F352572

General Info

Members Datasets Scaffolds Average Seq Length
240 109 240 149

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_101306199|Ga0070689_1013061991
Length 181
Sequence MRSLIFCAVHTIRAFRIRRKPRPQWMSAPRPRKMINLELKFPFPEQLLERAAQAALEHESQSIDSDLSIVLTDNEHLHELNLNYLGVDSPTDVLSFPASEKDPETGAHYLGDILISIPRAQAQAEAAGHPLESEVQLLVVHGVLHLLGHDHAEPADKARMWKAQDEILESLGLGNIKIREE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
34 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
35 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
36 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
49 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
50 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
51 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
52 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
53 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
54 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
55 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
56 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
57 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
58 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
59 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
60 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
61 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
62 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
63 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
64 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
65 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
66 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
67 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
68 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
69 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
70 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
71 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
72 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
73 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
74 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
75 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
77 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
78 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
79 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
80 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
81 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
82 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
83 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
84 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
85 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
86 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
87 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
88 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
95 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
96 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
97 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
98 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
99 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
101 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
102 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
103 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
104 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
105 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
106 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
107 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
108 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
109 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.42
Rhizosphere 99.58
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_310132 2162886007 Bacteria 10317
2 JGI25406J46586_10004807 3300003203 Bacteria 6281
3 Ga0065704_10070812 3300005289 Bacteria 15813
4 Ga0065707_10000483 3300005295 Bacteria 53504
5 Ga0065707_10095071 3300005295 Bacteria 3422
6 Ga0065707_10123060 3300005295 Bacteria 2074
7 Ga0065707_10159274 3300005295 Bacteria 1578
8 Ga0070690_100896305 3300005330 Bacteria 693
9 Ga0070689_101306199 3300005340 Unclassified 653
10 Ga0070689_101918128 3300005340 Bacteria 541
11 Ga0070692_10173613 3300005345 Unclassified 1244
12 Ga0070705_100037903 3300005440 Bacteria 2723
13 Ga0070705_100163421 3300005440 Bacteria 1491
14 Ga0070700_100041088 3300005441 Bacteria 2834
15 Ga0070694_100261996 3300005444 Bacteria 1312
16 Ga0070706_100049836 3300005467 Bacteria 3864
17 Ga0070706_100059879 3300005467 Bacteria 3515
18 Ga0070707_100166961 3300005468 Bacteria 2145
19 Ga0070707_100297992 3300005468 Unclassified 1567
20 Ga0070698_100015791 3300005471 Bacteria 7975
21 Ga0070698_100016945 3300005471 Bacteria 7681
22 Ga0070698_100319391 3300005471 Bacteria 1484
23 Ga0070699_100000285 3300005518 Bacteria 48435
24 Ga0070699_100160758 3300005518 Bacteria 1988
25 Ga0070699_100342683 3300005518 Unclassified 1345
26 Ga0070699_101179473 3300005518 Unclassified 702
27 Ga0070697_101515797 3300005536 Bacteria 599
28 Ga0070696_100357180 3300005546 Bacteria 1133
29 Ga0070704_100366075 3300005549 Bacteria 1221
30 Ga0070704_100378275 3300005549 Unclassified 1202
31 Ga0070704_101339807 3300005549 Unclassified 656
32 Ga0068857_100433482 3300005577 Bacteria 1227
33 Ga0068861_100043430 3300005719 Bacteria 3375
34 Ga0068861_101305380 3300005719 Unclassified 706
35 Ga0068862_100039786 3300005844 Bacteria 3995
36 Ga0068862_100108824 3300005844 Bacteria 2431
37 Ga0068862_100147345 3300005844 Bacteria 2093
38 Ga0068862_100156969 3300005844 Bacteria 2029
39 Ga0081539_10006348 3300005985 Bacteria 11389
40 Ga0075427_10001276 3300006194 Bacteria 3218
41 Ga0075428_100018356 3300006844 Bacteria 7733
42 Ga0075428_100069116 3300006844 Unclassified 3863
43 Ga0075428_100333850 3300006844 Bacteria 1628
44 Ga0075428_100514139 3300006844 Unclassified 1281
45 Ga0075430_100128966 3300006846 Bacteria 2108
46 Ga0075430_100130340 3300006846 Bacteria 2096
47 Ga0075431_100023357 3300006847 Bacteria 6326
48 Ga0075431_100122791 3300006847 Unclassified 2679
49 Ga0075431_100122867 3300006847 Bacteria 2679
50 Ga0075431_100470900 3300006847 Bacteria 1250
51 Ga0075434_100101444 3300006871 Bacteria 2884
52 Ga0075434_100478311 3300006871 Unclassified 1267
53 Ga0075434_101984616 3300006871 Bacteria 587
54 Ga0075429_100000170 3300006880 Bacteria 41847
55 Ga0075429_100111558 3300006880 Bacteria 2390
56 Ga0075429_100134002 3300006880 Unclassified 2168
57 Ga0075429_100162395 3300006880 Bacteria 1956
58 Ga0105240_11160810 3300009093 Unclassified 819
59 Ga0111539_10083196 3300009094 Bacteria 3764
60 Ga0111539_10706854 3300009094 Bacteria 1173
61 Ga0111539_10881085 3300009094 Bacteria 1041
62 Ga0111539_10969503 3300009094 Unclassified 989
63 Ga0114129_10000806 3300009147 Bacteria 40261
64 Ga0114129_10006829 3300009147 Bacteria 16216
65 Ga0114129_10010692 3300009147 Bacteria 13089
66 Ga0114129_10011488 3300009147 Bacteria 12608
67 Ga0114129_10169704 3300009147 Unclassified 2975
68 Ga0114129_10259787 3300009147 Bacteria 2328
69 Ga0114129_10304047 3300009147 Bacteria 2125
70 Ga0105243_10055223 3300009148 Bacteria 3155
71 Ga0105243_10081103 3300009148 Unclassified 2648
72 Ga0105243_10251340 3300009148 Bacteria 1578
73 Ga0105243_10312649 3300009148 Unclassified 1428
74 Ga0105249_10034312 3300009553 Bacteria 4598
75 Ga0105246_10282216 3300011119 Unclassified 1333
76 Ga0157380_10554871 3300014326 Bacteria 1128
77 Ga0157380_12451931 3300014326 Unclassified 587
78 Ga0157379_12522864 3300014968 Unclassified 514
79 Ga0207684_10103650 3300025910 Bacteria 2432
80 Ga0207684_10367277 3300025910 Bacteria 1238
81 Ga0207646_10070872 3300025922 Bacteria 3113
82 Ga0207646_10124787 3300025922 Bacteria 2314
83 Ga0207709_10033084 3300025935 Bacteria 3033
84 Ga0207709_10232209 3300025935 Unclassified 1337
85 Ga0207670_10086962 3300025936 Unclassified 2201
86 Ga0207712_11174872 3300025961 Bacteria 684
87 Ga0207712_11792135 3300025961 Unclassified 550
88 Ga0207708_10040422 3300026075 Bacteria 3556
89 Ga0207676_11622264 3300026095 Bacteria 645
90 Ga0207674_10687363 3300026116 Unclassified 988
91 Ga0207675_100021140 3300026118 Bacteria 6063
92 Ga0209995_1023798 3300027471 Unclassified 1019
93 Ga0209968_1012809 3300027526 Unclassified 1310
94 Ga0268265_10056537 3300028380 Unclassified 2986
95 Ga0268265_10086024 3300028380 Unclassified 2497
96 Ga0265326_10022349 3300028558 Bacteria 1812
97 Ga0265318_10009344 3300028577 Bacteria 4315
98 Ga0265338_10133025 3300028800 Bacteria 1960
99 Ga0265328_10033164 3300031239 Bacteria 1915
100 Ga0265320_10010083 3300031240 Bacteria 5650
101 Ga0265340_10009695 3300031247 Bacteria 5161
102 Ga0265331_10007916 3300031250 Bacteria 6089
103 Ga0265316_10027595 3300031344 Bacteria 4698
104 Ga0307408_100233130 3300031548 Bacteria 1509
105 Ga0316575_10378649 3300031665 Unclassified 605
106 Ga0316579_10351049 3300031691 Bacteria 713
107 Ga0265342_10308566 3300031712 Bacteria 832
108 Ga0316576_10069335 3300031727 Bacteria 2600
109 Ga0316578_10307819 3300031728 Bacteria 947
110 Ga0307405_11692967 3300031731 Unclassified 560
111 Ga0316577_10081230 3300031733 Bacteria 1813
112 Ga0316577_10284205 3300031733 Unclassified 937
113 Ga0307413_10018995 3300031824 Bacteria 3620
114 Ga0307410_10064667 3300031852 Unclassified 2514
115 Ga0307410_10428207 3300031852 Unclassified 1075
116 Ga0307406_10061848 3300031901 Bacteria 2420
117 Ga0307407_10011217 3300031903 Bacteria 4255
118 Ga0307412_10067000 3300031911 Unclassified 2436
119 Ga0307412_11320638 3300031911 Unclassified 650
120 Ga0307409_100010153 3300031995 Bacteria 5834
121 Ga0307416_101413677 3300032002 Bacteria 801
122 Ga0307416_102105873 3300032002 Unclassified 666
123 Ga0307411_11162584 3300032005 Unclassified 698
124 Ga0307415_100034521 3300032126 Unclassified 3294
125 Ga0316585_10158611 3300032137 Bacteria 747
126 Ga0316585_10241281 3300032137 Bacteria 599
127 Ga0316580_10160350 3300032139 Bacteria 691
128 Ga0316596_1206554 3300033541 Bacteria 547
129 Ga0373938_0102015 3300034957 Bacteria 722
130 Ga0373940_0157726 3300035088 Unclassified 727
131 Ga0373939_0095251 3300035114 Bacteria 1013
132 Ga0373941_0074352 3300035115 Bacteria 1135
133 Ga0316574_0516213 3300035398 Unclassified 744
134 Ga0316582_0071648 3300036647 Bacteria 2245
135 Ga0316584_0186570 3300036712 Unclassified 1534
136 Ga0451800_0084858 3300041459 Bacteria 1301
137 Ga0451577_0001325 3300042876 Bacteria 33718
138 Ga0451577_0007597 3300042876 Bacteria 10636
139 Ga0451577_0026809 3300042876 Bacteria 5217
140 Ga0451577_0112738 3300042876 Bacteria 2434
141 Ga0451577_0265747 3300042876 Bacteria 1553
142 Ga0451577_0368961 3300042876 Bacteria 1302
143 Ga0451577_0370243 3300042876 Bacteria 1300
144 Ga0451577_0419913 3300042876 Unclassified 1214
145 Ga0451577_0438003 3300042876 Unclassified 1187
146 Ga0451577_1857912 3300042876 Bacteria 528
147 Ga0453683_0003060 3300044673 Bacteria 12524
148 Ga0453683_0018039 3300044673 Unclassified 4532
149 Ga0453683_0047830 3300044673 Unclassified 2682
150 Ga0453683_0161976 3300044673 Bacteria 1415
151 Ga0453683_0243463 3300044673 Unclassified 1146
152 Ga0453683_0283899 3300044673 Bacteria 1057
153 Ga0453684_0000003 3300044712 Bacteria 1481694
154 Ga0453684_0000464 3300044712 Bacteria 161638
155 Ga0453684_0002232 3300044712 Bacteria 48042
156 Ga0453684_0003794 3300044712 Bacteria 33345
157 Ga0453684_0003946 3300044712 Bacteria 32470
158 Ga0453684_0006856 3300044712 Bacteria 21403
159 Ga0453684_0009447 3300044712 Bacteria 17058
160 Ga0453684_0012688 3300044712 Bacteria 13838
161 Ga0453684_0013707 3300044712 Bacteria 13124
162 Ga0453684_0026748 3300044712 Bacteria 8314
163 Ga0453684_0033512 3300044712 Bacteria 7158
164 Ga0453684_0041894 3300044712 Bacteria 6182
165 Ga0453684_0044118 3300044712 Bacteria 5975
166 Ga0453684_0046956 3300044712 Bacteria 5734
167 Ga0453684_0052323 3300044712 Bacteria 5342
168 Ga0453684_0086191 3300044712 Bacteria 3898
169 Ga0453684_0094383 3300044712 Bacteria 3680
170 Ga0453684_0095429 3300044712 Bacteria 3655
171 Ga0453684_0106514 3300044712 Unclassified 3416
172 Ga0453684_0142424 3300044712 Unclassified 2861
173 Ga0453684_0176730 3300044712 Bacteria 2510
174 Ga0453684_0383635 3300044712 Bacteria 1577
175 Ga0453684_0411381 3300044712 Unclassified 1513
176 Ga0453684_0493634 3300044712 Bacteria 1357
177 Ga0453684_0517691 3300044712 Unclassified 1318
178 Ga0453684_0544433 3300044712 Bacteria 1279
179 Ga0453684_0586542 3300044712 Bacteria 1223
180 Ga0453684_0601695 3300044712 Bacteria 1205
181 Ga0453684_0688648 3300044712 Bacteria 1112
182 Ga0453684_0954109 3300044712 Unclassified 915
183 Ga0453684_1058593 3300044712 Bacteria 859
184 Ga0453684_1095003 3300044712 Unclassified 842
185 Ga0453684_1144536 3300044712 Bacteria 820
186 Ga0453684_1226169 3300044712 Unclassified 786
187 Ga0453684_2162593 3300044712 Bacteria 556
188 Ga0451576_0019324 3300045051 Bacteria 7435
189 Ga0451576_0040727 3300045051 Bacteria 4914
190 Ga0451576_0089751 3300045051 Bacteria 3197
191 Ga0451576_0146938 3300045051 Unclassified 2458
192 Ga0451576_0186846 3300045051 Unclassified 2164
193 Ga0451576_0190812 3300045051 Unclassified 2140
194 Ga0451576_0298156 3300045051 Unclassified 1685
195 Ga0451576_0438656 3300045051 Bacteria 1370
196 Ga0451576_0590756 3300045051 Bacteria 1167
197 Ga0451576_1327648 3300045051 Bacteria 749
198 Ga0451576_2033593 3300045051 Unclassified 591
199 Ga0501038_0858394 3300049574 Bacteria 672
200 Ga0501039_0210320 3300049575 Unclassified 1530
201 Ga0501040_1025498 3300049576 Unclassified 598
202 Ga0501041_0311895 3300049577 Unclassified 992
203 Ga0501042_0698842 3300049578 Bacteria 737
204 Ga0501048_1004871 3300049582 Bacteria 600
205 Ga0501072_0597541 3300049588 Unclassified 870
206 Ga0501075_0894067 3300049591 Unclassified 675
207 Ga0501076_0125163 3300049592 Archaea 2083
208 Ga0501076_1357715 3300049592 Unclassified 584
209 Ga0501207_044889 3300049654 Bacteria 777
210 Ga0501081_0201137 3300049743 Bacteria 1445
211 Ga0501035_0684296 3300049822 Unclassified 829
212 Ga0501045_0408335 3300049824 Bacteria 1010
213 nmdc:mga05p37_1022602_c1 3300050507 Unclassified 875
214 nmdc:mga05p37_102685_c1 3300050507 Bacteria 3520
215 nmdc:mga05p37_107115_c1 3300050507 Bacteria 3439
216 nmdc:mga05p37_359943_c1 3300050507 Bacteria 1711
217 nmdc:mga05p37_476_c1 3300050507 Bacteria 43712
218 nmdc:mga05p37_6813_c1 3300050507 Bacteria 13467
219 nmdc:mga05p37_87009_c1 3300050507 Bacteria 3852
220 nmdc:mga05p37_92461_c1 3300050507 Unclassified 3727
221 nmdc:mga09592_147626_c1 3300050508 Bacteria 2028
222 nmdc:mga09592_15149_c1 3300050508 Bacteria 6299
223 nmdc:mga09592_284_c1 3300050508 Bacteria 36913
224 nmdc:mga09592_332075_c1 3300050508 Unclassified 1316
225 nmdc:mga09592_60224_c1 3300050508 Unclassified 3209
226 nmdc:mga09592_69666_c1 3300050508 Bacteria 2984
227 nmdc:mga0qj67_193371_c1 3300050509 Bacteria 1653
228 nmdc:mga0qj67_49616_c1 3300050509 Bacteria 3317
229 nmdc:mga06r32_1018296_c1 3300050510 Unclassified 780
230 nmdc:mga06r32_270061_c1 3300050510 Bacteria 1688
231 nmdc:mga06r32_584594_c1 3300050510 Bacteria 1089
232 nmdc:mga0n895_206764_c1 3300050512 Unclassified 1993
233 nmdc:mga0n895_524235_c1 3300050512 Unclassified 1192
234 nmdc:mga0a205_890057_c1 3300050515 Bacteria 737
235 Ga0501084_0104333 3300054114 Archaea 2381
236 Ga0501084_0953528 3300054114 Bacteria 721
237 Ga0501082_0263516 3300060353 Unclassified 1499
238 Ga0501082_1058399 3300060353 Unclassified 709
239 Ga0530510_0069112 3300061734 Bacteria 2563
240 Ga0530510_0232408 3300061734 Bacteria 1372

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028558 Ga0265326_10022349 Ga0265326_100223492 140
2 3300028577 Ga0265318_10009344 Ga0265318_100093443 140
3 3300028800 Ga0265338_10133025 Ga0265338_101330252 140
4 3300031239 Ga0265328_10033164 Ga0265328_100331642 140
5 3300031240 Ga0265320_10010083 Ga0265320_100100834 140
6 3300031247 Ga0265340_10009695 Ga0265340_100096954 140
7 3300031250 Ga0265331_10007916 Ga0265331_100079164 140
8 3300031344 Ga0265316_10027595 Ga0265316_100275953 140
9 3300031712 Ga0265342_10308566 Ga0265342_103085661 140
10 3300044712 Ga0453684_0033512 Ga0453684_0033512_2167_2628 141
11 3300032139 Ga0316580_10160350 Ga0316580_101603501 143
12 3300042876 Ga0451577_1857912 Ga0451577_1857912_27_473 143
13 3300044712 Ga0453684_0013707 Ga0453684_0013707_11467_11913 143
14 3300005467 Ga0070706_100059879 Ga0070706_1000598792 144
15 3300025910 Ga0207684_10103650 Ga0207684_101036502 144
16 3300031665 Ga0316575_10378649 Ga0316575_103786492 144
17 3300031691 Ga0316579_10351049 Ga0316579_103510492 144
18 3300031727 Ga0316576_10069335 Ga0316576_100693353 144
19 3300031728 Ga0316578_10307819 Ga0316578_103078192 144
20 3300031733 Ga0316577_10081230 Ga0316577_100812303 144
21 3300031733 Ga0316577_10284205 Ga0316577_102842052 144
22 3300032137 Ga0316585_10158611 Ga0316585_101586112 144
23 3300032137 Ga0316585_10241281 Ga0316585_102412811 144
24 3300033541 Ga0316596_1206554 Ga0316596_12065541 144
25 3300036647 Ga0316582_0071648 Ga0316582_0071648_188_637 144
26 3300036712 Ga0316584_0186570 Ga0316584_0186570_910_1359 144
27 3300042876 Ga0451577_0368961 Ga0451577_0368961_122_592 144
28 3300044673 Ga0453683_0047830 Ga0453683_0047830_105_575 144
29 3300044712 Ga0453684_0106514 Ga0453684_0106514_309_779 144
30 3300044712 Ga0453684_0142424 Ga0453684_0142424_860_1330 144
31 3300044712 Ga0453684_0688648 Ga0453684_0688648_187_681 144
32 3300045051 Ga0451576_0146938 Ga0451576_0146938_856_1326 144
33 3300035398 Ga0316574_0516213 Ga0316574_0516213_103_552 145
34 3300042876 Ga0451577_0265747 Ga0451577_0265747_665_1111 145
35 3300042876 Ga0451577_0370243 Ga0451577_0370243_345_803 145
36 3300044712 Ga0453684_0000464 Ga0453684_0000464_46366_46812 145
37 3300044712 Ga0453684_0383635 Ga0453684_0383635_819_1277 145
38 3300032005 Ga0307411_11162584 Ga0307411_111625841 146
39 3300042876 Ga0451577_0007597 Ga0451577_0007597_3106_3561 147
40 3300044712 Ga0453684_0000003 Ga0453684_0000003_201656_202111 147
41 3300044712 Ga0453684_0006856 Ga0453684_0006856_5439_5885 147
42 2162886007 SwRhRL2b_contig_310132 SwRhRL2b_0380.00007460 148
43 3300003203 JGI25406J46586_10004807 JGI25406J46586_100048074 148
44 3300005289 Ga0065704_10070812 Ga0065704_100708123 148
45 3300005295 Ga0065707_10000483 Ga0065707_1000048349 148
46 3300005295 Ga0065707_10095071 Ga0065707_100950713 148
47 3300005295 Ga0065707_10123060 Ga0065707_101230603 148
48 3300005295 Ga0065707_10159274 Ga0065707_101592742 148
49 3300005330 Ga0070690_100896305 Ga0070690_1008963051 148
50 3300005340 Ga0070689_101306199 Ga0070689_1013061991 148
51 3300005340 Ga0070689_101918128 Ga0070689_1019181281 148
52 3300005345 Ga0070692_10173613 Ga0070692_101736132 148
53 3300005440 Ga0070705_100037903 Ga0070705_1000379033 148
54 3300005440 Ga0070705_100163421 Ga0070705_1001634212 148
55 3300005441 Ga0070700_100041088 Ga0070700_1000410882 148
56 3300005444 Ga0070694_100261996 Ga0070694_1002619962 148
57 3300005467 Ga0070706_100049836 Ga0070706_1000498362 148
58 3300005468 Ga0070707_100166961 Ga0070707_1001669611 148
59 3300005468 Ga0070707_100297992 Ga0070707_1002979922 148
60 3300005471 Ga0070698_100015791 Ga0070698_1000157914 148
61 3300005471 Ga0070698_100016945 Ga0070698_1000169452 148
62 3300005471 Ga0070698_100319391 Ga0070698_1003193912 148
63 3300005518 Ga0070699_100000285 Ga0070699_10000028523 148
64 3300005518 Ga0070699_100160758 Ga0070699_1001607583 148
65 3300005518 Ga0070699_100342683 Ga0070699_1003426832 148
66 3300005518 Ga0070699_101179473 Ga0070699_1011794732 148
67 3300005536 Ga0070697_101515797 Ga0070697_1015157971 148
68 3300005546 Ga0070696_100357180 Ga0070696_1003571802 148
69 3300005549 Ga0070704_100366075 Ga0070704_1003660752 148
70 3300005549 Ga0070704_100378275 Ga0070704_1003782752 148
71 3300005549 Ga0070704_101339807 Ga0070704_1013398072 148
72 3300005577 Ga0068857_100433482 Ga0068857_1004334821 148
73 3300005719 Ga0068861_100043430 Ga0068861_1000434305 148
74 3300005719 Ga0068861_101305380 Ga0068861_1013053802 148
75 3300005844 Ga0068862_100039786 Ga0068862_1000397864 148
76 3300005844 Ga0068862_100108824 Ga0068862_1001088241 148
77 3300005844 Ga0068862_100147345 Ga0068862_1001473452 148
78 3300005844 Ga0068862_100156969 Ga0068862_1001569691 148
79 3300005985 Ga0081539_10006348 Ga0081539_100063483 148
80 3300006194 Ga0075427_10001276 Ga0075427_100012762 148
81 3300006844 Ga0075428_100018356 Ga0075428_1000183563 148
82 3300006844 Ga0075428_100069116 Ga0075428_1000691162 148
83 3300006844 Ga0075428_100333850 Ga0075428_1003338502 148
84 3300006844 Ga0075428_100514139 Ga0075428_1005141393 148
85 3300006846 Ga0075430_100128966 Ga0075430_1001289663 148
86 3300006846 Ga0075430_100130340 Ga0075430_1001303402 148
87 3300006847 Ga0075431_100023357 Ga0075431_1000233574 148
88 3300006847 Ga0075431_100122791 Ga0075431_1001227912 148
89 3300006847 Ga0075431_100122867 Ga0075431_1001228671 148
90 3300006847 Ga0075431_100470900 Ga0075431_1004709003 148
91 3300006871 Ga0075434_100101444 Ga0075434_1001014442 148
92 3300006871 Ga0075434_100478311 Ga0075434_1004783112 148
93 3300006871 Ga0075434_101984616 Ga0075434_1019846162 148
94 3300006880 Ga0075429_100000170 Ga0075429_10000017012 148
95 3300006880 Ga0075429_100111558 Ga0075429_1001115582 148
96 3300006880 Ga0075429_100134002 Ga0075429_1001340023 148
97 3300006880 Ga0075429_100162395 Ga0075429_1001623953 148
98 3300009093 Ga0105240_11160810 Ga0105240_111608101 148
99 3300009094 Ga0111539_10083196 Ga0111539_100831962 148
100 3300009094 Ga0111539_10706854 Ga0111539_107068542 148
101 3300009094 Ga0111539_10881085 Ga0111539_108810851 148
102 3300009094 Ga0111539_10969503 Ga0111539_109695032 148
103 3300009147 Ga0114129_10000806 Ga0114129_1000080634 148
104 3300009147 Ga0114129_10006829 Ga0114129_1000682912 148
105 3300009147 Ga0114129_10010692 Ga0114129_100106927 148
106 3300009147 Ga0114129_10011488 Ga0114129_100114887 148
107 3300009147 Ga0114129_10169704 Ga0114129_101697043 148
108 3300009147 Ga0114129_10259787 Ga0114129_102597872 148
109 3300009147 Ga0114129_10304047 Ga0114129_103040473 148
110 3300009148 Ga0105243_10055223 Ga0105243_100552232 148
111 3300009148 Ga0105243_10081103 Ga0105243_100811031 148
112 3300009148 Ga0105243_10251340 Ga0105243_102513403 148
113 3300009148 Ga0105243_10312649 Ga0105243_103126492 148
114 3300009553 Ga0105249_10034312 Ga0105249_100343122 148
115 3300011119 Ga0105246_10282216 Ga0105246_102822162 148
116 3300014326 Ga0157380_10554871 Ga0157380_105548712 148
117 3300014326 Ga0157380_12451931 Ga0157380_124519311 148
118 3300014968 Ga0157379_12522864 Ga0157379_125228641 148
119 3300025910 Ga0207684_10367277 Ga0207684_103672772 148
120 3300025922 Ga0207646_10070872 Ga0207646_100708724 148
121 3300025922 Ga0207646_10124787 Ga0207646_101247872 148
122 3300025935 Ga0207709_10033084 Ga0207709_100330844 148
123 3300025935 Ga0207709_10232209 Ga0207709_102322092 148
124 3300025936 Ga0207670_10086962 Ga0207670_100869623 148
125 3300025961 Ga0207712_11174872 Ga0207712_111748722 148
126 3300025961 Ga0207712_11792135 Ga0207712_117921351 148
127 3300026075 Ga0207708_10040422 Ga0207708_100404222 148
128 3300026095 Ga0207676_11622264 Ga0207676_116222642 148
129 3300026116 Ga0207674_10687363 Ga0207674_106873632 148
130 3300026118 Ga0207675_100021140 Ga0207675_1000211405 148
131 3300027471 Ga0209995_1023798 Ga0209995_10237982 148
132 3300027526 Ga0209968_1012809 Ga0209968_10128092 148
133 3300028380 Ga0268265_10056537 Ga0268265_100565372 148
134 3300028380 Ga0268265_10086024 Ga0268265_100860243 148
135 3300031548 Ga0307408_100233130 Ga0307408_1002331302 148
136 3300031731 Ga0307405_11692967 Ga0307405_116929671 148
137 3300031824 Ga0307413_10018995 Ga0307413_100189952 148
138 3300031852 Ga0307410_10064667 Ga0307410_100646673 148
139 3300031852 Ga0307410_10428207 Ga0307410_104282073 148
140 3300031901 Ga0307406_10061848 Ga0307406_100618482 148
141 3300031903 Ga0307407_10011217 Ga0307407_100112172 148
142 3300031911 Ga0307412_10067000 Ga0307412_100670003 148
143 3300031911 Ga0307412_11320638 Ga0307412_113206381 148
144 3300031995 Ga0307409_100010153 Ga0307409_1000101534 148
145 3300032002 Ga0307416_101413677 Ga0307416_1014136772 148
146 3300032002 Ga0307416_102105873 Ga0307416_1021058731 148
147 3300032126 Ga0307415_100034521 Ga0307415_1000345213 148
148 3300034957 Ga0373938_0102015 Ga0373938_0102015_86_532 148
149 3300035088 Ga0373940_0157726 Ga0373940_0157726_198_644 148
150 3300035114 Ga0373939_0095251 Ga0373939_0095251_33_479 148
151 3300035115 Ga0373941_0074352 Ga0373941_0074352_183_629 148
152 3300041459 Ga0451800_0084858 Ga0451800_0084858_671_1120 148
153 3300042876 Ga0451577_0001325 Ga0451577_0001325_14141_14590 148
154 3300042876 Ga0451577_0026809 Ga0451577_0026809_1583_2029 148
155 3300042876 Ga0451577_0112738 Ga0451577_0112738_319_765 148
156 3300042876 Ga0451577_0419913 Ga0451577_0419913_229_675 148
157 3300042876 Ga0451577_0438003 Ga0451577_0438003_611_1096 148
158 3300044673 Ga0453683_0003060 Ga0453683_0003060_11804_12253 148
159 3300044673 Ga0453683_0018039 Ga0453683_0018039_3339_3788 148
160 3300044673 Ga0453683_0161976 Ga0453683_0161976_182_661 148
161 3300044673 Ga0453683_0243463 Ga0453683_0243463_38_484 148
162 3300044673 Ga0453683_0283899 Ga0453683_0283899_378_824 148
163 3300044712 Ga0453684_0002232 Ga0453684_0002232_9546_9995 148
164 3300044712 Ga0453684_0003794 Ga0453684_0003794_29932_30381 148
165 3300044712 Ga0453684_0003946 Ga0453684_0003946_4183_4632 148
166 3300044712 Ga0453684_0009447 Ga0453684_0009447_1987_2436 148
167 3300044712 Ga0453684_0012688 Ga0453684_0012688_3948_4421 148
168 3300044712 Ga0453684_0026748 Ga0453684_0026748_2614_3060 148
169 3300044712 Ga0453684_0041894 Ga0453684_0041894_5460_5909 148
170 3300044712 Ga0453684_0044118 Ga0453684_0044118_45_494 148
171 3300044712 Ga0453684_0046956 Ga0453684_0046956_4029_4478 148
172 3300044712 Ga0453684_0052323 Ga0453684_0052323_4657_5103 148
173 3300044712 Ga0453684_0086191 Ga0453684_0086191_2428_2883 148
174 3300044712 Ga0453684_0094383 Ga0453684_0094383_2075_2554 148
175 3300044712 Ga0453684_0095429 Ga0453684_0095429_1782_2240 148
176 3300044712 Ga0453684_0176730 Ga0453684_0176730_1115_1561 148
177 3300044712 Ga0453684_0411381 Ga0453684_0411381_310_759 148
178 3300044712 Ga0453684_0493634 Ga0453684_0493634_790_1236 148
179 3300044712 Ga0453684_0517691 Ga0453684_0517691_111_596 148
180 3300044712 Ga0453684_0544433 Ga0453684_0544433_376_828 148
181 3300044712 Ga0453684_0586542 Ga0453684_0586542_66_545 148
182 3300044712 Ga0453684_0601695 Ga0453684_0601695_151_597 148
183 3300044712 Ga0453684_0954109 Ga0453684_0954109_50_499 148
184 3300044712 Ga0453684_1058593 Ga0453684_1058593_316_762 148
185 3300044712 Ga0453684_1095003 Ga0453684_1095003_115_561 148
186 3300044712 Ga0453684_1144536 Ga0453684_1144536_28_474 148
187 3300044712 Ga0453684_1226169 Ga0453684_1226169_232_681 148
188 3300044712 Ga0453684_2162593 Ga0453684_2162593_91_537 148
189 3300045051 Ga0451576_0019324 Ga0451576_0019324_2484_2930 148
190 3300045051 Ga0451576_0040727 Ga0451576_0040727_3984_4433 148
191 3300045051 Ga0451576_0089751 Ga0451576_0089751_539_988 148
192 3300045051 Ga0451576_0186846 Ga0451576_0186846_235_684 148
193 3300045051 Ga0451576_0190812 Ga0451576_0190812_161_607 148
194 3300045051 Ga0451576_0298156 Ga0451576_0298156_985_1464 148
195 3300045051 Ga0451576_0438656 Ga0451576_0438656_146_592 148
196 3300045051 Ga0451576_0590756 Ga0451576_0590756_356_802 148
197 3300045051 Ga0451576_1327648 Ga0451576_1327648_86_565 148
198 3300045051 Ga0451576_2033593 Ga0451576_2033593_58_537 148
199 3300049574 Ga0501038_0858394 Ga0501038_0858394_94_540 148
200 3300049575 Ga0501039_0210320 Ga0501039_0210320_720_1166 148
201 3300049576 Ga0501040_1025498 Ga0501040_1025498_120_566 148
202 3300049577 Ga0501041_0311895 Ga0501041_0311895_307_753 148
203 3300049578 Ga0501042_0698842 Ga0501042_0698842_149_595 148
204 3300049582 Ga0501048_1004871 Ga0501048_1004871_15_461 148
205 3300049588 Ga0501072_0597541 Ga0501072_0597541_252_698 148
206 3300049591 Ga0501075_0894067 Ga0501075_0894067_107_568 148
207 3300049592 Ga0501076_0125163 Ga0501076_0125163_220_666 148
208 3300049592 Ga0501076_1357715 Ga0501076_1357715_106_552 148
209 3300049654 Ga0501207_044889 Ga0501207_044889_161_607 148
210 3300049743 Ga0501081_0201137 Ga0501081_0201137_351_797 148
211 3300049822 Ga0501035_0684296 Ga0501035_0684296_327_773 148
212 3300049824 Ga0501045_0408335 Ga0501045_0408335_172_618 148
213 3300050507 nmdc:mga05p37_1022602_c1 nmdc:mga05p37_1022602_c1_114_560 148
214 3300050507 nmdc:mga05p37_102685_c1 nmdc:mga05p37_102685_c1_2658_3104 148
215 3300050507 nmdc:mga05p37_107115_c1 nmdc:mga05p37_107115_c1_708_1154 148
216 3300050507 nmdc:mga05p37_359943_c1 nmdc:mga05p37_359943_c1_611_1072 148
217 3300050507 nmdc:mga05p37_476_c1 nmdc:mga05p37_476_c1_33775_34221 148
218 3300050507 nmdc:mga05p37_6813_c1 nmdc:mga05p37_6813_c1_7745_8197 148
219 3300050507 nmdc:mga05p37_87009_c1 nmdc:mga05p37_87009_c1_1779_2225 148
220 3300050507 nmdc:mga05p37_92461_c1 nmdc:mga05p37_92461_c1_838_1284 148
221 3300050508 nmdc:mga09592_147626_c1 nmdc:mga09592_147626_c1_1180_1626 148
222 3300050508 nmdc:mga09592_15149_c1 nmdc:mga09592_15149_c1_3380_3841 148
223 3300050508 nmdc:mga09592_284_c1 nmdc:mga09592_284_c1_35410_35856 148
224 3300050508 nmdc:mga09592_332075_c1 nmdc:mga09592_332075_c1_688_1134 148
225 3300050508 nmdc:mga09592_60224_c1 nmdc:mga09592_60224_c1_2343_2789 148
226 3300050508 nmdc:mga09592_69666_c1 nmdc:mga09592_69666_c1_1696_2142 148
227 3300050509 nmdc:mga0qj67_193371_c1 nmdc:mga0qj67_193371_c1_936_1382 148
228 3300050509 nmdc:mga0qj67_49616_c1 nmdc:mga0qj67_49616_c1_1968_2414 148
229 3300050510 nmdc:mga06r32_1018296_c1 nmdc:mga06r32_1018296_c1_245_691 148
230 3300050510 nmdc:mga06r32_270061_c1 nmdc:mga06r32_270061_c1_574_1020 148
231 3300050510 nmdc:mga06r32_584594_c1 nmdc:mga06r32_584594_c1_122_568 148
232 3300050512 nmdc:mga0n895_206764_c1 nmdc:mga0n895_206764_c1_564_1022 148
233 3300050512 nmdc:mga0n895_524235_c1 nmdc:mga0n895_524235_c1_501_947 148
234 3300050515 nmdc:mga0a205_890057_c1 nmdc:mga0a205_890057_c1_159_605 148
235 3300054114 Ga0501084_0104333 Ga0501084_0104333_1533_1979 148
236 3300054114 Ga0501084_0953528 Ga0501084_0953528_150_596 148
237 3300060353 Ga0501082_0263516 Ga0501082_0263516_1028_1474 148
238 3300060353 Ga0501082_1058399 Ga0501082_1058399_35_481 148
239 3300061734 Ga0530510_0069112 Ga0530510_0069112_1564_2010 148
240 3300061734 Ga0530510_0232408 Ga0530510_0232408_253_699 148

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02130

YbeY

Endoribonuclease YbeY

41

171

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1oz9-assembly1.cif.gz_A crystal structure of aq_1354, a hypothetical protein from aquifex aeolicus 0.9107 2 139
7y7o-assembly1.cif.gz_A crystal structure of metallo-endoribonuclease ybey from staphylococcus aureus 0.9016 1 141
1oz9-assembly1.cif.gz_A crystal structure of aq_1354, a hypothetical protein from aquifex aeolicus 0.8803 2 139
7y7o-assembly1.cif.gz_A crystal structure of metallo-endoribonuclease ybey from staphylococcus aureus 0.8375 1 141
1xm5-assembly1.cif.gz_A crystal structure of metal-dependent hydrolase ybey from e. coli, pfam upf0054 0.8138 2 146
ID Description Score Start End Superfamily
af_A0A0R0GDI7_137_270_3.40.390.30 "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" 0.9176 32 139 3.40.390.30
1oz9A00 "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" 0.9107 2 139 3.40.390.30
af_Q2FY02_5_155_3.40.390.30 "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" 0.904 4 140 3.40.390.30
af_P9WGX9_1_163_3.40.390.30 "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" 0.8916 1 143 3.40.390.30
1oz9A00 "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" 0.8803 2 139 3.40.390.30
ID Description Score Start End GO Terms
AF-A0A7C3FJW6-F1-model_v4 Endoribonuclease YbeY (EC 3.1.-.-) 0.9872 31 136 GO:0004222
GO:0004521
GO:0005737
GO:0006364
GO:0008270
AF-A0A7C3KMU1-F1-model_v4 Endoribonuclease YbeY (EC 3.1.-.-) 0.9787 1 148 GO:0004222
GO:0004521
GO:0005737
GO:0006364
GO:0008270
AF-A0A7C3KMU1-F1-model_v4 Endoribonuclease YbeY (EC 3.1.-.-) 0.9723 1 148 GO:0004222
GO:0004521
GO:0005737
GO:0006364
GO:0008270
AF-A0A2M8CSK9-F1-model_v4 Endoribonuclease YbeY (EC 3.1.-.-) 0.9693 1 147 GO:0004222
GO:0004521
GO:0005737
GO:0006364
GO:0008270
AF-A0A1F8QTB7-F1-model_v4 rRNA maturation RNase YbeY 0.966 54 148 GO:0004222
GO:0004519
GO:0006364
GO:0046872

Feature Viewer

pLDDT pTM Quality
93.43 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map