507 Bacteria 2911
54 Ga0307408_100003257 3300031548 Bacteria 11161
55 Ga0307409_100396896 3300031995 Unclassified 1316
56 Ga0373939_0021701 3300035114 Bacteria 1761
57 Ga0395899_0000098 3300037312 Bacteria 151953
58 Ga0436365_0194176 3300039437 Bacteria 1452
59 Ga0436361_0886293 3300039447 Bacteria 22531
60 Ga0436361_1045937 3300039447 Bacteria 9057
61 Ga0466972_0001052 3300044658 Bacteria 13237
62 Ga0466982_0026934 3300044672 Bacteria 3362
63 Ga0466965_0001199 3300044683 Bacteria 10247
64 Ga0466965_0094155 3300044683 Bacteria 1526
65 Ga0466964_0024999 3300044706 Bacteria 2330
66 Ga0453684_0000672 3300044712 Bacteria 122591
67 Ga0466968_0017032 3300044735 Bacteria 2899
68 Ga0451576_0000268 3300045051 Bacteria 127422
69 Ga0495617_000075 3300046452 Bacteria 78250
70 Ga0495617_000647 3300046452 Bacteria 17439
71 Ga0495617_004015 3300046452 Bacteria 5405
72 Ga0495603_0138199 3300046455 Bacteria 1418
73 Ga0495590_0000021 3300046457 Bacteria 210878
74 Ga0495590_0007315 3300046457 Bacteria 4266
75 Ga0495638_0002515 3300046460 Bacteria 14913
76 Ga0495653_0000044 3300046463 Bacteria 115591
77 Ga0495650_0000082 3300046471 Bacteria 239477
78 Ga0495650_0000941 3300046471 Bacteria 33764
79 Ga0495605_0000098 3300046474 Bacteria 109816
80 Ga0495605_0000121 3300046474 Bacteria 102560
81 Ga0495584_0000005 3300046491 Bacteria 306957
82 Ga0495584_0017050 3300046491 Bacteria 3702
83 Ga0495585_0000023 3300046492 Bacteria 149218
84 Ga0495585_0000898 3300046492 Bacteria 25216
85 Ga0495585_0007544 3300046492 Bacteria 6651
86 Ga0495585_0029986 3300046492 Bacteria 3094
87 Ga0495585_0038288 3300046492 Bacteria 2699
88 Ga0495596_0001453 3300046500 Bacteria 13566
89 Ga0495607_0015180 3300046501 Bacteria 4999
90 Ga0495607_0035569 3300046501 Bacteria 3011
91 Ga0495607_0045664 3300046501 Bacteria 2575
92 Ga0495583_0000116 3300046506 Bacteria 135355
93 Ga0495583_0000150 3300046506 Bacteria 117772
94 Ga0495606_0000099 3300046507 Bacteria 150950
95 Ga0495606_0000223 3300046507 Bacteria 100501
96 Ga0495606_0003936 3300046507 Bacteria 15279
97 Ga0495606_0034344 3300046507 Bacteria 3483
98 Ga0495606_0052926 3300046507 Bacteria 2636
99 Ga0495610_0000017 3300046512 Bacteria 365675
100 Ga0495610_0002542 3300046512 Bacteria 15193
101 Ga0495610_0039029 3300046512 Bacteria 2405
102 Ga0495616_0001830 3300046513 Bacteria 14406
103 Ga0495616_0002486 3300046513 Bacteria 12192
104 Ga0495616_0009091 3300046513 Bacteria 5828
105 Ga0495616_0053029 3300046513 Bacteria 2017
106 Ga0495616_0056442 3300046513 Bacteria 1939
107 Ga0495631_0041045 3300046518 Bacteria 2048
108 Ga0495631_0090995 3300046518 Bacteria 1313
109 Ga0495632_0065682 3300046519 Unclassified 1752
110 Ga0495637_0072522 3300046520 Bacteria 1386
111 Ga0495643_0000209 3300046522 Bacteria 89487
112 Ga0495643_0058716 3300046522 Bacteria 2046
113 Ga0495643_0127968 3300046522 Bacteria 1277
114 Ga0495644_0000581 3300046523 Bacteria 15320
115 Ga0495644_0011540 3300046523 Bacteria 3401
116 Ga0495648_0000048 3300046524 Bacteria 164840
117 Ga0495648_0017106 3300046524 Bacteria 5196
118 Ga0495648_0018583 3300046524 Bacteria 4916
119 Ga0495663_0011050 3300046525 Bacteria 2514
120 Ga0495642_0003370 3300046528 Bacteria 6312
121 Ga0495642_0071296 3300046528 Bacteria 1453
122 Ga0495654_0019573 3300046530 Bacteria 3540
123 Ga0495586_0251730 3300046535 Bacteria 1008
124 Ga0495609_0002561 3300046538 Bacteria 11091
125 Ga0495597_0000017 3300046542 Bacteria 165491
126 Ga0495597_0000414 3300046542 Bacteria 36818
127 Ga0495597_0023061 3300046542 Bacteria 2880
128 Ga0495597_0039839 3300046542 Bacteria 2101
129 Ga0495622_0086935 3300046557 Bacteria 1437
130 Ga0495633_0000070 3300046558 Bacteria 133333
131 Ga0495633_0001464 3300046558 Bacteria 18313
132 Ga0495633_0002368 3300046558 Bacteria 13357
133 Ga0495633_0002560 3300046558 Bacteria 12742
134 Ga0495633_0008523 3300046558 Bacteria 5762
135 Ga0495633_0008839 3300046558 Bacteria 5623
136 Ga0495633_0013330 3300046558 Bacteria 4337
137 Ga0495633_0035138 3300046558 Bacteria 2407
138 Ga0495656_0016674 3300046615 Bacteria 2790
139 Ga0495656_0058979 3300046615 Bacteria 1668
140 Ga0495668_0000143 3300046616 Bacteria 107442
141 Ga0495668_0000286 3300046616 Bacteria 69771
142 Ga0495668_0000647 3300046616 Bacteria 41830
143 Ga0495668_0002763 3300046616 Bacteria 14026
144 Ga0495668_0030139 3300046616 Bacteria 3065
145 Ga0495611_0001930 3300046648 Bacteria 9854
146 Ga0495611_0005371 3300046648 Bacteria 5486
147 Ga0495611_0007319 3300046648 Bacteria 4689
148 Ga0495625_0000338 3300046660 Bacteria 71524
149 Ga0495625_0003515 3300046660 Bacteria 15526
150 Ga0495625_0031313 3300046660 Bacteria 3959
151 Ga0495625_0043882 3300046660 Bacteria 3239
152 Ga0495625_0081944 3300046660 Bacteria 2245
153 Ga0495625_0084785 3300046660 Bacteria 2200
154 Ga0495661_0028962 3300046665 Bacteria 3538
155 Ga0495661_0045715 3300046665 Bacteria 2676
156 Ga0495588_0205768 3300046674 Bacteria 1039
157 Ga0495669_0008053 3300046684 Bacteria 4422
158 Ga0495670_0037082 3300046691 Bacteria 2429
159 Ga0495670_0058971 3300046691 Bacteria 1926
160 Ga0495670_0077640 3300046691 Bacteria 1688
161 Ga0495671_0000026 3300046692 Bacteria 237110
162 Ga0495671_0015713 3300046692 Bacteria 4049
163 Ga0495671_0016066 3300046692 Bacteria 4002
164 Ga0495671_0212065 3300046692 Bacteria 938
165 Ga0495589_0007866 3300046794 Bacteria 5581
166 Ga0495660_0000538 3300046810 Bacteria 31032
167 Ga0495660_0001587 3300046810 Bacteria 15260
168 Ga0495660_0002304 3300046810 Bacteria 12241
169 Ga0495660_0005117 3300046810 Bacteria 7879
170 Ga0495636_0094111 3300047318 Bacteria 1303
171 Ga0495672_0000013 3300047320 Bacteria 511827
172 Ga0495672_0115616 3300047320 Bacteria 1433
173 Ga0495683_0000790 3300047323 Bacteria 22534
174 Ga0495683_0003414 3300047323 Bacteria 9270
175 Ga0495683_0009744 3300047323 Bacteria 5107
176 Ga0495687_000057 3300047443 Bacteria 186224
177 Ga0495677_0004226 3300047445 Bacteria 5534
178 Ga0495677_0004483 3300047445 Bacteria 5353
179 Ga0495677_0084992 3300047445 Bacteria 1188
180 Ga0495677_0112194 3300047445 Bacteria 1037
181 Ga0495679_017214 3300047446 Bacteria 2591
182 Ga0495685_000358 3300047447 Bacteria 14541
183 Ga0495685_005195 3300047447 Bacteria 4241
184 Ga0495685_017981 3300047447 Bacteria 2423
185 Ga0495673_0000069 3300047469 Bacteria 218170
186 Ga0495673_0000203 3300047469 Bacteria 89918
187 Ga0495673_0044556 3300047469 Bacteria 1978
188 Ga0495681_0005768 3300047470 Bacteria 8234
189 Ga0495681_0024402 3300047470 Bacteria 3187
190 Ga0495681_0039527 3300047470 Bacteria 2302
191 Ga0495686_0038247 3300047472 Bacteria 3070
192 Ga0495686_0058371 3300047472 Bacteria 2405
193 Ga0495686_0069489 3300047472 Bacteria 2171
194 Ga0495615_0027546 3300048090 Bacteria 1334
195 Ga0495626_0000048 3300048091 Bacteria 161634
196 Ga0495626_0004288 3300048091 Bacteria 8801
197 Ga0495626_0021798 3300048091 Bacteria 3172
198 Ga0496102_0000279 3300048905 Bacteria 65185
199 Ga0496102_0183514 3300048905 Bacteria 1971
200 Ga0496103_0024210 3300048906 Bacteria 3662
201 Ga0496107_0078563 3300048910 Bacteria 2405
202 Ga0496111_0005924 3300048914 Bacteria 7883
203 Ga0496116_0016386 3300048919 Bacteria 5800
204 Ga0496117_0000010 3300048920 Bacteria 611954
205 Ga0496118_0000009 3300048921 Bacteria 611954
206 Ga0496121_0004497 3300048924 Bacteria 18689
207 Ga0496121_0027660 3300048924 Bacteria 5301
208 Ga0496121_0061832 3300048924 Bacteria 3070
209 Ga0496122_0001806 3300048925 Bacteria 32791
210 Ga0496122_0011339 3300048925 Bacteria 9045
211 Ga0496123_0003318 3300048926 Bacteria 18231
212 Ga0496123_0003741 3300048926 Bacteria 16678
213 Ga0496124_0016992 3300048927 Bacteria 6886
214 Ga0496125_0052581 3300048928 Bacteria 3348
215 Ga0496126_0002547 3300048929 Bacteria 24391
216 Ga0495678_000010 3300049459 Bacteria 357896
217 Ga0495678_000431 3300049459 Bacteria 41904
218 Ga0495678_006079 3300049459 Bacteria 6499
219 Ga0495678_011806 3300049459 Bacteria 4167
220 Ga0495678_020285 3300049459 Bacteria 2947
221 Ga0495682_0000089 3300049460 Bacteria 80020
222 Ga0495682_0005952 3300049460 Bacteria 4997
223 Ga0500566_0250357 3300053094 Unclassified 862
224 Ga0500586_000020 3300053145 Bacteria 30971
225 Ga0500586_015855 3300053145 Bacteria 2273

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053094 Ga0500566_0250357 Ga0500566_0250357_36_794 250
2 3300017792 Ga0163161_10014883 Ga0163161_100148834 258
3 3300003323 rootH1_10106063 rootH1_101060632 260
4 3300031995 Ga0307409_100396896 Ga0307409_1003968962 265
5 3300046506 Ga0495583_0000150 Ga0495583_0000150_74072_74953 268
6 3300046523 Ga0495644_0000581 Ga0495644_0000581_4192_5172 268
7 3300046538 Ga0495609_0002561 Ga0495609_0002561_9946_10827 268
8 3300046615 Ga0495656_0016674 Ga0495656_0016674_174_1055 268
9 3300046648 Ga0495611_0001930 Ga0495611_0001930_6240_7121 268
10 3300046648 Ga0495611_0005371 Ga0495611_0005371_4314_5195 268
11 3300047443 Ga0495687_000057 Ga0495687_000057_142524_143405 268
12 3300047445 Ga0495677_0004226 Ga0495677_0004226_4206_5087 268
13 3300046457 Ga0495590_0007315 Ga0495590_0007315_273_1154 269
14 3300046474 Ga0495605_0000121 Ga0495605_0000121_75864_76745 269
15 3300046513 Ga0495616_0002486 Ga0495616_0002486_4964_5845 269
16 3300046513 Ga0495616_0053029 Ga0495616_0053029_1027_1968 269
17 3300046660 Ga0495625_0031313 Ga0495625_0031313_1263_2177 269
18 3300046660 Ga0495625_0043882 Ga0495625_0043882_830_1711 269
19 3300046692 Ga0495671_0212065 Ga0495671_0212065_38_919 269
20 3300047323 Ga0495683_0000790 Ga0495683_0000790_1868_2749 269
21 3300047469 Ga0495673_0044556 Ga0495673_0044556_191_1072 269
22 3300028379 Ga0268266_10364287 Ga0268266_103642872 270
23 3300046513 Ga0495616_0009091 Ga0495616_0009091_3881_4762 270
24 3300046519 Ga0495632_0065682 Ga0495632_0065682_753_1613 271
25 3300046512 Ga0495610_0000017 Ga0495610_0000017_42011_42967 272
26 3300039437 Ga0436365_0194176 Ga0436365_0194176_274_1194 274
27 3300046452 Ga0495617_000647 Ga0495617_000647_2374_3255 274
28 3300046558 Ga0495633_0002560 Ga0495633_0002560_8972_9853 274
29 3300046692 Ga0495671_0015713 Ga0495671_0015713_3131_4012 274
30 3300046457 Ga0495590_0000021 Ga0495590_0000021_19551_20501 276
31 3300046616 Ga0495668_0000143 Ga0495668_0000143_19387_20337 276
32 3300049459 Ga0495678_020285 Ga0495678_020285_285_1235 276
33 3300031548 Ga0307408_100003257 Ga0307408_1000032572 278
34 3300046506 Ga0495583_0000116 Ga0495583_0000116_52770_53666 278
35 3300046558 Ga0495633_0002368 Ga0495633_0002368_6732_7706 279
36 iso_pu_bacteria 8002745576 8002748689 279
37 3300005841 Ga0068863_100077600 Ga0068863_1000776004 280
38 3300013308 Ga0157375_10016357 Ga0157375_100163573 280
39 3300025923 Ga0207681_10280028 Ga0207681_102800282 280
40 3300025940 Ga0207691_10063169 Ga0207691_100631692 280
41 3300026088 Ga0207641_10072230 Ga0207641_100722301 280
42 3300046530 Ga0495654_0019573 Ga0495654_0019573_838_1812 280
43 3300046542 Ga0495597_0000414 Ga0495597_0000414_17568_18539 280
44 3300047469 Ga0495673_0000069 Ga0495673_0000069_176317_177231 280
45 3300021361 Ga0213872_10006612 Ga0213872_100066127 281
46 3300039447 Ga0436361_1045937 Ga0436361_1045937_3256_4179 281
47 3300046452 Ga0495617_000075 Ga0495617_000075_35911_36882 281
48 3300047469 Ga0495673_0000203 Ga0495673_0000203_37385_38311 281
49 3300048929 Ga0496126_0002547 Ga0496126_0002547_14718_15644 281
50 3300031507 Ga0307509_10101550 Ga0307509_101015502 282
51 3300046558 Ga0495633_0013330 Ga0495633_0013330_2643_3593 282
52 3300046660 Ga0495625_0003515 Ga0495625_0003515_8223_9167 282
53 3300044672 Ga0466982_0026934 Ga0466982_0026934_485_1453 283
54 3300005330 Ga0070690_100074001 Ga0070690_1000740012 284
55 3300005340 Ga0070689_100000752 Ga0070689_1000007529 284
56 3300005365 Ga0070688_100113910 Ga0070688_1001139102 284
57 3300005438 Ga0070701_10007084 Ga0070701_100070847 284
58 3300005440 Ga0070705_100062270 Ga0070705_1000622702 284
59 3300005444 Ga0070694_100016769 Ga0070694_1000167693 284
60 3300005544 Ga0070686_100015477 Ga0070686_1000154773 284
61 3300005546 Ga0070696_100105039 Ga0070696_1001050393 284
62 3300005617 Ga0068859_100013256 Ga0068859_10001325610 284
63 3300005618 Ga0068864_100006517 Ga0068864_1000065178 284
64 3300005843 Ga0068860_100120483 Ga0068860_1001204833 284
65 3300005844 Ga0068862_100011762 Ga0068862_1000117628 284
66 3300006931 Ga0097620_100013256 Ga0097620_10001325610 284
67 3300017792 Ga0163161_10200309 Ga0163161_102003091 284
68 3300025936 Ga0207670_10012094 Ga0207670_100120941 284
69 3300026095 Ga0207676_10009441 Ga0207676_100094413 284
70 3300026118 Ga0207675_100003324 Ga0207675_10000332410 284
71 3300046491 Ga0495584_0017050 Ga0495584_0017050_2060_2941 284
72 3300046492 Ga0495585_0029986 Ga0495585_0029986_56_937 284
73 3300046501 Ga0495607_0035569 Ga0495607_0035569_427_1308 284
74 3300046665 Ga0495661_0028962 Ga0495661_0028962_1715_2677 284
75 3300046691 Ga0495670_0058971 Ga0495670_0058971_828_1709 284
76 3300046810 Ga0495660_0005117 Ga0495660_0005117_1253_2215 284
77 3300047320 Ga0495672_0115616 Ga0495672_0115616_451_1332 284
78 3300047323 Ga0495683_0009744 Ga0495683_0009744_2269_3231 284
79 3300047447 Ga0495685_000358 Ga0495685_000358_9562_10443 284
80 3300047472 Ga0495686_0069489 Ga0495686_0069489_166_1047 284
81 3300048925 Ga0496122_0011339 Ga0496122_0011339_6475_7437 284
82 3300049459 Ga0495678_006079 Ga0495678_006079_5564_6445 284
83 3300049460 Ga0495682_0000089 Ga0495682_0000089_35006_35887 284
84 3300053145 Ga0500586_015855 Ga0500586_015855_726_1688 284
85 3300028380 Ga0268265_10035781 Ga0268265_100357812 285
86 3300031456 Ga0307513_10038588 Ga0307513_100385886 285
87 3300046616 Ga0495668_0000647 Ga0495668_0000647_29079_30041 285
88 3300047446 Ga0495679_017214 Ga0495679_017214_1161_2123 285
89 3300048924 Ga0496121_0061832 Ga0496121_0061832_696_1658 285
90 3300044683 Ga0466965_0094155 Ga0466965_0094155_84_968 286
91 3300046471 Ga0495650_0000941 Ga0495650_0000941_25056_26009 286
92 3300046492 Ga0495585_0000898 Ga0495585_0000898_21958_22920 286
93 3300046660 Ga0495625_0000338 Ga0495625_0000338_20959_21912 286
94 3300005615 Ga0070702_100001985 Ga0070702_10000198511 287
95 3300046507 Ga0495606_0000223 Ga0495606_0000223_66623_67537 287
96 3300046512 Ga0495610_0002542 Ga0495610_0002542_3955_4869 287
97 3300046522 Ga0495643_0127968 Ga0495643_0127968_205_1119 287
98 3300046616 Ga0495668_0000286 Ga0495668_0000286_15408_16322 287
99 3300047472 Ga0495686_0058371 Ga0495686_0058371_454_1368 287
100 3300048924 Ga0496121_0027660 Ga0496121_0027660_432_1379 287
101 3300048926 Ga0496123_0003741 Ga0496123_0003741_14629_15573 287
102 3300003771 Ga0055526_1000079 Ga0055526_100007943 288
103 3300025295 Ga0209564_1000047 Ga0209564_1000047287 288
104 3300046501 Ga0495607_0015180 Ga0495607_0015180_610_1530 288
105 3300046558 Ga0495633_0008523 Ga0495633_0008523_528_1448 288
106 3300046810 Ga0495660_0002304 Ga0495660_0002304_9126_10049 288
107 3300047320 Ga0495672_0000013 Ga0495672_0000013_388912_389835 288
108 3300047318 Ga0495636_0094111 Ga0495636_0094111_345_1292 289
109 3300005615 Ga0070702_100185995 Ga0070702_1001859952 290
110 3300046512 Ga0495610_0039029 Ga0495610_0039029_154_1089 291
111 3300046558 Ga0495633_0001464 Ga0495633_0001464_4735_5670 291
112 3300053145 Ga0500586_000020 Ga0500586_000020_15549_16484 291
113 3300005293 Ga0065715_10022449 Ga0065715_100224492 292
114 3300037312 Ga0395899_0000098 Ga0395899_0000098_131440_132342 292
115 3300046452 Ga0495617_004015 Ga0495617_004015_4297_5187 292
116 3300046455 Ga0495603_0138199 Ga0495603_0138199_347_1246 292
117 3300046460 Ga0495638_0002515 Ga0495638_0002515_9426_10337 292
118 3300046491 Ga0495584_0000005 Ga0495584_0000005_263978_264868 292
119 3300046492 Ga0495585_0000023 Ga0495585_0000023_122625_123515 292
120 3300046492 Ga0495585_0007544 Ga0495585_0007544_404_1303 292
121 3300046492 Ga0495585_0038288 Ga0495585_0038288_1539_2450 292
122 3300046500 Ga0495596_0001453 Ga0495596_0001453_829_1740 292
123 3300046501 Ga0495607_0045664 Ga0495607_0045664_1594_2505 292
124 3300046507 Ga0495606_0034344 Ga0495606_0034344_2170_3060 292
125 3300046507 Ga0495606_0052926 Ga0495606_0052926_1278_2189 292
126 3300046513 Ga0495616_0001830 Ga0495616_0001830_146_1036 292
127 3300046513 Ga0495616_0056442 Ga0495616_0056442_415_1326 292
128 3300046518 Ga0495631_0041045 Ga0495631_0041045_1088_1987 292
129 3300046518 Ga0495631_0090995 Ga0495631_0090995_341_1252 292
130 3300046522 Ga0495643_0058716 Ga0495643_0058716_749_1660 292
131 3300046523 Ga0495644_0011540 Ga0495644_0011540_2321_3232 292
132 3300046524 Ga0495648_0000048 Ga0495648_0000048_2307_3197 292
133 3300046528 Ga0495642_0003370 Ga0495642_0003370_1659_2558 292
134 3300046528 Ga0495642_0071296 Ga0495642_0071296_213_1124 292
135 3300046535 Ga0495586_0251730 Ga0495586_0251730_19_918 292
136 3300046542 Ga0495597_0023061 Ga0495597_0023061_404_1303 292
137 3300046542 Ga0495597_0039839 Ga0495597_0039839_291_1202 292
138 3300046557 Ga0495622_0086935 Ga0495622_0086935_221_1120 292
139 3300046558 Ga0495633_0008839 Ga0495633_0008839_397_1296 292
140 3300046558 Ga0495633_0035138 Ga0495633_0035138_1395_2294 292
141 3300046616 Ga0495668_0002763 Ga0495668_0002763_3553_4452 292
142 3300046648 Ga0495611_0007319 Ga0495611_0007319_2736_3647 292
143 3300046660 Ga0495625_0084785 Ga0495625_0084785_388_1299 292
144 3300046665 Ga0495661_0045715 Ga0495661_0045715_1647_2546 292
145 3300046674 Ga0495588_0205768 Ga0495588_0205768_20_919 292
146 3300046684 Ga0495669_0008053 Ga0495669_0008053_1971_2870 292
147 3300046691 Ga0495670_0037082 Ga0495670_0037082_340_1239 292
148 3300046691 Ga0495670_0077640 Ga0495670_0077640_129_1028 292
149 3300046692 Ga0495671_0016066 Ga0495671_0016066_2099_2998 292
150 3300046794 Ga0495589_0007866 Ga0495589_0007866_3432_4331 292
151 3300047323 Ga0495683_0003414 Ga0495683_0003414_165_1055 292
152 3300047445 Ga0495677_0004483 Ga0495677_0004483_1088_1987 292
153 3300047445 Ga0495677_0084992 Ga0495677_0084992_261_1172 292
154 3300047447 Ga0495685_005195 Ga0495685_005195_2219_3130 292
155 3300047470 Ga0495681_0024402 Ga0495681_0024402_178_1089 292
156 3300047470 Ga0495681_0039527 Ga0495681_0039527_173_1072 292
157 3300047472 Ga0495686_0038247 Ga0495686_0038247_1559_2470 292
158 3300048091 Ga0495626_0004288 Ga0495626_0004288_1252_2154 292
159 3300048091 Ga0495626_0021798 Ga0495626_0021798_1819_2730 292
160 3300049460 Ga0495682_0005952 Ga0495682_0005952_1244_2155 292
161 3300044658 Ga0466972_0001052 Ga0466972_0001052_1129_2034 293
162 3300044683 Ga0466965_0001199 Ga0466965_0001199_8557_9462 293
163 3300044706 Ga0466964_0024999 Ga0466964_0024999_267_1178 293
164 3300044735 Ga0466968_0017032 Ga0466968_0017032_27_938 293
165 3300046507 Ga0495606_0003936 Ga0495606_0003936_7161_8108 293
166 3300048905 Ga0496102_0183514 Ga0496102_0183514_622_1569 293
167 iso_pu_bacteria 2857558681 2857559652 293
168 3300003771 Ga0055526_1000025 Ga0055526_100002519 294
169 3300009036 Ga0105244_10000891 Ga0105244_1000089110 294
170 3300025295 Ga0209564_1000027 Ga0209564_100002752 294
171 3300044712 Ga0453684_0000672 Ga0453684_0000672_26861_27784 295
172 3300045051 Ga0451576_0000268 Ga0451576_0000268_31691_32614 295
173 3300048927 Ga0496124_0016992 Ga0496124_0016992_698_1636 295
174 3300046692 Ga0495671_0000026 Ga0495671_0000026_205960_206898 296
175 3300046524 Ga0495648_0017106 Ga0495648_0017106_2855_3811 297
176 3300046615 Ga0495656_0058979 Ga0495656_0058979_348_1382 298
177 3300047447 Ga0495685_017981 Ga0495685_017981_470_1504 298
178 3300048090 Ga0495615_0027546 Ga0495615_0027546_37_1071 298
179 iso_pu_bacteria 2842711865 2842712114 299
180 3300009036 Ga0105244_10085440 Ga0105244_100854402 300
181 3300015261 Ga0182006_1000010 Ga0182006_1000010338 300
182 3300015262 Ga0182007_10000021 Ga0182007_10000021127 300
183 3300015265 Ga0182005_1000009 Ga0182005_100000945 300
184 3300046558 Ga0495633_0000070 Ga0495633_0000070_21739_22674 300
185 3300048091 Ga0495626_0000048 Ga0495626_0000048_32353_33333 300
186 3300048914 Ga0496111_0005924 Ga0496111_0005924_6850_7824 300
187 3300048919 Ga0496116_0016386 Ga0496116_0016386_3276_4250 300
188 3300048920 Ga0496117_0000010 Ga0496117_0000010_558214_559188 300
189 3300048921 Ga0496118_0000009 Ga0496118_0000009_52767_53741 300
190 3300048924 Ga0496121_0004497 Ga0496121_0004497_10461_11435 300
191 3300048925 Ga0496122_0001806 Ga0496122_0001806_15386_16360 300
192 3300048926 Ga0496123_0003318 Ga0496123_0003318_6283_7257 300
193 3300049459 Ga0495678_000431 Ga0495678_000431_12775_13707 300
194 3300049459 Ga0495678_011806 Ga0495678_011806_1301_2239 300
195 iso_pu_bacteria 2857553236 2857557783 300
196 iso_pu_bacteria 2857564685 2857568250 300
197 3300021361 Ga0213872_10000400 Ga0213872_1000040020 302
198 3300039447 Ga0436361_0886293 Ga0436361_0886293_6860_7792 302
199 3300014497 Ga0182008_10001391 Ga0182008_100013919 303
200 3300046660 Ga0495625_0081944 Ga0495625_0081944_1149_2060 303
201 3300048928 Ga0496125_0052581 Ga0496125_0052581_317_1291 303
202 3300025245 Ga0207425_1000433 Ga0207425_100043312 304
203 3300025294 Ga0209025_1006403 Ga0209025_10064034 304
204 3300025297 Ga0209758_1000436 Ga0209758_100043663 304
205 3300035114 Ga0373939_0021701 Ga0373939_0021701_291_1211 304
206 3300046471 Ga0495650_0000082 Ga0495650_0000082_92058_93005 304
207 3300046474 Ga0495605_0000098 Ga0495605_0000098_56347_57267 304
208 3300046810 Ga0495660_0000538 Ga0495660_0000538_8466_9398 304
209 3300047470 Ga0495681_0005768 Ga0495681_0005768_5432_6373 304
210 3300048910 Ga0496107_0078563 Ga0496107_0078563_587_1504 304
211 3300049459 Ga0495678_000010 Ga0495678_000010_68341_69270 304
212 3300046520 Ga0495637_0072522 Ga0495637_0072522_323_1273 305
213 3300046524 Ga0495648_0018583 Ga0495648_0018583_1105_2052 305
214 3300046616 Ga0495668_0030139 Ga0495668_0030139_202_1161 305
215 iso_pu_bacteria 2738541297 2738827030 305
216 iso_pu_bacteria 2738541357 2739150827 305
217 iso_pu_bacteria 2738543003 2739192746 305
218 iso_pu_bacteria 2738543026 2739319223 305
219 iso_pu_bacteria 2738543029 2739337464 305
220 3300046463 Ga0495653_0000044 Ga0495653_0000044_36560_37489 306
221 3300046507 Ga0495606_0000099 Ga0495606_0000099_36824_37753 306
222 iso_pu_bacteria 2600255292 2601666763 306
223 iso_pu_bacteria 2857547612 2857548529 306
224 iso_pu_bacteria 2885080285 2885082614 306
225 iso_pu_bacteria 2932410948 2932413123 306
226 iso_pu_bacteria 2932416698 2932420638 306
227 3300046522 Ga0495643_0000209 Ga0495643_0000209_9087_10037 307
228 3300046542 Ga0495597_0000017 Ga0495597_0000017_155402_156352 307
229 3300046810 Ga0495660_0001587 Ga0495660_0001587_5759_6718 307
230 3300048905 Ga0496102_0000279 Ga0496102_0000279_10818_11867 307
231 3300048906 Ga0496103_0024210 Ga0496103_0024210_1431_2480 307
232 3300046525 Ga0495663_0011050 Ga0495663_0011050_296_1267 311
233 3300047445 Ga0495677_0112194 Ga0495677_0112194_29_997 311
234 3300003322 rootL2_10044694 rootL2_100446945 312
235 3300003322 rootL2_10044693 rootL2_100446935 313
236 3300003323 rootH1_10347125 rootH1_103471253 313
237 3300003763 Ga0055529_1000152 Ga0055529_100015246 313
238 3300025233 Ga0209437_107045 Ga0209437_1070452 313
239 3300025261 Ga0209233_1041113 Ga0209233_10411131 313
240 3300025272 Ga0209455_1000070 Ga0209455_100007049 313

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09935

DUF2167

Protein of unknown function (DUF2167)

62

291

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rcd-assembly2.cif.gz_C crystal structure of a protein with unknown function from duf3225 family (eca3500) from pectobacterium atrosepticum scri1043 at 2.32 a resolution 0.7165 148 202
5tsh-assembly1.cif.gz_E pilb from geobacter metallireducens bound to amp-pnp 0.7089 156 200
4luq-assembly2.cif.gz_D crystal structure of virulence effector tse3 in complex with neutralizer tsi3 0.6788 39 202
7tdz-assembly1.cif.gz_a cryo-em model of protomer of the cytoplasmic ring of the nuclear pore complex from xenopus laevis 0.638 148 188
2owp-assembly1.cif.gz_B crystal structure of a cystatin-like fold protein (bxe_b1374) from burkholderia xenovorans lb400 at 2.00 a resolution 0.6339 148 202
ID Description Score Start End Superfamily
af_P45759_80_213_3.30.450.90 Alpha Beta;2-Layer Sandwich;Beta-Lactamase; 0.8276 163 200 3.30.450.90
3lygA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7199 148 194 3.10.450.50
af_Q4CTR6_67_183_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7155 148 188 3.10.450.50
5tshE01 Alpha Beta;2-Layer Sandwich;Beta-Lactamase; 0.6972 156 198 3.30.450.90
af_P32586_424_706_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.6963 146 184 3.90.190.10
ID Description Score Start End GO Terms
AF-A0A0C1KWQ7-F1-model_v4 DUF2167 domain-containing protein 0.9489 30 252 GO:0016020
AF-A0A4Q6DQC4-F1-model_v4 deleted 0.945 12 241
AF-A0A6M6BE11-F1-model_v4 DUF2167 domain-containing protein 0.9445 34 188
AF-A0A2N8EVE6-F1-model_v4 deleted 0.9284 152 235
AF-A0A6M6BE11-F1-model_v4 DUF2167 domain-containing protein 0.9271 34 188

Feature Viewer

pLDDT pTM Quality
78.65 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map