F353066
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 240 | 43 | 480 | 232 |
Family's Representative Sequence
| Representative Sequence | 3300038726|Ga0400490_37674|Ga0400490_37674_64129_64914 |
| Length | 261 |
| Sequence | MNSWMAAWDTASAPDINPNKEKTKKMTKEIILVVDDEEDILELVRFNLSREGFTILCAATGEAAWDLLKTQRVDLLVLDLMLPGMDGLELARRLKSEPRTQAVPIVMLSAKGEESDIVAGLELGADDYVTKPFSPRVLTARVRAVLRRLTQPEKAEEEVLEIYDLMIDSGRRSVTVDGHSVDLTYTEFQVLSFLARRPGWVFTRTQIVDAVRGDDYPVTDRSVDVQIVGLRKKLGASGHYIETVRGVGYRFKEKAPSEQTH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 2 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 3 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 4 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 5 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 6 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 7 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 8 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 9 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 10 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 11 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 12 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 13 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 14 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 15 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 16 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 17 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 18 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 19 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 20 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 21 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 22 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 23 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 24 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 25 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 26 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 27 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 28 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 29 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 30 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 31 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 32 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 33 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 34 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 35 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 36 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 37 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 38 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 39 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 40 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 41 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 42 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 43 | 2740891818 | Desulfofaba hansenii DSM 12642 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.75 |
| Metatranscriptomes | 0.83 |
| Isolates | 0.42 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 80 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.25 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0400490_37674 | 3300038726 | Bacteria | 71589 |
| 2 | Ga0070690_100265899 | 3300005330 | Bacteria | 1218 |
| 3 | Ga0070679_100064126 | 3300005530 | Bacteria | 3662 |
| 4 | Ga0068859_100182391 | 3300005617 | Bacteria | 2182 |
| 5 | Ga0097620_100182393 | 3300006931 | Bacteria | 2182 |
| 6 | Ga0268265_10261393 | 3300028380 | Bacteria | 1539 |
| 7 | Ga0265330_10008961 | 3300031235 | Bacteria | 4776 |
| 8 | Ga0265332_10105669 | 3300031238 | Bacteria | 1187 |
| 9 | Ga0265339_10009606 | 3300031249 | Bacteria | 6058 |
| 10 | Ga0265327_10050011 | 3300031251 | Bacteria | 2190 |
| 11 | Ga0265316_10000273 | 3300031344 | Bacteria | 58040 |
| 12 | Ga0265316_10194971 | 3300031344 | Bacteria | 1503 |
| 13 | Ga0316575_10000780 | 3300031665 | Bacteria | 9648 |
| 14 | Ga0316575_10001079 | 3300031665 | Bacteria | 8492 |
| 15 | Ga0316575_10006646 | 3300031665 | Bacteria | 4169 |
| 16 | Ga0316575_10010227 | 3300031665 | Bacteria | 3440 |
| 17 | Ga0316575_10015978 | 3300031665 | Bacteria | 2834 |
| 18 | Ga0316575_10044358 | 3300031665 | Bacteria | 1764 |
| 19 | Ga0316575_10046216 | 3300031665 | Bacteria | 1729 |
| 20 | Ga0316575_10230662 | 3300031665 | Bacteria | 774 |
| 21 | Ga0316579_10007334 | 3300031691 | Bacteria | 4550 |
| 22 | Ga0316579_10007421 | 3300031691 | Bacteria | 4527 |
| 23 | Ga0316579_10008248 | 3300031691 | Bacteria | 4338 |
| 24 | Ga0316579_10024702 | 3300031691 | Bacteria | 2707 |
| 25 | Ga0316579_10027158 | 3300031691 | Bacteria | 2597 |
| 26 | Ga0316579_10055508 | 3300031691 | Bacteria | 1857 |
| 27 | Ga0316579_10081740 | 3300031691 | Bacteria | 1538 |
| 28 | Ga0265314_10000988 | 3300031711 | Bacteria | 33412 |
| 29 | Ga0265314_10199728 | 3300031711 | Bacteria | 1183 |
| 30 | Ga0265342_10022531 | 3300031712 | Bacteria | 4002 |
| 31 | Ga0316576_10013344 | 3300031727 | Bacteria | 5457 |
| 32 | Ga0316576_10015092 | 3300031727 | Bacteria | 5175 |
| 33 | Ga0316576_10023344 | 3300031727 | Bacteria | 4306 |
| 34 | Ga0316576_10028902 | 3300031727 | Bacteria | 3913 |
| 35 | Ga0316576_10029594 | 3300031727 | Bacteria | 3873 |
| 36 | Ga0316576_10032008 | 3300031727 | Bacteria | 3736 |
| 37 | Ga0316576_10038827 | 3300031727 | Bacteria | 3416 |
| 38 | Ga0316576_10055272 | 3300031727 | Bacteria | 2897 |
| 39 | Ga0316576_10064120 | 3300031727 | Bacteria | 2698 |
| 40 | Ga0316576_10065489 | 3300031727 | Bacteria | 2671 |
| 41 | Ga0316576_10097444 | 3300031727 | Bacteria | 2195 |
| 42 | Ga0316576_10104185 | 3300031727 | Bacteria | 2123 |
| 43 | Ga0316576_10105393 | 3300031727 | Bacteria | 2110 |
| 44 | Ga0316576_10127479 | 3300031727 | Bacteria | 1913 |
| 45 | Ga0316576_10141164 | 3300031727 | Unclassified | 1814 |
| 46 | Ga0316576_10172943 | 3300031727 | Bacteria | 1630 |
| 47 | Ga0316576_10177003 | 3300031727 | Bacteria | 1609 |
| 48 | Ga0316576_10204738 | 3300031727 | Bacteria | 1486 |
| 49 | Ga0316576_10251304 | 3300031727 | Bacteria | 1327 |
| 50 | Ga0316578_10000641 | 3300031728 | Bacteria | 12380 |
| 51 | Ga0316578_10013290 | 3300031728 | Bacteria | 4363 |
| 52 | Ga0316578_10019525 | 3300031728 | Bacteria | 3732 |
| 53 | Ga0316578_10025949 | 3300031728 | Bacteria | 3301 |
| 54 | Ga0316578_10026240 | 3300031728 | Bacteria | 3283 |
| 55 | Ga0316578_10026615 | 3300031728 | Bacteria | 3263 |
| 56 | Ga0316578_10029284 | 3300031728 | Bacteria | 3125 |
| 57 | Ga0316578_10029987 | 3300031728 | Bacteria | 3089 |
| 58 | Ga0316578_10032358 | 3300031728 | Bacteria | 2987 |
| 59 | Ga0316578_10039951 | 3300031728 | Bacteria | 2710 |
| 60 | Ga0316578_10092089 | 3300031728 | Bacteria | 1811 |
| 61 | Ga0316578_10121044 | 3300031728 | Bacteria | 1573 |
| 62 | Ga0316578_10125062 | 3300031728 | Bacteria | 1546 |
| 63 | Ga0316578_10234433 | 3300031728 | Bacteria | 1102 |
| 64 | Ga0316578_10328959 | 3300031728 | Bacteria | 911 |
| 65 | Ga0316577_10000520 | 3300031733 | Bacteria | 15441 |
| 66 | Ga0316577_10008742 | 3300031733 | Bacteria | 5429 |
| 67 | Ga0316577_10010729 | 3300031733 | Bacteria | 4951 |
| 68 | Ga0316577_10010825 | 3300031733 | Bacteria | 4931 |
| 69 | Ga0316577_10016296 | 3300031733 | Bacteria | 4094 |
| 70 | Ga0316577_10017415 | 3300031733 | Bacteria | 3966 |
| 71 | Ga0316577_10046037 | 3300031733 | Bacteria | 2437 |
| 72 | Ga0316577_10063726 | 3300031733 | Bacteria | 2058 |
| 73 | Ga0316577_10094528 | 3300031733 | Bacteria | 1674 |
| 74 | Ga0316577_10100353 | 3300031733 | Bacteria | 1622 |
| 75 | Ga0316577_10137771 | 3300031733 | Bacteria | 1374 |
| 76 | Ga0316577_10311150 | 3300031733 | Bacteria | 893 |
| 77 | Ga0316577_10312299 | 3300031733 | Bacteria | 891 |
| 78 | Ga0316583_10001368 | 3300032133 | Bacteria | 8095 |
| 79 | Ga0316583_10006020 | 3300032133 | Bacteria | 4357 |
| 80 | Ga0316583_10011393 | 3300032133 | Bacteria | 3206 |
| 81 | Ga0316583_10013688 | 3300032133 | Bacteria | 2928 |
| 82 | Ga0316583_10014351 | 3300032133 | Bacteria | 2858 |
| 83 | Ga0316583_10018199 | 3300032133 | Bacteria | 2522 |
| 84 | Ga0316583_10029172 | 3300032133 | Bacteria | 1967 |
| 85 | Ga0316583_10032559 | 3300032133 | Bacteria | 1853 |
| 86 | Ga0316583_10035940 | 3300032133 | Bacteria | 1759 |
| 87 | Ga0316583_10045197 | 3300032133 | Bacteria | 1555 |
| 88 | Ga0316583_10048062 | 3300032133 | Bacteria | 1503 |
| 89 | Ga0316583_10059474 | 3300032133 | Bacteria | 1340 |
| 90 | Ga0316585_10004091 | 3300032137 | Bacteria | 4047 |
| 91 | Ga0316585_10005804 | 3300032137 | Bacteria | 3497 |
| 92 | Ga0316585_10009059 | 3300032137 | Bacteria | 2894 |
| 93 | Ga0316585_10010114 | 3300032137 | Bacteria | 2763 |
| 94 | Ga0316585_10034502 | 3300032137 | Bacteria | 1599 |
| 95 | Ga0316585_10049699 | 3300032137 | Bacteria | 1345 |
| 96 | Ga0316585_10055524 | 3300032137 | Bacteria | 1274 |
| 97 | Ga0316580_10002544 | 3300032139 | Bacteria | 5041 |
| 98 | Ga0316580_10005277 | 3300032139 | Bacteria | 3766 |
| 99 | Ga0316580_10006156 | 3300032139 | Bacteria | 3533 |
| 100 | Ga0316580_10007198 | 3300032139 | Bacteria | 3307 |
| 101 | Ga0316580_10009485 | 3300032139 | Bacteria | 2925 |
| 102 | Ga0316580_10011759 | 3300032139 | Bacteria | 2660 |
| 103 | Ga0316580_10025629 | 3300032139 | Bacteria | 1824 |
| 104 | Ga0316580_10059340 | 3300032139 | Bacteria | 1175 |
| 105 | Ga0316580_10065139 | 3300032139 | Bacteria | 1118 |
| 106 | Ga0316593_10000667 | 3300032168 | Bacteria | 6635 |
| 107 | Ga0316593_10062489 | 3300032168 | Bacteria | 1275 |
| 108 | Ga0316574_0000019 | 3300035398 | Bacteria | 40791 |
| 109 | Ga0316574_0003897 | 3300035398 | Bacteria | 7753 |
| 110 | Ga0316574_0004593 | 3300035398 | Bacteria | 7257 |
| 111 | Ga0316574_0005538 | 3300035398 | Bacteria | 6740 |
| 112 | Ga0316574_0007526 | 3300035398 | Bacteria | 5974 |
| 113 | Ga0316574_0010254 | 3300035398 | Bacteria | 5285 |
| 114 | Ga0316574_0017470 | 3300035398 | Bacteria | 4199 |
| 115 | Ga0316574_0023691 | 3300035398 | Bacteria | 3667 |
| 116 | Ga0316574_0040352 | 3300035398 | Bacteria | 2874 |
| 117 | Ga0316574_0059090 | 3300035398 | Bacteria | 2403 |
| 118 | Ga0316574_0102983 | 3300035398 | Bacteria | 1827 |
| 119 | Ga0316574_0122079 | 3300035398 | Bacteria | 1673 |
| 120 | Ga0316574_0155461 | 3300035398 | Bacteria | 1473 |
| 121 | Ga0316574_0161758 | 3300035398 | Bacteria | 1441 |
| 122 | Ga0373933_0218294 | 3300035724 | Bacteria | 1223 |
| 123 | Ga0373937_0369067 | 3300036401 | Bacteria | 1361 |
| 124 | Ga0316582_0002365 | 3300036647 | Bacteria | 8839 |
| 125 | Ga0316582_0005821 | 3300036647 | Bacteria | 6402 |
| 126 | Ga0316582_0017434 | 3300036647 | Bacteria | 4155 |
| 127 | Ga0316582_0025780 | 3300036647 | Bacteria | 3533 |
| 128 | Ga0316582_0031715 | 3300036647 | Bacteria | 3232 |
| 129 | Ga0316582_0034947 | 3300036647 | Bacteria | 3099 |
| 130 | Ga0316582_0036032 | 3300036647 | Bacteria | 3059 |
| 131 | Ga0316582_0036071 | 3300036647 | Bacteria | 3058 |
| 132 | Ga0316582_0043068 | 3300036647 | Bacteria | 2831 |
| 133 | Ga0316582_0054388 | 3300036647 | Bacteria | 2548 |
| 134 | Ga0316582_0075178 | 3300036647 | Bacteria | 2194 |
| 135 | Ga0316582_0098592 | 3300036647 | Bacteria | 1933 |
| 136 | Ga0316582_0162677 | 3300036647 | Bacteria | 1512 |
| 137 | Ga0316582_0255629 | 3300036647 | Bacteria | 1201 |
| 138 | Ga0316582_0375341 | 3300036647 | Bacteria | 979 |
| 139 | Ga0316584_0000209 | 3300036712 | Bacteria | 28838 |
| 140 | Ga0316584_0000241 | 3300036712 | Bacteria | 27284 |
| 141 | Ga0316584_0000858 | 3300036712 | Bacteria | 17246 |
| 142 | Ga0316584_0006228 | 3300036712 | Bacteria | 8079 |
| 143 | Ga0316584_0014914 | 3300036712 | Bacteria | 5550 |
| 144 | Ga0316584_0015605 | 3300036712 | Bacteria | 5433 |
| 145 | Ga0316584_0017418 | 3300036712 | Bacteria | 5164 |
| 146 | Ga0316584_0023627 | 3300036712 | Bacteria | 4491 |
| 147 | Ga0316584_0039065 | 3300036712 | Bacteria | 3532 |
| 148 | Ga0316584_0047197 | 3300036712 | Bacteria | 3217 |
| 149 | Ga0316584_0063920 | 3300036712 | Bacteria | 2755 |
| 150 | Ga0316584_0089674 | 3300036712 | Unclassified | 2302 |
| 151 | Ga0316584_0105379 | 3300036712 | Bacteria | 2110 |
| 152 | Ga0316584_0143415 | 3300036712 | Bacteria | 1780 |
| 153 | Ga0316584_0149004 | 3300036712 | Bacteria | 1743 |
| 154 | Ga0316584_0171582 | 3300036712 | Bacteria | 1608 |
| 155 | Ga0316584_0590865 | 3300036712 | Bacteria | 771 |
| 156 | Ga0316581_0007662 | 3300037588 | Bacteria | 2908 |
| 157 | Ga0316581_0020308 | 3300037588 | Bacteria | 1945 |
| 158 | Ga0316581_0058579 | 3300037588 | Bacteria | 1181 |
| 159 | Ga0316581_0071443 | 3300037588 | Bacteria | 1066 |
| 160 | Ga0400484_39203 | 3300038725 | Bacteria | 17902 |
| 161 | Ga0400484_45010 | 3300038725 | Bacteria | 3342 |
| 162 | Ga0400490_40909 | 3300038726 | Bacteria | 4483 |
| 163 | Ga0400490_45908 | 3300038726 | Bacteria | 1386 |
| 164 | Ga0400490_50261 | 3300038726 | Bacteria | 2937 |
| 165 | Ga0400490_59445 | 3300038726 | Bacteria | 1025 |
| 166 | Ga0400491_13551 | 3300038727 | Bacteria | 10986 |
| 167 | Ga0400491_16505 | 3300038727 | Bacteria | 8997 |
| 168 | Ga0400491_19594 | 3300038727 | Bacteria | 5116 |
| 169 | Ga0400485_06711 | 3300038735 | Bacteria | 12158 |
| 170 | Ga0400485_08453 | 3300038735 | Bacteria | 5553 |
| 171 | Ga0400485_12678 | 3300038735 | Bacteria | 46924 |
| 172 | Ga0400485_20719 | 3300038735 | Bacteria | 18353 |
| 173 | Ga0400488_02745 | 3300038741 | Bacteria | 1766 |
| 174 | Ga0400488_17213 | 3300038741 | Bacteria | 15970 |
| 175 | Ga0400488_35570 | 3300038741 | Bacteria | 7138 |
| 176 | Ga0400488_63171 | 3300038741 | Bacteria | 3682 |
| 177 | Ga0400486_02119 | 3300038742 | Bacteria | 14138 |
| 178 | Ga0400486_06275 | 3300038742 | Bacteria | 24765 |
| 179 | Ga0400486_12309 | 3300038742 | Bacteria | 67151 |
| 180 | Ga0400486_28288 | 3300038742 | Bacteria | 4008 |
| 181 | Ga0400486_30562 | 3300038742 | Bacteria | 6547 |
| 182 | Ga0400483_000434 | 3300039062 | Bacteria | 7986 |
| 183 | Ga0400483_032995 | 3300039062 | Bacteria | 6891 |
| 184 | Ga0400483_057521 | 3300039062 | Bacteria | 4013 |
| 185 | Ga0400483_099912 | 3300039062 | Bacteria | 96888 |
| 186 | Ga0400483_155385 | 3300039062 | Bacteria | 1145 |
| 187 | Ga0400483_161689 | 3300039062 | Bacteria | 11160 |
| 188 | Ga0400483_192105 | 3300039062 | Bacteria | 7401 |
| 189 | Ga0400483_219077 | 3300039062 | Bacteria | 6774 |
| 190 | Ga0400483_250011 | 3300039062 | Bacteria | 6692 |
| 191 | Ga0400483_260905 | 3300039062 | Bacteria | 2627 |
| 192 | Ga0400483_267354 | 3300039062 | Bacteria | 1416 |
| 193 | Ga0400489_06127 | 3300039093 | Bacteria | 80653 |
| 194 | Ga0400489_21020 | 3300039093 | Bacteria | 35098 |
| 195 | Ga0400489_28513 | 3300039093 | Bacteria | 7928 |
| 196 | Ga0400489_44975 | 3300039093 | Bacteria | 10823 |
| 197 | Ga0400489_49215 | 3300039093 | Bacteria | 1805 |
| 198 | Ga0400489_51496 | 3300039093 | Bacteria | 14088 |
| 199 | Ga0400487_04507 | 3300039110 | Bacteria | 5595 |
| 200 | Ga0400487_46191 | 3300039110 | Bacteria | 22422 |
| 201 | Ga0400487_57257 | 3300039110 | Bacteria | 2822 |
| 202 | Ga0400487_57726 | 3300039110 | Bacteria | 6039 |
| 203 | Ga0451577_0000143 | 3300042876 | Bacteria | 158858 |
| 204 | Ga0451577_0000888 | 3300042876 | Bacteria | 44399 |
| 205 | Ga0451577_0005666 | 3300042876 | Bacteria | 12687 |
| 206 | Ga0451577_0064533 | 3300042876 | Bacteria | 3265 |
| 207 | Ga0451577_0095550 | 3300042876 | Bacteria | 2654 |
| 208 | Ga0451577_0245784 | 3300042876 | Bacteria | 1619 |
| 209 | Ga0451577_0450932 | 3300042876 | Unclassified | 1168 |
| 210 | Ga0453683_0000843 | 3300044673 | Bacteria | 29670 |
| 211 | Ga0453683_0023476 | 3300044673 | Bacteria | 3931 |
| 212 | Ga0453683_0078552 | 3300044673 | Bacteria | 2067 |
| 213 | Ga0453683_0082079 | 3300044673 | Bacteria | 2020 |
| 214 | Ga0453684_0000022 | 3300044712 | Bacteria | 860785 |
| 215 | Ga0453684_0000239 | 3300044712 | Bacteria | 235992 |
| 216 | Ga0453684_0000678 | 3300044712 | Bacteria | 122005 |
| 217 | Ga0453684_0001304 | 3300044712 | Bacteria | 73967 |
| 218 | Ga0453684_0001668 | 3300044712 | Bacteria | 60142 |
| 219 | Ga0453684_0001920 | 3300044712 | Bacteria | 53891 |
| 220 | Ga0453684_0009972 | 3300044712 | Bacteria | 16373 |
| 221 | Ga0453684_0011708 | 3300044712 | Bacteria | 14631 |
| 222 | Ga0453684_0034586 | 3300044712 | Bacteria | 7010 |
| 223 | Ga0453684_0071169 | 3300044712 | Bacteria | 4399 |
| 224 | Ga0453684_0072569 | 3300044712 | Bacteria | 4345 |
| 225 | Ga0453684_0131315 | 3300044712 | Bacteria | 3004 |
| 226 | Ga0453684_0165456 | 3300044712 | Bacteria | 2611 |
| 227 | Ga0453684_0316601 | 3300044712 | Bacteria | 1768 |
| 228 | Ga0453684_0572677 | 3300044712 | Bacteria | 1241 |
| 229 | Ga0453684_0598108 | 3300044712 | Bacteria | 1209 |
| 230 | Ga0453684_0615567 | 3300044712 | Bacteria | 1189 |
| 231 | Ga0451576_0000074 | 3300045051 | Bacteria | 248280 |
| 232 | Ga0451576_0000238 | 3300045051 | Bacteria | 134437 |
| 233 | Ga0451576_0000306 | 3300045051 | Bacteria | 119031 |
| 234 | Ga0451576_0127222 | 3300045051 | Bacteria | 2655 |
| 235 | Ga0451576_0691941 | 3300045051 | Bacteria | 1071 |
| 236 | Ga0451576_0996316 | 3300045051 | Bacteria | 878 |
| 237 | Ga0496125_0000899 | 3300048928 | Bacteria | 47036 |
| 238 | Ga0496125_0010310 | 3300048928 | Bacteria | 9461 |
| 239 | Ga0496126_0060497 | 3300048929 | Bacteria | 3406 |
| 240 | 2740992456 | 2740891818 | Bacteria | 6711283 |
| 241 | Ga0400490_37674 | |||
| 242 | Ga0070690_100265899 | |||
| 243 | Ga0070679_100064126 | |||
| 244 | Ga0068859_100182391 | |||
| 245 | Ga0097620_100182393 | |||
| 246 | Ga0268265_10261393 | |||
| 247 | Ga0265330_10008961 | |||
| 248 | Ga0265332_10105669 | |||
| 249 | Ga0265339_10009606 | |||
| 250 | Ga0265327_10050011 | |||
| 251 | Ga0265316_10000273 | |||
| 252 | Ga0265316_10194971 | |||
| 253 | Ga0316575_10000780 | |||
| 254 | Ga0316575_10001079 | |||
| 255 | Ga0316575_10006646 | |||
| 256 | Ga0316575_10010227 | |||
| 257 | Ga0316575_10015978 | |||
| 258 | Ga0316575_10044358 | |||
| 259 | Ga0316575_10046216 | |||
| 260 | Ga0316575_10230662 | |||
| 261 | Ga0316579_10007334 | |||
| 262 | Ga0316579_10007421 | |||
| 263 | Ga0316579_10008248 | |||
| 264 | Ga0316579_10024702 | |||
| 265 | Ga0316579_10027158 | |||
| 266 | Ga0316579_10055508 | |||
| 267 | Ga0316579_10081740 | |||
| 268 | Ga0265314_10000988 | |||
| 269 | Ga0265314_10199728 | |||
| 270 | Ga0265342_10022531 | |||
| 271 | Ga0316576_10013344 | |||
| 272 | Ga0316576_10015092 | |||
| 273 | Ga0316576_10023344 | |||
| 274 | Ga0316576_10028902 | |||
| 275 | Ga0316576_10029594 | |||
| 276 | Ga0316576_10032008 | |||
| 277 | Ga0316576_10038827 | |||
| 278 | Ga0316576_10055272 | |||
| 279 | Ga0316576_10064120 | |||
| 280 | Ga0316576_10065489 | |||
| 281 | Ga0316576_10097444 | |||
| 282 | Ga0316576_10104185 | |||
| 283 | Ga0316576_10105393 | |||
| 284 | Ga0316576_10127479 | |||
| 285 | Ga0316576_10141164 | |||
| 286 | Ga0316576_10172943 | |||
| 287 | Ga0316576_10177003 | |||
| 288 | Ga0316576_10204738 | |||
| 289 | Ga0316576_10251304 | |||
| 290 | Ga0316578_10000641 | |||
| 291 | Ga0316578_10013290 | |||
| 292 | Ga0316578_10019525 | |||
| 293 | Ga0316578_10025949 | |||
| 294 | Ga0316578_10026240 | |||
| 295 | Ga0316578_10026615 | |||
| 296 | Ga0316578_10029284 | |||
| 297 | Ga0316578_10029987 | |||
| 298 | Ga0316578_10032358 | |||
| 299 | Ga0316578_10039951 | |||
| 300 | Ga0316578_10092089 | |||
| 301 | Ga0316578_10121044 | |||
| 302 | Ga0316578_10125062 | |||
| 303 | Ga0316578_10234433 | |||
| 304 | Ga0316578_10328959 | |||
| 305 | Ga0316577_10000520 | |||
| 306 | Ga0316577_10008742 | |||
| 307 | Ga0316577_10010729 | |||
| 308 | Ga0316577_10010825 | |||
| 309 | Ga0316577_10016296 | |||
| 310 | Ga0316577_10017415 | |||
| 311 | Ga0316577_10046037 | |||
| 312 | Ga0316577_10063726 | |||
| 313 | Ga0316577_10094528 | |||
| 314 | Ga0316577_10100353 | |||
| 315 | Ga0316577_10137771 | |||
| 316 | Ga0316577_10311150 | |||
| 317 | Ga0316577_10312299 | |||
| 318 | Ga0316583_10001368 | |||
| 319 | Ga0316583_10006020 | |||
| 320 | Ga0316583_10011393 | |||
| 321 | Ga0316583_10013688 | |||
| 322 | Ga0316583_10014351 | |||
| 323 | Ga0316583_10018199 | |||
| 324 | Ga0316583_10029172 | |||
| 325 | Ga0316583_10032559 | |||
| 326 | Ga0316583_10035940 | |||
| 327 | Ga0316583_10045197 | |||
| 328 | Ga0316583_10048062 | |||
| 329 | Ga0316583_10059474 | |||
| 330 | Ga0316585_10004091 | |||
| 331 | Ga0316585_10005804 | |||
| 332 | Ga0316585_10009059 | |||
| 333 | Ga0316585_10010114 | |||
| 334 | Ga0316585_10034502 | |||
| 335 | Ga0316585_10049699 | |||
| 336 | Ga0316585_10055524 | |||
| 337 | Ga0316580_10002544 | |||
| 338 | Ga0316580_10005277 | |||
| 339 | Ga0316580_10006156 | |||
| 340 | Ga0316580_10007198 | |||
| 341 | Ga0316580_10009485 | |||
| 342 | Ga0316580_10011759 | |||
| 343 | Ga0316580_10025629 | |||
| 344 | Ga0316580_10059340 | |||
| 345 | Ga0316580_10065139 | |||
| 346 | Ga0316593_10000667 | |||
| 347 | Ga0316593_10062489 | |||
| 348 | Ga0316574_0000019 | |||
| 349 | Ga0316574_0003897 | |||
| 350 | Ga0316574_0004593 | |||
| 351 | Ga0316574_0005538 | |||
| 352 | Ga0316574_0007526 | |||
| 353 | Ga0316574_0010254 | |||
| 354 | Ga0316574_0017470 | |||
| 355 | Ga0316574_0023691 | |||
| 356 | Ga0316574_0040352 | |||
| 357 | Ga0316574_0059090 | |||
| 358 | Ga0316574_0102983 | |||
| 359 | Ga0316574_0122079 | |||
| 360 | Ga0316574_0155461 | |||
| 361 | Ga0316574_0161758 | |||
| 362 | Ga0373933_0218294 | |||
| 363 | Ga0373937_0369067 | |||
| 364 | Ga0316582_0002365 | |||
| 365 | Ga0316582_0005821 | |||
| 366 | Ga0316582_0017434 | |||
| 367 | Ga0316582_0025780 | |||
| 368 | Ga0316582_0031715 | |||
| 369 | Ga0316582_0034947 | |||
| 370 | Ga0316582_0036032 | |||
| 371 | Ga0316582_0036071 | |||
| 372 | Ga0316582_0043068 | |||
| 373 | Ga0316582_0054388 | |||
| 374 | Ga0316582_0075178 | |||
| 375 | Ga0316582_0098592 | |||
| 376 | Ga0316582_0162677 | |||
| 377 | Ga0316582_0255629 | |||
| 378 | Ga0316582_0375341 | |||
| 379 | Ga0316584_0000209 | |||
| 380 | Ga0316584_0000241 | |||
| 381 | Ga0316584_0000858 | |||
| 382 | Ga0316584_0006228 | |||
| 383 | Ga0316584_0014914 | |||
| 384 | Ga0316584_0015605 | |||
| 385 | Ga0316584_0017418 | |||
| 386 | Ga0316584_0023627 | |||
| 387 | Ga0316584_0039065 | |||
| 388 | Ga0316584_0047197 | |||
| 389 | Ga0316584_0063920 | |||
| 390 | Ga0316584_0089674 | |||
| 391 | Ga0316584_0105379 | |||
| 392 | Ga0316584_0143415 | |||
| 393 | Ga0316584_0149004 | |||
| 394 | Ga0316584_0171582 | |||
| 395 | Ga0316584_0590865 | |||
| 396 | Ga0316581_0007662 | |||
| 397 | Ga0316581_0020308 | |||
| 398 | Ga0316581_0058579 | |||
| 399 | Ga0316581_0071443 | |||
| 400 | Ga0400484_39203 | |||
| 401 | Ga0400484_45010 | |||
| 402 | Ga0400490_40909 | |||
| 403 | Ga0400490_45908 | |||
| 404 | Ga0400490_50261 | |||
| 405 | Ga0400490_59445 | |||
| 406 | Ga0400491_13551 | |||
| 407 | Ga0400491_16505 | |||
| 408 | Ga0400491_19594 | |||
| 409 | Ga0400485_06711 | |||
| 410 | Ga0400485_08453 | |||
| 411 | Ga0400485_12678 | |||
| 412 | Ga0400485_20719 | |||
| 413 | Ga0400488_02745 | |||
| 414 | Ga0400488_17213 | |||
| 415 | Ga0400488_35570 | |||
| 416 | Ga0400488_63171 | |||
| 417 | Ga0400486_02119 | |||
| 418 | Ga0400486_06275 | |||
| 419 | Ga0400486_12309 | |||
| 420 | Ga0400486_28288 | |||
| 421 | Ga0400486_30562 | |||
| 422 | Ga0400483_000434 | |||
| 423 | Ga0400483_032995 | |||
| 424 | Ga0400483_057521 | |||
| 425 | Ga0400483_099912 | |||
| 426 | Ga0400483_155385 | |||
| 427 | Ga0400483_161689 | |||
| 428 | Ga0400483_192105 | |||
| 429 | Ga0400483_219077 | |||
| 430 | Ga0400483_250011 | |||
| 431 | Ga0400483_260905 | |||
| 432 | Ga0400483_267354 | |||
| 433 | Ga0400489_06127 | |||
| 434 | Ga0400489_21020 | |||
| 435 | Ga0400489_28513 | |||
| 436 | Ga0400489_44975 | |||
| 437 | Ga0400489_49215 | |||
| 438 | Ga0400489_51496 | |||
| 439 | Ga0400487_04507 | |||
| 440 | Ga0400487_46191 | |||
| 441 | Ga0400487_57257 | |||
| 442 | Ga0400487_57726 | |||
| 443 | Ga0451577_0000143 | |||
| 444 | Ga0451577_0000888 | |||
| 445 | Ga0451577_0005666 | |||
| 446 | Ga0451577_0064533 | |||
| 447 | Ga0451577_0095550 | |||
| 448 | Ga0451577_0245784 | |||
| 449 | Ga0451577_0450932 | |||
| 450 | Ga0453683_0000843 | |||
| 451 | Ga0453683_0023476 | |||
| 452 | Ga0453683_0078552 | |||
| 453 | Ga0453683_0082079 | |||
| 454 | Ga0453684_0000022 | |||
| 455 | Ga0453684_0000239 | |||
| 456 | Ga0453684_0000678 | |||
| 457 | Ga0453684_0001304 | |||
| 458 | Ga0453684_0001668 | |||
| 459 | Ga0453684_0001920 | |||
| 460 | Ga0453684_0009972 | |||
| 461 | Ga0453684_0011708 | |||
| 462 | Ga0453684_0034586 | |||
| 463 | Ga0453684_0071169 | |||
| 464 | Ga0453684_0072569 | |||
| 465 | Ga0453684_0131315 | |||
| 466 | Ga0453684_0165456 | |||
| 467 | Ga0453684_0316601 | |||
| 468 | Ga0453684_0572677 | |||
| 469 | Ga0453684_0598108 | |||
| 470 | Ga0453684_0615567 | |||
| 471 | Ga0451576_0000074 | |||
| 472 | Ga0451576_0000238 | |||
| 473 | Ga0451576_0000306 | |||
| 474 | Ga0451576_0127222 | |||
| 475 | Ga0451576_0691941 | |||
| 476 | Ga0451576_0996316 | |||
| 477 | Ga0496125_0000899 | |||
| 478 | Ga0496125_0010310 | |||
| 479 | Ga0496126_0060497 | |||
| 480 | 2740992456 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ifh-assembly1.cif.gz_A | unphosphorylated spo0f from paenisporosarcina sp. tg-14 | 0.9724 | 4 | 122 |
| 2zwm-assembly1.cif.gz_B | crystal structure of yycf receiver domain from bacillus subtilis | 0.9723 | 4 | 123 |
| 8fk2-assembly1.cif.gz_B | the n-terminal vicr from streptococcus mutans | 0.9653 | 4 | 126 |
| 6rh1-assembly1.cif.gz_C | revisiting ph-gated conformational switch. complex hk853-rr468 d53a ph 7 | 0.9636 | 3 | 121 |
| 7m0s-assembly1.cif.gz_B | n-terminal domain of pmra from acinetobacter baumannii | 0.9634 | 4 | 123 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FXN6_3_86_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9749 | 4 | 88 | 3.40.50.2300 |
| af_Q54SP4_555_700_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9743 | 3 | 125 | 3.40.50.2300 |
| af_P52076_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9705 | 5 | 84 | 3.40.50.2300 |
| af_P14375_1_129_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9669 | 2 | 121 | 3.40.50.2300 |
| af_P0AFJ5_1_84_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9653 | 3 | 84 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4P5XGE1-F1-model_v4 | deleted | 0.9882 | 3 | 125 |
|
| AF-A0A523EAV0-F1-model_v4 | Diguanylate cyclase | 0.9823 | 3 | 125 |
GO:0000160
GO:0005886 GO:0043709 GO:0052621 GO:1902201 |
| AF-A0A1V6GZZ9-F1-model_v4 | Response regulator PleD | 0.9815 | 3 | 124 |
GO:0000155
|
| AF-A0A2N2TQE8-F1-model_v4 | Adenylate/guanylate cyclase domain-containing response regulator | 0.981 | 4 | 125 |
GO:0000156
GO:0000976 GO:0004016 GO:0005829 GO:0006355 GO:0009190 GO:0032993 |
| AF-K9RQN4-F1-model_v4 | EAL domain-containing protein | 0.9806 | 2 | 125 |
GO:0000160
GO:0071111 |