F352969

General Info

Members Datasets Scaffolds Average Seq Length
240 135 480 258

Family's Representative Sequence

Representative Sequence 3300027876|Ga0209974_10093322|Ga0209974_100933222
Length 241
Sequence MSVSCYAAVVAIETLAPLPDGSTPEAGPIVASWLGRMEYRAALELQKSLVTQRAEGRIGDRLLLLEHPRVLTLGRTADPAHIRADPAELAARGIDVIRVERGGEVTYHGPGQLVAYPIVALSSRGLLVRPLCAAHGVAAGRRDGHPGCWCDPEGADPRKIGALGLRIERGVSYHGIALNVTVDLADFDLIDACGMPGVTSTSIAAERGETAATPTTASVERAAVIFAKAFAAELGAPLTGI

Samples

Sample ID Description Type Environment
1 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
25 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
26 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
32 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
33 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
34 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
35 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
36 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
37 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
38 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
39 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
54 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
56 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
57 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
58 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
59 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
60 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
61 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
62 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
63 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
64 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
65 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
66 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
67 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
68 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
69 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
70 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
71 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
72 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
73 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
74 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
75 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
76 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
79 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
80 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
81 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
82 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
83 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
84 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
85 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
86 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
87 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
88 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
89 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
90 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
91 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
92 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
93 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
94 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
95 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
96 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
97 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
98 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
99 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
100 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
101 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
102 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
103 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
104 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
116 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
117 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
118 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
119 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
120 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
121 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
122 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
123 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
124 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
125 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
126 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
127 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
128 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
129 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
130 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
131 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
132 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
133 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
134 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
135 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 13.33
Rhizosphere 85.83
Stem 0
Stem Tuber 0
Unclassified 4.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209974_10093322 3300027876 Bacteria 1045
2 rootH1_10223786 3300003323 Bacteria 3096
3 Ga0070683_100197053 3300005329 Bacteria 1913
4 Ga0070680_100056498 3300005336 Bacteria 3208
5 Ga0070692_10015798 3300005345 Bacteria 3578
6 Ga0070688_100175396 3300005365 Bacteria 1483
7 Ga0070703_10057346 3300005406 Unclassified 1264
8 Ga0070705_100017324 3300005440 Bacteria 3760
9 Ga0070705_100063423 3300005440 Bacteria 2204
10 Ga0070705_100287366 3300005440 Bacteria 1172
11 Ga0070700_100022363 3300005441 Bacteria 3686
12 Ga0070694_100030254 3300005444 Bacteria 3540
13 Ga0070694_100037068 3300005444 Bacteria 3233
14 Ga0070708_100006545 3300005445 Bacteria 9269
15 Ga0070708_100151549 3300005445 Bacteria 2156
16 Ga0070662_100024833 3300005457 Bacteria 4133
17 Ga0070706_100001052 3300005467 Bacteria 29968
18 Ga0070706_100050577 3300005467 Bacteria 3835
19 Ga0070706_100141295 3300005467 Bacteria 2248
20 Ga0070707_100001500 3300005468 Bacteria 22744
21 Ga0070707_100004686 3300005468 Bacteria 12816
22 Ga0070698_100052008 3300005471 Bacteria 4170
23 Ga0070699_100001368 3300005518 Bacteria 22411
24 Ga0070699_100028216 3300005518 Bacteria 4841
25 Ga0070699_100117228 3300005518 Bacteria 2340
26 Ga0070699_100320450 3300005518 Bacteria 1393
27 Ga0070684_100153545 3300005535 Bacteria 2087
28 Ga0070695_100007972 3300005545 Bacteria 6272
29 Ga0070695_100008841 3300005545 Bacteria 5984
30 Ga0070696_100008181 3300005546 Bacteria 6998
31 Ga0070696_100009936 3300005546 Bacteria 6366
32 Ga0070704_100058792 3300005549 Bacteria 2740
33 Ga0070704_100063148 3300005549 Eukaryota 2657
34 Ga0068860_100054984 3300005843 Bacteria 3783
35 Ga0081539_10004978 3300005985 Bacteria 14067
36 Ga0081539_10007122 3300005985 Bacteria 10333
37 Ga0075428_100135392 3300006844 Bacteria 2679
38 Ga0075434_100375825 3300006871 Bacteria 1442
39 Ga0068865_100320687 3300006881 Bacteria 1246
40 Ga0075435_100159224 3300007076 Bacteria 1901
41 Ga0111539_10160460 3300009094 Bacteria 2630
42 Ga0111539_10190467 3300009094 Bacteria 2393
43 Ga0105245_10148873 3300009098 Bacteria 2212
44 Ga0105243_10168362 3300009148 Bacteria 1895
45 Ga0105249_10004962 3300009553 Bacteria 11477
46 Ga0157378_10316711 3300013297 Bacteria 1514
47 Ga0157375_10020061 3300013308 Bacteria 6098
48 Ga0163163_10039994 3300014325 Bacteria 4578
49 Ga0163163_10124066 3300014325 Bacteria 2619
50 Ga0157380_10367927 3300014326 Bacteria 1352
51 Ga0157377_10078978 3300014745 Bacteria 1919
52 Ga0157377_10384115 3300014745 Bacteria 952
53 Ga0157379_10013703 3300014968 Bacteria 7105
54 Ga0157379_10049993 3300014968 Bacteria 3732
55 Ga0157376_10038056 3300014969 Bacteria 3911
56 Ga0163161_10036073 3300017792 Bacteria 3540
57 Ga0207653_10011051 3300025885 Bacteria 2819
58 Ga0207684_10003227 3300025910 Bacteria 16015
59 Ga0207684_10003286 3300025910 Bacteria 15860
60 Ga0207684_10233189 3300025910 Bacteria 1588
61 Ga0207646_10001588 3300025922 Bacteria 27763
62 Ga0207646_10003310 3300025922 Bacteria 18327
63 Ga0207646_10008630 3300025922 Bacteria 10186
64 Ga0207646_10054994 3300025922 Bacteria 3560
65 Ga0207659_10054616 3300025926 Bacteria 2853
66 Ga0207687_10148994 3300025927 Bacteria 1783
67 Ga0207706_10168666 3300025933 Bacteria 1924
68 Ga0207704_10248806 3300025938 Bacteria 1333
69 Ga0207711_10721374 3300025941 Bacteria 930
70 Ga0207661_10045832 3300025944 Bacteria 3464
71 Ga0207712_10512358 3300025961 Bacteria 1027
72 Ga0207703_10040107 3300026035 Bacteria 3746
73 Ga0207708_10096728 3300026075 Bacteria 2282
74 Ga0207676_10306431 3300026095 Bacteria 1452
75 Ga0207674_10208545 3300026116 Bacteria 1903
76 Ga0207428_10367585 3300027907 Bacteria 1057
77 Ga0268264_10073026 3300028381 Eukaryota 2910
78 Ga0265319_1001120 3300028563 Bacteria 16699
79 Ga0265334_10002072 3300028573 Bacteria 9484
80 Ga0265334_10005664 3300028573 Bacteria 5453
81 Ga0265318_10004276 3300028577 Bacteria 6959
82 Ga0265318_10053048 3300028577 Bacteria 1521
83 Ga0265318_10070977 3300028577 Bacteria 1291
84 Ga0265322_10015560 3300028654 Bacteria 2197
85 Ga0265336_10005464 3300028666 Bacteria 4684
86 Ga0265338_10239251 3300028800 Unclassified 1345
87 Ga0265332_10002131 3300031238 Bacteria 10225
88 Ga0265328_10057900 3300031239 Unclassified 1423
89 Ga0265320_10000888 3300031240 Bacteria 22548
90 Ga0265320_10002200 3300031240 Bacteria 13709
91 Ga0265320_10065266 3300031240 Bacteria 1728
92 Ga0265325_10082632 3300031241 Unclassified 1594
93 Ga0265340_10003670 3300031247 Bacteria 8640
94 Ga0265339_10020712 3300031249 Bacteria 3838
95 Ga0265339_10080707 3300031249 Bacteria 1720
96 Ga0265331_10149149 3300031250 Bacteria 1062
97 Ga0265316_10008864 3300031344 Bacteria 9290
98 Ga0307408_100342524 3300031548 Bacteria 1266
99 Ga0265313_10008028 3300031595 Bacteria 7076
100 Ga0265313_10063842 3300031595 Bacteria 1715
101 Ga0316575_10019176 3300031665 Unclassified 2612
102 Ga0265314_10012998 3300031711 Bacteria 6759
103 Ga0265314_10106992 3300031711 Bacteria 1785
104 Ga0265342_10048899 3300031712 Bacteria 2533
105 Ga0265342_10066742 3300031712 Bacteria 2107
106 Ga0307405_10132085 3300031731 Bacteria 1727
107 Ga0307413_10039303 3300031824 Unclassified 2751
108 Ga0307413_10306587 3300031824 Bacteria 1206
109 Ga0307406_10223971 3300031901 Bacteria 1400
110 Ga0307409_100043140 3300031995 Bacteria 3384
111 Ga0439466_0013397 3300041411 Bacteria 3002
112 Ga0451793_1470974 3300041452 Bacteria 891
113 Ga0451849_0030653 3300041505 Bacteria 1046
114 Ga0439446_0041550 3300042156 Bacteria 1356
115 Ga0451577_0075980 3300042876 Bacteria 2995
116 Ga0466961_0415886 3300044693 Bacteria 815
117 Ga0451576_0311377 3300045051 Unclassified 1647
118 Ga0495651_0203352 3300046462 Bacteria 1384
119 Ga0495653_0106924 3300046463 Unclassified 2017
120 Ga0495630_0111478 3300046517 Bacteria 2072
121 Ga0495656_0048971 3300046615 Bacteria 1798
122 Ga0495674_0194385 3300047319 Bacteria 1685
123 Ga0496101_0033486 3300048904 Bacteria 3624
124 Ga0496102_0018686 3300048905 Bacteria 6096
125 Ga0496102_0175583 3300048905 Bacteria 2017
126 Ga0496103_0044755 3300048906 Bacteria 2728
127 Ga0496104_0007822 3300048907 Bacteria 9475
128 Ga0496104_0011551 3300048907 Bacteria 7912
129 Ga0496104_0069158 3300048907 Bacteria 3356
130 Ga0496104_0100520 3300048907 Bacteria 2768
131 Ga0496105_0003705 3300048908 Bacteria 11372
132 Ga0496105_0007419 3300048908 Bacteria 8487
133 Ga0496105_0029864 3300048908 Bacteria 4463
134 Ga0496105_0418265 3300048908 Bacteria 1061
135 Ga0496106_0182119 3300048909 Bacteria 1668
136 Ga0496107_0045740 3300048910 Bacteria 3149
137 Ga0496107_0316527 3300048910 Bacteria 1161
138 Ga0496108_0005779 3300048911 Bacteria 10021
139 Ga0496108_0176143 3300048911 Bacteria 1851
140 Ga0496108_0192256 3300048911 Bacteria 1769
141 Ga0496109_0002898 3300048912 Bacteria 14333
142 Ga0496109_0086818 3300048912 Bacteria 2889
143 Ga0496109_0232504 3300048912 Bacteria 1734
144 Ga0496110_0003793 3300048913 Bacteria 11646
145 Ga0496110_0037439 3300048913 Bacteria 4216
146 Ga0496110_0107846 3300048913 Bacteria 2500
147 Ga0496111_0001236 3300048914 Bacteria 14303
148 Ga0496111_0055811 3300048914 Unclassified 2857
149 Ga0496112_0027963 3300048915 Bacteria 5440
150 Ga0496113_0001423 3300048916 Bacteria 13308
151 Ga0496113_0007489 3300048916 Bacteria 7030
152 Ga0496113_0059804 3300048916 Bacteria 2871
153 Ga0496114_0474053 3300048917 Bacteria 1107
154 Ga0501034_0187088 3300049571 Bacteria 2034
155 Ga0501036_0020083 3300049572 Bacteria 5609
156 Ga0501036_0040263 3300049572 Bacteria 3952
157 Ga0501036_0402590 3300049572 Bacteria 1142
158 Ga0501037_0071835 3300049573 Bacteria 2517
159 Ga0501038_0113403 3300049574 Bacteria 2243
160 Ga0501038_0208995 3300049574 Bacteria 1562
161 Ga0501039_0051577 3300049575 Bacteria 3183
162 Ga0501039_0142820 3300049575 Bacteria 1880
163 Ga0501040_0084287 3300049576 Bacteria 2205
164 Ga0501040_0192202 3300049576 Bacteria 1448
165 Ga0501041_0022166 3300049577 Bacteria 3803
166 Ga0501041_0035395 3300049577 Bacteria 3025
167 Ga0501041_0077416 3300049577 Unclassified 2046
168 Ga0501042_0111264 3300049578 Bacteria 1972
169 Ga0501042_0117473 3300049578 Bacteria 1915
170 Ga0501042_0296258 3300049578 Bacteria 1168
171 Ga0501043_0029965 3300049579 Bacteria 4275
172 Ga0501046_0007079 3300049580 Bacteria 9875
173 Ga0501048_0053099 3300049582 Bacteria 2883
174 Ga0501048_0102165 3300049582 Bacteria 2023
175 Ga0501067_0101623 3300049583 Bacteria 1598
176 Ga0501068_0029649 3300049584 Bacteria 3241
177 Ga0501069_0003385 3300049585 Bacteria 8186
178 Ga0501070_0013124 3300049586 Bacteria 6983
179 Ga0501071_0040454 3300049587 Bacteria 3335
180 Ga0501071_0089439 3300049587 Bacteria 2260
181 Ga0501071_0102356 3300049587 Bacteria 2112
182 Ga0501072_0037800 3300049588 Bacteria 3786
183 Ga0501072_0077019 3300049588 Bacteria 2640
184 Ga0501072_0148860 3300049588 Bacteria 1867
185 Ga0501072_0197827 3300049588 Bacteria 1602
186 Ga0501072_0280022 3300049588 Bacteria 1327
187 Ga0501072_0384152 3300049588 Bacteria 1114
188 Ga0501074_0024880 3300049590 Bacteria 4349
189 Ga0501074_0032671 3300049590 Bacteria 3769
190 Ga0501074_0097296 3300049590 Bacteria 2107
191 Ga0501075_0011801 3300049591 Bacteria 6195
192 Ga0501075_0043692 3300049591 Bacteria 3361
193 Ga0501075_0101302 3300049591 Bacteria 2187
194 Ga0501075_0167829 3300049591 Bacteria 1674
195 Ga0501076_0001767 3300049592 Bacteria 14627
196 Ga0501076_0006193 3300049592 Bacteria 8658
197 Ga0501076_0026148 3300049592 Bacteria 4519
198 Ga0501076_0052663 3300049592 Bacteria 3224
199 Ga0501076_0123407 3300049592 Bacteria 2098
200 Ga0501076_0269429 3300049592 Bacteria 1394
201 Ga0501077_0026552 3300049593 Bacteria 3674
202 Ga0501077_0066020 3300049593 Bacteria 2295
203 Ga0501077_0097978 3300049593 Bacteria 1858
204 Ga0501077_0240678 3300049593 Bacteria 1150
205 Ga0501077_0312073 3300049593 Bacteria 1002
206 Ga0501079_0045151 3300049741 Bacteria 3401
207 Ga0501079_0210914 3300049741 Bacteria 1517
208 Ga0501079_0236114 3300049741 Bacteria 1428
209 Ga0501079_0247300 3300049741 Bacteria 1393
210 Ga0501080_0074008 3300049742 Bacteria 3169
211 Ga0501081_0054771 3300049743 Bacteria 2755
212 Ga0501081_0060460 3300049743 Bacteria 2625
213 Ga0501081_0121964 3300049743 Bacteria 1857
214 Ga0501081_0470965 3300049743 Bacteria 934
215 Ga0501083_0029143 3300049744 Bacteria 3800
216 Ga0501045_0036164 3300049824 Bacteria 3585
217 Ga0501045_0066971 3300049824 Bacteria 2637
218 Ga0501045_0211815 3300049824 Bacteria 1443
219 Ga0501045_0296089 3300049824 Bacteria 1204
220 nmdc:mga05p37_289591_c1 3300050507 Bacteria 1950
221 nmdc:mga05p37_487301_c1 3300050507 Bacteria 1418
222 nmdc:mga05p37_49895_c1 3300050507 Bacteria 5147
223 nmdc:mga08y16_228253_c1 3300050511 Bacteria 1926
224 nmdc:mga08y16_287814_c1 3300050511 Bacteria 1694
225 nmdc:mga0n895_362750_c1 3300050512 Bacteria 1467
226 Ga0501084_0068835 3300054114 Bacteria 2963
227 Ga0501084_0076279 3300054114 Bacteria 2810
228 Ga0501084_0183183 3300054114 Bacteria 1768
229 Ga0501082_0044937 3300060353 Bacteria 3810
230 Ga0501082_0078587 3300060353 Bacteria 2846
231 Ga0501082_0087940 3300060353 Bacteria 2681
232 Ga0501082_0089417 3300060353 Bacteria 2659
233 Ga0501082_0110712 3300060353 Bacteria 2377
234 Ga0501082_0208449 3300060353 Bacteria 1700
235 Ga0530510_0001464 3300061734 Bacteria 15840
236 Ga0530510_0064750 3300061734 Bacteria 2648
237 Ga0530510_0158057 3300061734 Bacteria 1676
238 Ga0530510_0162052 3300061734 Bacteria 1654
239 Ga0530510_0209653 3300061734 Bacteria 1448
240 Ga0530510_0289567 3300061734 Bacteria 1224
241 Ga0209974_10093322
242 rootH1_10223786
243 Ga0070683_100197053
244 Ga0070680_100056498
245 Ga0070692_10015798
246 Ga0070688_100175396
247 Ga0070703_10057346
248 Ga0070705_100017324
249 Ga0070705_100063423
250 Ga0070705_100287366
251 Ga0070700_100022363
252 Ga0070694_100030254
253 Ga0070694_100037068
254 Ga0070708_100006545
255 Ga0070708_100151549
256 Ga0070662_100024833
257 Ga0070706_100001052
258 Ga0070706_100050577
259 Ga0070706_100141295
260 Ga0070707_100001500
261 Ga0070707_100004686
262 Ga0070698_100052008
263 Ga0070699_100001368
264 Ga0070699_100028216
265 Ga0070699_100117228
266 Ga0070699_100320450
267 Ga0070684_100153545
268 Ga0070695_100007972
269 Ga0070695_100008841
270 Ga0070696_100008181
271 Ga0070696_100009936
272 Ga0070704_100058792
273 Ga0070704_100063148
274 Ga0068860_100054984
275 Ga0081539_10004978
276 Ga0081539_10007122
277 Ga0075428_100135392
278 Ga0075434_100375825
279 Ga0068865_100320687
280 Ga0075435_100159224
281 Ga0111539_10160460
282 Ga0111539_10190467
283 Ga0105245_10148873
284 Ga0105243_10168362
285 Ga0105249_10004962
286 Ga0157378_10316711
287 Ga0157375_10020061
288 Ga0163163_10039994
289 Ga0163163_10124066
290 Ga0157380_10367927
291 Ga0157377_10078978
292 Ga0157377_10384115
293 Ga0157379_10013703
294 Ga0157379_10049993
295 Ga0157376_10038056
296 Ga0163161_10036073
297 Ga0207653_10011051
298 Ga0207684_10003227
299 Ga0207684_10003286
300 Ga0207684_10233189
301 Ga0207646_10001588
302 Ga0207646_10003310
303 Ga0207646_10008630
304 Ga0207646_10054994
305 Ga0207659_10054616
306 Ga0207687_10148994
307 Ga0207706_10168666
308 Ga0207704_10248806
309 Ga0207711_10721374
310 Ga0207661_10045832
311 Ga0207712_10512358
312 Ga0207703_10040107
313 Ga0207708_10096728
314 Ga0207676_10306431
315 Ga0207674_10208545
316 Ga0207428_10367585
317 Ga0268264_10073026
318 Ga0265319_1001120
319 Ga0265334_10002072
320 Ga0265334_10005664
321 Ga0265318_10004276
322 Ga0265318_10053048
323 Ga0265318_10070977
324 Ga0265322_10015560
325 Ga0265336_10005464
326 Ga0265338_10239251
327 Ga0265332_10002131
328 Ga0265328_10057900
329 Ga0265320_10000888
330 Ga0265320_10002200
331 Ga0265320_10065266
332 Ga0265325_10082632
333 Ga0265340_10003670
334 Ga0265339_10020712
335 Ga0265339_10080707
336 Ga0265331_10149149
337 Ga0265316_10008864
338 Ga0307408_100342524
339 Ga0265313_10008028
340 Ga0265313_10063842
341 Ga0316575_10019176
342 Ga0265314_10012998
343 Ga0265314_10106992
344 Ga0265342_10048899
345 Ga0265342_10066742
346 Ga0307405_10132085
347 Ga0307413_10039303
348 Ga0307413_10306587
349 Ga0307406_10223971
350 Ga0307409_100043140
351 Ga0439466_0013397
352 Ga0451793_1470974
353 Ga0451849_0030653
354 Ga0439446_0041550
355 Ga0451577_0075980
356 Ga0466961_0415886
357 Ga0451576_0311377
358 Ga0495651_0203352
359 Ga0495653_0106924
360 Ga0495630_0111478
361 Ga0495656_0048971
362 Ga0495674_0194385
363 Ga0496101_0033486
364 Ga0496102_0018686
365 Ga0496102_0175583
366 Ga0496103_0044755
367 Ga0496104_0007822
368 Ga0496104_0011551
369 Ga0496104_0069158
370 Ga0496104_0100520
371 Ga0496105_0003705
372 Ga0496105_0007419
373 Ga0496105_0029864
374 Ga0496105_0418265
375 Ga0496106_0182119
376 Ga0496107_0045740
377 Ga0496107_0316527
378 Ga0496108_0005779
379 Ga0496108_0176143
380 Ga0496108_0192256
381 Ga0496109_0002898
382 Ga0496109_0086818
383 Ga0496109_0232504
384 Ga0496110_0003793
385 Ga0496110_0037439
386 Ga0496110_0107846
387 Ga0496111_0001236
388 Ga0496111_0055811
389 Ga0496112_0027963
390 Ga0496113_0001423
391 Ga0496113_0007489
392 Ga0496113_0059804
393 Ga0496114_0474053
394 Ga0501034_0187088
395 Ga0501036_0020083
396 Ga0501036_0040263
397 Ga0501036_0402590
398 Ga0501037_0071835
399 Ga0501038_0113403
400 Ga0501038_0208995
401 Ga0501039_0051577
402 Ga0501039_0142820
403 Ga0501040_0084287
404 Ga0501040_0192202
405 Ga0501041_0022166
406 Ga0501041_0035395
407 Ga0501041_0077416
408 Ga0501042_0111264
409 Ga0501042_0117473
410 Ga0501042_0296258
411 Ga0501043_0029965
412 Ga0501046_0007079
413 Ga0501048_0053099
414 Ga0501048_0102165
415 Ga0501067_0101623
416 Ga0501068_0029649
417 Ga0501069_0003385
418 Ga0501070_0013124
419 Ga0501071_0040454
420 Ga0501071_0089439
421 Ga0501071_0102356
422 Ga0501072_0037800
423 Ga0501072_0077019
424 Ga0501072_0148860
425 Ga0501072_0197827
426 Ga0501072_0280022
427 Ga0501072_0384152
428 Ga0501074_0024880
429 Ga0501074_0032671
430 Ga0501074_0097296
431 Ga0501075_0011801
432 Ga0501075_0043692
433 Ga0501075_0101302
434 Ga0501075_0167829
435 Ga0501076_0001767
436 Ga0501076_0006193
437 Ga0501076_0026148
438 Ga0501076_0052663
439 Ga0501076_0123407
440 Ga0501076_0269429
441 Ga0501077_0026552
442 Ga0501077_0066020
443 Ga0501077_0097978
444 Ga0501077_0240678
445 Ga0501077_0312073
446 Ga0501079_0045151
447 Ga0501079_0210914
448 Ga0501079_0236114
449 Ga0501079_0247300
450 Ga0501080_0074008
451 Ga0501081_0054771
452 Ga0501081_0060460
453 Ga0501081_0121964
454 Ga0501081_0470965
455 Ga0501083_0029143
456 Ga0501045_0036164
457 Ga0501045_0066971
458 Ga0501045_0211815
459 Ga0501045_0296089
460 nmdc:mga05p37_289591_c1
461 nmdc:mga05p37_487301_c1
462 nmdc:mga05p37_49895_c1
463 nmdc:mga08y16_228253_c1
464 nmdc:mga08y16_287814_c1
465 nmdc:mga0n895_362750_c1
466 Ga0501084_0068835
467 Ga0501084_0076279
468 Ga0501084_0183183
469 Ga0501082_0044937
470 Ga0501082_0078587
471 Ga0501082_0087940
472 Ga0501082_0089417
473 Ga0501082_0110712
474 Ga0501082_0208449
475 Ga0530510_0001464
476 Ga0530510_0064750
477 Ga0530510_0158057
478 Ga0530510_0162052
479 Ga0530510_0209653
480 Ga0530510_0289567

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21948

LplA-B_cat

Lipoyl protein ligase A/B catalytic domain

38

230

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qhv-assembly1.cif.gz_A structural basis of octanoic acid recognition by lipoate-protein ligase b 0.917 30 247
2qhv-assembly1.cif.gz_A structural basis of octanoic acid recognition by lipoate-protein ligase b 0.8922 30 247
1w66-assembly1.cif.gz_A structure of a lipoate-protein ligase b from mycobacterium tuberculosis 0.8908 31 242
1w66-assembly1.cif.gz_A structure of a lipoate-protein ligase b from mycobacterium tuberculosis 0.8177 31 242
2p5i-assembly1.cif.gz_A crystal structure of protein bh3822 from bacillus halodurans, a member of the biotin/lipoate a/b protein ligase family 0.7574 30 244
ID Description Score Start End Superfamily
af_Q9SXP7_6_215_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9113 31 246 3.30.930.10
af_P60720_2_203_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9 28 241 3.30.930.10
af_Q9SXP7_6_215_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8989 31 246 3.30.930.10
1w66A01 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8908 31 242 3.30.930.10
af_P60720_2_203_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8874 28 241 3.30.930.10
ID Description Score Start End GO Terms
AF-A0A1F8S993-F1-model_v4 Octanoyltransferase (EC 2.3.1.181) (Lipoate-protein ligase B) (Lipoyl/octanoyl transferase) (Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase) 0.9781 28 251 GO:0005737
GO:0033819
AF-A0A1F8S8Q7-F1-model_v4 Octanoyltransferase (EC 2.3.1.181) (Lipoate-protein ligase B) (Lipoyl/octanoyl transferase) (Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase) 0.9779 32 251 GO:0005737
GO:0033819
AF-A0A660VAY6-F1-model_v4 lipoyl(octanoyl) transferase (EC 2.3.1.181) 0.9702 31 198 GO:0033819
AF-A0A7V8VPI9-F1-model_v4 Octanoyltransferase 0.9592 29 123 GO:0033819
AF-A0A1F8S8Q7-F1-model_v4 Octanoyltransferase (EC 2.3.1.181) (Lipoate-protein ligase B) (Lipoyl/octanoyl transferase) (Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase) 0.9564 32 251 GO:0005737
GO:0033819

Map