F352971

General Info

Members Datasets Scaffolds Average Seq Length
240 162 480 249

Family's Representative Sequence

Representative Sequence 3300028573|Ga0265334_10000639|Ga0265334_100006392
Length 274
Sequence VSADPAVADPAGAALLRVRGLRKAFGRNVVLDGLDLDVDAHQVVVLIGTSGSGKSTLLRCIDLLETVDDGVVEFEGRDITDPRVDADAVRSRMGIVFQAFNLFPHLSVLDNVTLAPRRVHRVARAEAELRALELLDRVGLRAKASAHPDELSGGQQQRVAIARSLVNDPKLMLFDEVTSALDPELVGEVLALLRDLKSDGMTMIVATHEMGFARQVADRVCFLDGGRVLEAGPPGQVLGDPVRERTRQFLSRIIAAGRLQPADSGQDTPTGPGR

Samples

Sample ID Description Type Environment
1 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
32 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
67 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
68 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
69 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
70 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
71 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
72 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
73 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
74 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
75 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
76 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
77 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
78 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
79 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
80 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
81 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
82 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
83 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
86 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
87 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
88 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
89 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
90 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
91 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
92 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
93 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
94 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
95 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
96 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
99 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
100 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
101 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
102 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
103 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
104 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
105 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
106 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
107 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
108 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
109 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
110 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
111 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
112 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
113 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
114 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
115 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
116 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
117 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
118 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
119 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
120 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
121 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
124 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
125 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
126 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
129 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
130 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
131 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
137 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
138 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
139 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
140 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
141 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
143 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
144 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
145 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
146 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
147 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
148 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
149 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
150 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
151 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
152 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
153 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
154 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
155 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
156 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
157 2643221629 Devosia sp. Root105 Isolate Unclassified
158 2643221630 Microbacterium sp. Root322 Isolate Unclassified
159 2643221662 Devosia sp. Root413D1 Isolate Unclassified
160 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
161 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
162 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.25
Metatranscriptomes 0.83
Isolates 2.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.58
Nodule 0
Rhizoplane 6.67
Rhizosphere 86.25
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265334_10000639 3300028573 Bacteria 17719
2 Ga0070683_100061168 3300005329 Bacteria 3501
3 Ga0070683_100212382 3300005329 Bacteria 1838
4 Ga0070683_100544131 3300005329 Bacteria 1110
5 Ga0070680_100050736 3300005336 Bacteria 3384
6 Ga0070682_100173850 3300005337 Bacteria 1499
7 Ga0068868_100041270 3300005338 Bacteria 3595
8 Ga0070714_100001550 3300005435 Bacteria 16732
9 Ga0070714_100006392 3300005435 Bacteria 9097
10 Ga0070714_100006972 3300005435 Bacteria 8761
11 Ga0070714_100265388 3300005435 Bacteria 1591
12 Ga0070678_100354438 3300005456 Bacteria 1262
13 Ga0070681_10127027 3300005458 Bacteria 2482
14 Ga0070706_100027860 3300005467 Bacteria 5196
15 Ga0070707_100004069 3300005468 Bacteria 13740
16 Ga0070698_100070824 3300005471 Bacteria 3498
17 Ga0070699_100010988 3300005518 Bacteria 7830
18 Ga0070679_100140377 3300005530 Bacteria 2396
19 Ga0070684_100206456 3300005535 Bacteria 1790
20 Ga0070697_100187959 3300005536 Bacteria 1752
21 Ga0070693_100307426 3300005547 Bacteria 1071
22 Ga0068855_100157927 3300005563 Bacteria 2576
23 Ga0068855_100193202 3300005563 Bacteria 2295
24 Ga0068857_100059079 3300005577 Bacteria 3406
25 Ga0068856_100036819 3300005614 Bacteria 4798
26 Ga0068856_100197209 3300005614 Bacteria 2027
27 Ga0068856_100259397 3300005614 Bacteria 1753
28 Ga0068856_100662363 3300005614 Bacteria 1064
29 Ga0068863_100120439 3300005841 Bacteria 2502
30 Ga0081455_10005957 3300005937 Bacteria 13217
31 Ga0081538_10000521 3300005981 Bacteria 42921
32 Ga0081539_10004135 3300005985 Bacteria 16512
33 Ga0070717_10043664 3300006028 Bacteria 3659
34 Ga0075363_100099160 3300006048 Bacteria 1611
35 Ga0075363_100191407 3300006048 Bacteria 1167
36 Ga0075367_10017134 3300006178 Bacteria 3971
37 Ga0075367_10071981 3300006178 Bacteria 2080
38 Ga0075370_10175196 3300006353 Bacteria 1261
39 Ga0075428_100077666 3300006844 Bacteria 3624
40 Ga0075431_100069521 3300006847 Bacteria 3633
41 Ga0075434_100003540 3300006871 Bacteria 13944
42 Ga0075434_100484382 3300006871 Bacteria 1258
43 Ga0075436_100000733 3300006914 Bacteria 21735
44 Ga0075435_100116312 3300007076 Bacteria 2227
45 Ga0105240_10083005 3300009093 Bacteria 3934
46 Ga0105240_10095133 3300009093 Bacteria 3632
47 Ga0105245_10073823 3300009098 Bacteria 3103
48 Ga0105237_10790780 3300009545 Bacteria 955
49 Ga0105238_10950503 3300009551 Bacteria 879
50 Ga0105239_10047393 3300010375 Bacteria 4710
51 Ga0105239_11015361 3300010375 Bacteria 954
52 Ga0157373_10117029 3300013100 Bacteria 1873
53 Ga0157370_10057491 3300013104 Bacteria 3698
54 Ga0157369_10009546 3300013105 Bacteria 11098
55 Ga0157369_10035083 3300013105 Bacteria 5501
56 Ga0157369_10146967 3300013105 Bacteria 2492
57 Ga0157374_10008374 3300013296 Bacteria 8831
58 Ga0157372_10266522 3300013307 Bacteria 1989
59 Ga0157372_10430066 3300013307 Bacteria 1539
60 Ga0163163_10258213 3300014325 Bacteria 1793
61 Ga0157379_10003066 3300014968 Bacteria 14133
62 Ga0206356_11575879 3300020070 Bacteria 1031
63 Ga0206353_11103491 3300020082 Bacteria 1767
64 Ga0207647_10023859 3300025904 Bacteria 4040
65 Ga0207684_10043469 3300025910 Bacteria 3809
66 Ga0207707_10027660 3300025912 Bacteria 4958
67 Ga0207707_10051391 3300025912 Bacteria 3589
68 Ga0207695_10005936 3300025913 Bacteria 16003
69 Ga0207671_10175525 3300025914 Bacteria 1665
70 Ga0207671_10182742 3300025914 Bacteria 1632
71 Ga0207663_10398840 3300025916 Bacteria 1052
72 Ga0207660_10073733 3300025917 Bacteria 2489
73 Ga0207660_10403214 3300025917 Bacteria 1101
74 Ga0207657_10562202 3300025919 Bacteria 891
75 Ga0207652_10044188 3300025921 Bacteria 3795
76 Ga0207652_10245187 3300025921 Bacteria 1615
77 Ga0207646_10034763 3300025922 Bacteria 4556
78 Ga0207646_10339132 3300025922 Bacteria 1358
79 Ga0207687_10020893 3300025927 Bacteria 4345
80 Ga0207664_10002753 3300025929 Bacteria 11671
81 Ga0207664_10025127 3300025929 Bacteria 4482
82 Ga0207664_10046215 3300025929 Bacteria 3417
83 Ga0207664_10106970 3300025929 Bacteria 2320
84 Ga0207690_10189794 3300025932 Bacteria 1553
85 Ga0207667_10024600 3300025949 Bacteria 6607
86 Ga0207667_10252500 3300025949 Bacteria 1804
87 Ga0207702_10015009 3300026078 Bacteria 6424
88 Ga0207702_10113487 3300026078 Bacteria 2413
89 Ga0207702_10212480 3300026078 Bacteria 1799
90 Ga0207641_10458470 3300026088 Bacteria 1233
91 Ga0207676_10272750 3300026095 Bacteria 1533
92 Ga0207674_10118618 3300026116 Bacteria 2616
93 Ga0207698_10219544 3300026142 Bacteria 1717
94 Ga0265322_10004386 3300028654 Bacteria 4204
95 Ga0265340_10094979 3300031247 Bacteria 1390
96 Ga0265339_10095094 3300031249 Bacteria 1557
97 Ga0265316_10000868 3300031344 Bacteria 33294
98 Ga0316578_10004773 3300031728 Bacteria 6461
99 Ga0316578_10034967 3300031728 Bacteria 2887
100 Ga0307405_10019172 3300031731 Bacteria 3793
101 Ga0307410_10134642 3300031852 Bacteria 1820
102 Ga0307416_100262177 3300032002 Bacteria 1690
103 Ga0307411_10035152 3300032005 Bacteria 3126
104 Ga0373926_0008926 3300035083 Bacteria 3342
105 Ga0373945_0006736 3300035116 Bacteria 3713
106 Ga0373946_0083581 3300035171 Bacteria 1402
107 Ga0373947_0096442 3300035725 Bacteria 1852
108 Ga0316584_0140506 3300036712 Bacteria 1801
109 Ga0316584_0430819 3300036712 Bacteria 935
110 Ga0395899_0327799 3300037312 Bacteria 1029
111 Ga0395900_0033212 3300037418 Bacteria 5311
112 Ga0395900_0105812 3300037418 Bacteria 2890
113 Ga0395898_0006255 3300037466 Bacteria 12739
114 Ga0395905_0040983 3300037471 Bacteria 4344
115 Ga0395901_0151858 3300038443 Bacteria 2433
116 Ga0395901_0263235 3300038443 Bacteria 1794
117 Ga0466972_0055838 3300044658 Bacteria 1899
118 Ga0466972_0152033 3300044658 Bacteria 1088
119 Ga0466966_0004970 3300044684 Bacteria 8740
120 Ga0466966_0091775 3300044684 Bacteria 1885
121 Ga0466961_0001191 3300044693 Bacteria 16033
122 Ga0466961_0026120 3300044693 Bacteria 3755
123 Ga0466961_0115049 3300044693 Bacteria 1690
124 Ga0466961_0155093 3300044693 Bacteria 1429
125 Ga0466963_0007957 3300044694 Bacteria 6346
126 Ga0466963_0014009 3300044694 Bacteria 4938
127 Ga0466963_0029820 3300044694 Bacteria 3514
128 Ga0466963_0086852 3300044694 Bacteria 2126
129 Ga0466963_0190825 3300044694 Bacteria 1431
130 Ga0466963_0340406 3300044694 Bacteria 1056
131 Ga0466964_0019370 3300044706 Bacteria 2615
132 Ga0466964_0199441 3300044706 Bacteria 960
133 Ga0466971_0003188 3300044719 Bacteria 6997
134 Ga0466971_0062657 3300044719 Bacteria 1683
135 Ga0466968_0059983 3300044735 Bacteria 1639
136 Ga0466970_0000099 3300044765 Bacteria 37481
137 Ga0466970_0059439 3300044765 Bacteria 2047
138 Ga0466970_0205731 3300044765 Bacteria 1096
139 Ga0466970_0225657 3300044765 Bacteria 1046
140 Ga0466957_0001822 3300044842 Bacteria 11234
141 Ga0466957_0003514 3300044842 Bacteria 8619
142 Ga0466957_0041594 3300044842 Bacteria 2779
143 Ga0466957_0229136 3300044842 Bacteria 1229
144 Ga0466960_0085158 3300044901 Bacteria 1601
145 Ga0466960_0113650 3300044901 Bacteria 1410
146 Ga0466959_0014011 3300045049 Bacteria 5820
147 Ga0466959_0014407 3300045049 Bacteria 5743
148 Ga0466959_0118988 3300045049 Bacteria 1879
149 Ga0466958_0000888 3300045836 Bacteria 13389
150 Ga0466958_0003033 3300045836 Bacteria 8606
151 Ga0466958_0011520 3300045836 Bacteria 4980
152 Ga0466958_0037771 3300045836 Bacteria 2894
153 Ga0466967_0000737 3300045976 Bacteria 16779
154 Ga0466967_0001203 3300045976 Bacteria 14562
155 Ga0466967_0004175 3300045976 Bacteria 9668
156 Ga0466967_0011948 3300045976 Bacteria 6615
157 Ga0466967_0037382 3300045976 Bacteria 4154
158 Ga0466967_0041643 3300045976 Bacteria 3962
159 Ga0466967_0065635 3300045976 Bacteria 3231
160 Ga0466967_0148066 3300045976 Bacteria 2191
161 Ga0466967_0173611 3300045976 Bacteria 2029
162 Ga0466967_0180443 3300045976 Bacteria 1991
163 Ga0466967_0319317 3300045976 Bacteria 1497
164 Ga0466967_0340018 3300045976 Bacteria 1451
165 Ga0466967_0542254 3300045976 Bacteria 1144
166 Ga0495627_001239 3300046453 Bacteria 15886
167 Ga0495629_0002956 3300046459 Bacteria 12938
168 Ga0495629_0015958 3300046459 Bacteria 5397
169 Ga0495651_0078719 3300046462 Bacteria 2493
170 Ga0495582_0000520 3300046473 Bacteria 21190
171 Ga0495584_0075148 3300046491 Bacteria 1699
172 Ga0495608_0110540 3300046511 Bacteria 1767
173 Ga0495608_0328251 3300046511 Bacteria 944
174 Ga0495618_0062380 3300046514 Bacteria 2365
175 Ga0495628_0207048 3300046516 Bacteria 1476
176 Ga0495665_0026796 3300046531 Bacteria 3095
177 Ga0495640_0040955 3300046533 Bacteria 3240
178 Ga0495645_0244191 3300046543 Bacteria 1196
179 Ga0495656_0107502 3300046615 Bacteria 1300
180 Ga0495657_0112661 3300046675 Bacteria 1722
181 Ga0495646_0048154 3300046680 Bacteria 2591
182 Ga0495647_0108222 3300046681 Bacteria 1157
183 Ga0495658_0000156 3300046683 Bacteria 38011
184 Ga0495613_0000454 3300046689 Bacteria 34974
185 Ga0495624_0066462 3300046690 Bacteria 2251
186 Ga0495581_0012284 3300047315 Bacteria 4960
187 Ga0495581_0031385 3300047315 Bacteria 3079
188 Ga0495674_0111711 3300047319 Bacteria 2316
189 Ga0495676_0062550 3300047321 Bacteria 2905
190 Ga0495680_0326811 3300047322 Bacteria 1072
191 Ga0496100_0548866 3300048903 Bacteria 894
192 Ga0496101_0026721 3300048904 Bacteria 4013
193 Ga0496104_0196692 3300048907 Bacteria 1928
194 Ga0496104_0650006 3300048907 Bacteria 963
195 Ga0496106_0198663 3300048909 Bacteria 1595
196 Ga0496108_0016168 3300048911 Bacteria 6084
197 Ga0496108_0028038 3300048911 Bacteria 4658
198 Ga0496110_0082997 3300048913 Bacteria 2858
199 Ga0496111_0066638 3300048914 Bacteria 2615
200 Ga0496111_0111882 3300048914 Bacteria 2011
201 Ga0496112_0019068 3300048915 Bacteria 6466
202 Ga0496112_0191378 3300048915 Bacteria 2008
203 Ga0496113_0100138 3300048916 Bacteria 2245
204 Ga0496114_0119249 3300048917 Bacteria 2268
205 Ga0496114_0151192 3300048917 Bacteria 2014
206 Ga0496115_0451347 3300048918 Bacteria 1038
207 Ga0501037_0232389 3300049573 Bacteria 1294
208 Ga0501038_0373595 3300049574 Bacteria 1107
209 Ga0501040_0267212 3300049576 Bacteria 1221
210 Ga0501041_0179305 3300049577 Bacteria 1326
211 Ga0501047_0172137 3300049581 Bacteria 2034
212 Ga0501067_0011514 3300049583 Bacteria 4900
213 Ga0501074_0043991 3300049590 Bacteria 3233
214 Ga0501075_0265966 3300049591 Bacteria 1307
215 Ga0501076_0159563 3300049592 Bacteria 1837
216 Ga0501076_0369204 3300049592 Bacteria 1179
217 Ga0501079_0095400 3300049741 Bacteria 2305
218 Ga0501044_0258667 3300049823 Bacteria 1679
219 Ga0501045_0019698 3300049824 Bacteria 4814
220 nmdc:mga03683_91949_c1 3300050489 Bacteria 1324
221 nmdc:mga03n38_107922_c1 3300050490 Bacteria 1351
222 nmdc:mga03n38_227980_c1 3300050490 Bacteria 975
223 nmdc:mga00v17_80483_c1 3300050491 Bacteria 2033
224 nmdc:mga0k408_66035_c1 3300050493 Bacteria 2107
225 nmdc:mga06z11_94835_c1 3300050494 Bacteria 1627
226 nmdc:mga09592_654130_c1 3300050508 Bacteria 897
227 nmdc:mga0qj67_19767_c1 3300050509 Bacteria 5150
228 nmdc:mga0n895_7740_c1 3300050512 Bacteria 9250
229 nmdc:mga0rr50_2487_c1 3300050513 Bacteria 10408
230 nmdc:mga08x19_2226_c1 3300050514 Bacteria 11839
231 Ga0495601_0191748 3300053077 Bacteria 1335
232 Ga0495619_0317519 3300053085 Bacteria 1078
233 Ga0466962_0011827 3300061719 Bacteria 4201
234 2643735161 2643221542 Bacteria 3563959
235 2644168296 2643221629 Bacteria 5850260
236 2644171971 2643221630 Bacteria 3601215
237 2644351181 2643221662 Bacteria 5851492
238 2816510139 2816332139 Bacteria 9138787
239 2852663401 2852663356 Bacteria 4090475
240 2857595261 2857591370 Bacteria 6569758
241 Ga0265334_10000639
242 Ga0070683_100061168
243 Ga0070683_100212382
244 Ga0070683_100544131
245 Ga0070680_100050736
246 Ga0070682_100173850
247 Ga0068868_100041270
248 Ga0070714_100001550
249 Ga0070714_100006392
250 Ga0070714_100006972
251 Ga0070714_100265388
252 Ga0070678_100354438
253 Ga0070681_10127027
254 Ga0070706_100027860
255 Ga0070707_100004069
256 Ga0070698_100070824
257 Ga0070699_100010988
258 Ga0070679_100140377
259 Ga0070684_100206456
260 Ga0070697_100187959
261 Ga0070693_100307426
262 Ga0068855_100157927
263 Ga0068855_100193202
264 Ga0068857_100059079
265 Ga0068856_100036819
266 Ga0068856_100197209
267 Ga0068856_100259397
268 Ga0068856_100662363
269 Ga0068863_100120439
270 Ga0081455_10005957
271 Ga0081538_10000521
272 Ga0081539_10004135
273 Ga0070717_10043664
274 Ga0075363_100099160
275 Ga0075363_100191407
276 Ga0075367_10017134
277 Ga0075367_10071981
278 Ga0075370_10175196
279 Ga0075428_100077666
280 Ga0075431_100069521
281 Ga0075434_100003540
282 Ga0075434_100484382
283 Ga0075436_100000733
284 Ga0075435_100116312
285 Ga0105240_10083005
286 Ga0105240_10095133
287 Ga0105245_10073823
288 Ga0105237_10790780
289 Ga0105238_10950503
290 Ga0105239_10047393
291 Ga0105239_11015361
292 Ga0157373_10117029
293 Ga0157370_10057491
294 Ga0157369_10009546
295 Ga0157369_10035083
296 Ga0157369_10146967
297 Ga0157374_10008374
298 Ga0157372_10266522
299 Ga0157372_10430066
300 Ga0163163_10258213
301 Ga0157379_10003066
302 Ga0206356_11575879
303 Ga0206353_11103491
304 Ga0207647_10023859
305 Ga0207684_10043469
306 Ga0207707_10027660
307 Ga0207707_10051391
308 Ga0207695_10005936
309 Ga0207671_10175525
310 Ga0207671_10182742
311 Ga0207663_10398840
312 Ga0207660_10073733
313 Ga0207660_10403214
314 Ga0207657_10562202
315 Ga0207652_10044188
316 Ga0207652_10245187
317 Ga0207646_10034763
318 Ga0207646_10339132
319 Ga0207687_10020893
320 Ga0207664_10002753
321 Ga0207664_10025127
322 Ga0207664_10046215
323 Ga0207664_10106970
324 Ga0207690_10189794
325 Ga0207667_10024600
326 Ga0207667_10252500
327 Ga0207702_10015009
328 Ga0207702_10113487
329 Ga0207702_10212480
330 Ga0207641_10458470
331 Ga0207676_10272750
332 Ga0207674_10118618
333 Ga0207698_10219544
334 Ga0265322_10004386
335 Ga0265340_10094979
336 Ga0265339_10095094
337 Ga0265316_10000868
338 Ga0316578_10004773
339 Ga0316578_10034967
340 Ga0307405_10019172
341 Ga0307410_10134642
342 Ga0307416_100262177
343 Ga0307411_10035152
344 Ga0373926_0008926
345 Ga0373945_0006736
346 Ga0373946_0083581
347 Ga0373947_0096442
348 Ga0316584_0140506
349 Ga0316584_0430819
350 Ga0395899_0327799
351 Ga0395900_0033212
352 Ga0395900_0105812
353 Ga0395898_0006255
354 Ga0395905_0040983
355 Ga0395901_0151858
356 Ga0395901_0263235
357 Ga0466972_0055838
358 Ga0466972_0152033
359 Ga0466966_0004970
360 Ga0466966_0091775
361 Ga0466961_0001191
362 Ga0466961_0026120
363 Ga0466961_0115049
364 Ga0466961_0155093
365 Ga0466963_0007957
366 Ga0466963_0014009
367 Ga0466963_0029820
368 Ga0466963_0086852
369 Ga0466963_0190825
370 Ga0466963_0340406
371 Ga0466964_0019370
372 Ga0466964_0199441
373 Ga0466971_0003188
374 Ga0466971_0062657
375 Ga0466968_0059983
376 Ga0466970_0000099
377 Ga0466970_0059439
378 Ga0466970_0205731
379 Ga0466970_0225657
380 Ga0466957_0001822
381 Ga0466957_0003514
382 Ga0466957_0041594
383 Ga0466957_0229136
384 Ga0466960_0085158
385 Ga0466960_0113650
386 Ga0466959_0014011
387 Ga0466959_0014407
388 Ga0466959_0118988
389 Ga0466958_0000888
390 Ga0466958_0003033
391 Ga0466958_0011520
392 Ga0466958_0037771
393 Ga0466967_0000737
394 Ga0466967_0001203
395 Ga0466967_0004175
396 Ga0466967_0011948
397 Ga0466967_0037382
398 Ga0466967_0041643
399 Ga0466967_0065635
400 Ga0466967_0148066
401 Ga0466967_0173611
402 Ga0466967_0180443
403 Ga0466967_0319317
404 Ga0466967_0340018
405 Ga0466967_0542254
406 Ga0495627_001239
407 Ga0495629_0002956
408 Ga0495629_0015958
409 Ga0495651_0078719
410 Ga0495582_0000520
411 Ga0495584_0075148
412 Ga0495608_0110540
413 Ga0495608_0328251
414 Ga0495618_0062380
415 Ga0495628_0207048
416 Ga0495665_0026796
417 Ga0495640_0040955
418 Ga0495645_0244191
419 Ga0495656_0107502
420 Ga0495657_0112661
421 Ga0495646_0048154
422 Ga0495647_0108222
423 Ga0495658_0000156
424 Ga0495613_0000454
425 Ga0495624_0066462
426 Ga0495581_0012284
427 Ga0495581_0031385
428 Ga0495674_0111711
429 Ga0495676_0062550
430 Ga0495680_0326811
431 Ga0496100_0548866
432 Ga0496101_0026721
433 Ga0496104_0196692
434 Ga0496104_0650006
435 Ga0496106_0198663
436 Ga0496108_0016168
437 Ga0496108_0028038
438 Ga0496110_0082997
439 Ga0496111_0066638
440 Ga0496111_0111882
441 Ga0496112_0019068
442 Ga0496112_0191378
443 Ga0496113_0100138
444 Ga0496114_0119249
445 Ga0496114_0151192
446 Ga0496115_0451347
447 Ga0501037_0232389
448 Ga0501038_0373595
449 Ga0501040_0267212
450 Ga0501041_0179305
451 Ga0501047_0172137
452 Ga0501067_0011514
453 Ga0501074_0043991
454 Ga0501075_0265966
455 Ga0501076_0159563
456 Ga0501076_0369204
457 Ga0501079_0095400
458 Ga0501044_0258667
459 Ga0501045_0019698
460 nmdc:mga03683_91949_c1
461 nmdc:mga03n38_107922_c1
462 nmdc:mga03n38_227980_c1
463 nmdc:mga00v17_80483_c1
464 nmdc:mga0k408_66035_c1
465 nmdc:mga06z11_94835_c1
466 nmdc:mga09592_654130_c1
467 nmdc:mga0qj67_19767_c1
468 nmdc:mga0n895_7740_c1
469 nmdc:mga0rr50_2487_c1
470 nmdc:mga08x19_2226_c1
471 Ga0495601_0191748
472 Ga0495619_0317519
473 Ga0466962_0011827
474 2643735161
475 2644168296
476 2644171971
477 2644351181
478 2816510139
479 2852663401
480 2857595261

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

31

179

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yms-assembly1.cif.gz_A crystal structure of an amino acid abc transporter 0.9888 8 245
3c41-assembly1.cif.gz_K abc protein artp in complex with amp-pnp/mg2+ 0.984 8 245
4u00-assembly1.cif.gz_A crystal structure of ttha1159 in complex with adp 0.9801 8 245
4yms-assembly1.cif.gz_A crystal structure of an amino acid abc transporter 0.9766 8 245
1b0u-assembly1.cif.gz_A-2 atp-binding subunit of the histidine permease from salmonella typhimurium 0.9717 7 246
ID Description Score Start End Superfamily
4ymtJ00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9869 8 245 3.40.50.300
4ymtJ00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9747 8 245 3.40.50.300
af_P0AAF6_1_241_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9622 7 242 3.40.50.300
af_P33360_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9551 8 244 3.40.50.300
af_Q58762_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9537 8 242 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A6J6IAX0-F1-model_v4 Unannotated protein 0.9956 164 251 GO:0005886
AF-A0A7Y9H5T3-F1-model_v4 Polar amino acid transport system ATP-binding protein 0.9954 8 246 GO:0005524
GO:0005886
GO:0015424
GO:0016887
AF-A0A7X7G2J4-F1-model_v4 ATP-binding cassette domain-containing protein 0.9952 8 242 GO:0005524
GO:0005886
GO:0016887
AF-W1DWD4-F1-model_v4 Glutamate Aspartate transport ATP-binding protein GltL (TC 3.A.1.3.4) 0.9881 38 246 GO:0005524
GO:0005886
GO:0015424
GO:0016887
AF-A0A7W5GT45-F1-model_v4 ABC-type polar amino acid transport system ATPase subunit 0.9868 8 247 GO:0005524
GO:0005886
GO:0015424
GO:0016887

Map