F352293

General Info

Members Datasets Scaffolds Average Seq Length
239 159 478 444

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0034870|Ga0501032_0034870_1734_3164
Length 467
Sequence LTALFYFLGVVLFVVAILASIGLHELGHMIPAKAFGAKVSQYFIGFGPTVWSRRKGETEYGVKGVPLGGYVKILGMLPPDPAQSQLEQTADARAGTTNAEPAERGVAVAAGSAGAATELKVRQSNTGMFTQLISDARAAEWETIQPEDAPRLFYRLAWWKKVIVMAGGPTVNLLIAFVVFLGVFSIYGSHEVVADAGRPVIDTVSRCVLPFDESDRACRSTDPVAPAYQAGLRPGDVITSFNGTEVRSWDQLRTLIQHNFAGHAVIGFTRHGKAMTGQTNTTVQARPDSQNPSNQKLTQVGFLGVAPKSHTQVTHGGPLYTLRQMGTMTRDSVVALVHLPVKVWGVAEAIVGAKPRAADSPVSIVGGGRIAGEEISDTSFPLADRIAGLLMLVAGFNLFIGLFNFIPLLPLDGGHIASALWEALRRALARLRRRPDPGYVDAAKLLPVAYVVAGLLLDLVVPLHPLA

Samples

Sample ID Description Type Environment
1 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
10 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
42 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
43 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
57 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
60 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
61 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
62 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
63 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
64 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
65 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
66 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
67 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
68 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
69 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
70 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
71 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
72 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
73 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
74 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
75 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
76 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
77 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
78 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
79 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
80 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
81 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
82 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
83 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
84 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
85 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
86 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
87 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
88 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
89 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
90 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
91 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
92 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
93 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
94 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
95 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
96 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
97 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
98 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
99 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
100 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
113 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
114 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
115 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
116 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
117 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
118 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
119 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
120 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
121 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
122 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
123 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
124 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
126 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
127 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
128 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
129 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
130 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
131 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
132 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
133 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
134 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
135 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
136 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
137 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
138 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
139 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
140 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
141 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
142 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
143 2643221576 Nocardioides sp. Root614 Isolate Unclassified
144 2643221590 Nocardioides sp. Root682 Isolate Unclassified
145 2643221604 Nocardioides sp. Root190 Isolate Unclassified
146 2643221615 Nocardioides sp. Root224 Isolate Unclassified
147 2643221617 Nocardioides sp. Root79 Isolate Unclassified
148 2643221620 Nocardioides sp. Root240 Isolate Unclassified
149 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
150 2738541305 Nocardioides sp. CF167 Isolate Unclassified
151 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
152 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
153 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
154 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
155 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
156 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
157 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
158 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
159 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 92.05
Metatranscriptomes 0.84
Isolates 7.11

Biome Distribution

Category Percentage (%)
Aerial Root 0.84
Bulb 0
Endosphere 17.99
Nodule 0
Rhizoplane 10.04
Rhizosphere 63.18
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501032_0034870 3300049569 Bacteria 3442
2 LJQas_1000280 3300000549 Bacteria 9213
3 JGI24740J21852_10025102 3300001979 Bacteria 2013
4 JGI24737J22298_10015334 3300001990 Bacteria 2480
5 Ga0006562J51391_1012396 3300003578 Bacteria 3320
6 Ga0070658_10067736 3300005327 Bacteria 2917
7 Ga0070683_100001281 3300005329 Bacteria 19122
8 Ga0070683_100047126 3300005329 Bacteria 3983
9 Ga0070659_100072913 3300005366 Bacteria 2733
10 Ga0070678_100071820 3300005456 Bacteria 2592
11 Ga0070685_10051672 3300005466 Bacteria 2377
12 Ga0070707_100176897 3300005468 Bacteria 2080
13 Ga0070698_100022168 3300005471 Bacteria 6649
14 Ga0070679_100037786 3300005530 Bacteria 4798
15 Ga0070672_100048393 3300005543 Bacteria 3304
16 Ga0070665_100002906 3300005548 Bacteria 18504
17 Ga0068855_100063100 3300005563 Bacteria 4324
18 Ga0068857_100009335 3300005577 Bacteria 8515
19 Ga0068856_100199237 3300005614 Bacteria 2017
20 Ga0068864_100066583 3300005618 Bacteria 3127
21 Ga0068864_100091177 3300005618 Bacteria 2688
22 Ga0068858_100016079 3300005842 Bacteria 7029
23 Ga0068860_100000451 3300005843 Bacteria 51981
24 Ga0068860_100096699 3300005843 Bacteria 2815
25 Ga0081539_10042482 3300005985 Bacteria 2647
26 Ga0075365_10004303 3300006038 Bacteria 7516
27 Ga0075365_10019903 3300006038 Bacteria 4152
28 Ga0075365_10032084 3300006038 Bacteria 3374
29 Ga0075365_10062169 3300006038 Bacteria 2496
30 Ga0075368_10000808 3300006042 Bacteria 9642
31 Ga0075363_100001152 3300006048 Bacteria 9687
32 Ga0075363_100003161 3300006048 Bacteria 6930
33 Ga0075363_100005106 3300006048 Bacteria 5807
34 Ga0075363_100012148 3300006048 Bacteria 4142
35 Ga0075364_10029080 3300006051 Bacteria 3542
36 Ga0075364_10046493 3300006051 Bacteria 2826
37 Ga0075364_10048443 3300006051 Bacteria 2769
38 Ga0075364_10142354 3300006051 Bacteria 1614
39 Ga0075362_10008546 3300006177 Bacteria 3921
40 Ga0075367_10001320 3300006178 Bacteria 10513
41 Ga0075367_10025968 3300006178 Bacteria 3317
42 Ga0075367_10026578 3300006178 Bacteria 3284
43 Ga0075370_10001552 3300006353 Bacteria 10058
44 Ga0068865_100092078 3300006881 Bacteria 2202
45 Ga0111539_10150481 3300009094 Bacteria 2724
46 Ga0105245_10002916 3300009098 Bacteria 15349
47 Ga0105243_10112414 3300009148 Bacteria 2282
48 Ga0105237_10141938 3300009545 Bacteria 2396
49 Ga0105239_10005653 3300010375 Bacteria 14609
50 Ga0105246_10036293 3300011119 Bacteria 3301
51 Ga0157369_10013423 3300013105 Bacteria 9261
52 Ga0157372_10015586 3300013307 Bacteria 8150
53 Ga0157375_10051180 3300013308 Bacteria 4055
54 Ga0163163_10019293 3300014325 Bacteria 6402
55 Ga0163163_10048860 3300014325 Bacteria 4162
56 Ga0157379_10006071 3300014968 Bacteria 10405
57 Ga0163161_10048197 3300017792 Bacteria 3076
58 Ga0206353_10000319 3300020082 Bacteria 2667
59 Ga0207688_10019263 3300025901 Bacteria 3715
60 Ga0207647_10015090 3300025904 Bacteria 5307
61 Ga0207647_10043251 3300025904 Bacteria 2819
62 Ga0207705_10066396 3300025909 Bacteria 2609
63 Ga0207657_10140212 3300025919 Bacteria 1976
64 Ga0207652_10029693 3300025921 Bacteria 4574
65 Ga0207687_10078467 3300025927 Bacteria 2378
66 Ga0207690_10051511 3300025932 Bacteria 2753
67 Ga0207661_10009573 3300025944 Bacteria 6955
68 Ga0207661_10221186 3300025944 Bacteria 1674
69 Ga0207678_10077418 3300026067 Bacteria 2849
70 Ga0207702_10183904 3300026078 Bacteria 1926
71 Ga0207674_10014570 3300026116 Bacteria 8677
72 Ga0207683_10097508 3300026121 Bacteria 2622
73 Ga0209813_10000796 3300027866 Bacteria 7158
74 Ga0209813_10005582 3300027866 Bacteria 3063
75 Ga0268266_10006568 3300028379 Bacteria 10629
76 Ga0268264_10003254 3300028381 Bacteria 14049
77 Ga0316575_10000010 3300031665 Bacteria 51771
78 Ga0307410_10064724 3300031852 Bacteria 2513
79 Ga0307412_10082832 3300031911 Bacteria 2222
80 Ga0307412_10094478 3300031911 Bacteria 2100
81 Ga0307409_100060545 3300031995 Bacteria 2953
82 Ga0307409_100106056 3300031995 Bacteria 2344
83 Ga0307416_100010065 3300032002 Bacteria 6227
84 Ga0307414_10092990 3300032004 Bacteria 2247
85 Ga0307415_100003935 3300032126 Bacteria 7631
86 Ga0307415_100074463 3300032126 Bacteria 2400
87 Ga0395900_0123280 3300037418 Bacteria 2658
88 Ga0395905_0019967 3300037471 Bacteria 6350
89 Ga0395901_0020378 3300038443 Bacteria 6788
90 Ga0395901_0021191 3300038443 Bacteria 6657
91 Ga0439438_026708 3300041405 Bacteria 1564
92 Ga0466965_0020913 3300044683 Bacteria 3149
93 Ga0466965_0066848 3300044683 Bacteria 1803
94 Ga0466961_0090836 3300044693 Bacteria 1928
95 Ga0466963_0048192 3300044694 Bacteria 2814
96 Ga0466964_0004578 3300044706 Bacteria 5114
97 Ga0466968_0039876 3300044735 Bacteria 1978
98 Ga0466970_0015908 3300044765 Bacteria 3873
99 Ga0466970_0018149 3300044765 Bacteria 3640
100 Ga0466970_0054319 3300044765 Bacteria 2139
101 Ga0466970_0085501 3300044765 Bacteria 1708
102 Ga0466957_0002955 3300044842 Bacteria 9218
103 Ga0466957_0054362 3300044842 Bacteria 2444
104 Ga0466960_0006340 3300044901 Bacteria 4742
105 Ga0466960_0046246 3300044901 Bacteria 2083
106 Ga0466960_0073661 3300044901 Bacteria 1705
107 Ga0466959_0185318 3300045049 Bacteria 1454
108 Ga0451576_0099410 3300045051 Bacteria 3027
109 Ga0466967_0016571 3300045976 Bacteria 5817
110 Ga0466967_0034398 3300045976 Bacteria 4301
111 Ga0466967_0036222 3300045976 Bacteria 4210
112 Ga0466967_0050418 3300045976 Bacteria 3644
113 Ga0466967_0082731 3300045976 Bacteria 2902
114 Ga0466967_0107699 3300045976 Bacteria 2556
115 Ga0495629_0040646 3300046459 Bacteria 3272
116 Ga0495658_0048936 3300046683 Bacteria 2386
117 Ga0496100_0193157 3300048903 Bacteria 1479
118 Ga0496101_0111968 3300048904 Bacteria 2055
119 Ga0496102_0081925 3300048905 Bacteria 2976
120 Ga0496102_0092663 3300048905 Bacteria 2798
121 Ga0496103_0103292 3300048906 Bacteria 1805
122 Ga0496104_0015816 3300048907 Bacteria 6844
123 Ga0496105_0034024 3300048908 Bacteria 4189
124 Ga0496105_0141548 3300048908 Bacteria 1980
125 Ga0496105_0268822 3300048908 Bacteria 1377
126 Ga0496106_0016941 3300048909 Bacteria 5393
127 Ga0496107_0140413 3300048910 Bacteria 1785
128 Ga0496108_0173396 3300048911 Bacteria 1867
129 Ga0496109_0016242 3300048912 Bacteria 6508
130 Ga0496109_0042345 3300048912 Bacteria 4124
131 Ga0496109_0077595 3300048912 Bacteria 3057
132 Ga0496110_0035151 3300048913 Bacteria 4345
133 Ga0496110_0233629 3300048913 Bacteria 1673
134 Ga0496111_0016734 3300048914 Bacteria 5058
135 Ga0496114_0005923 3300048917 Bacteria 9612
136 Ga0496114_0008064 3300048917 Bacteria 8338
137 Ga0496114_0045873 3300048917 Bacteria 3631
138 Ga0496115_0024069 3300048918 Bacteria 4731
139 Ga0496115_0034385 3300048918 Bacteria 4005
140 Ga0496115_0230452 3300048918 Bacteria 1527
141 Ga0496117_0000216 3300048920 Bacteria 111598
142 Ga0496122_0004682 3300048925 Bacteria 16796
143 Ga0496123_0037315 3300048926 Bacteria 3432
144 Ga0501031_0042226 3300049568 Bacteria 2977
145 Ga0501031_0072254 3300049568 Bacteria 2246
146 Ga0501032_0028873 3300049569 Bacteria 3809
147 Ga0501033_0013048 3300049570 Bacteria 6334
148 Ga0501034_0013194 3300049571 Bacteria 8511
149 Ga0501034_0040455 3300049571 Bacteria 4719
150 Ga0501034_0041933 3300049571 Bacteria 4631
151 Ga0501034_0212162 3300049571 Bacteria 1891
152 Ga0501036_0026729 3300049572 Bacteria 4875
153 Ga0501036_0128721 3300049572 Bacteria 2138
154 Ga0501037_0000932 3300049573 Bacteria 21730
155 Ga0501037_0010717 3300049573 Bacteria 6737
156 Ga0501038_0000978 3300049574 Bacteria 25638
157 Ga0501039_0015714 3300049575 Bacteria 5791
158 Ga0501040_0101589 3300049576 Bacteria 2006
159 Ga0501042_0024405 3300049578 Bacteria 4241
160 Ga0501043_0018326 3300049579 Bacteria 5489
161 Ga0501046_0006540 3300049580 Bacteria 10303
162 Ga0501046_0009179 3300049580 Bacteria 8567
163 Ga0501046_0025945 3300049580 Bacteria 4790
164 Ga0501048_0006482 3300049582 Bacteria 8897
165 Ga0501048_0105385 3300049582 Bacteria 1990
166 Ga0501067_0002276 3300049583 Bacteria 10596
167 Ga0501067_0003417 3300049583 Bacteria 8737
168 Ga0501067_0046139 3300049583 Bacteria 2419
169 Ga0501068_0021505 3300049584 Bacteria 3766
170 Ga0501070_0001372 3300049586 Bacteria 21777
171 Ga0501070_0010749 3300049586 Bacteria 7734
172 Ga0501070_0012896 3300049586 Bacteria 7043
173 Ga0501070_0039282 3300049586 Bacteria 3948
174 Ga0501070_0076465 3300049586 Bacteria 2772
175 Ga0501070_0115921 3300049586 Bacteria 2212
176 Ga0501071_0038869 3300049587 Bacteria 3402
177 Ga0501072_0014964 3300049588 Bacteria 5947
178 Ga0501072_0015416 3300049588 Bacteria 5859
179 Ga0501072_0025403 3300049588 Bacteria 4615
180 Ga0501073_0007184 3300049589 Bacteria 8294
181 Ga0501074_0012229 3300049590 Bacteria 6239
182 Ga0501074_0020202 3300049590 Bacteria 4841
183 Ga0501076_0104499 3300049592 Bacteria 2285
184 Ga0501077_0002848 3300049593 Bacteria 10373
185 Ga0501077_0083083 3300049593 Bacteria 2029
186 Ga0501079_0021522 3300049741 Bacteria 4932
187 Ga0501080_0006513 3300049742 Bacteria 10488
188 Ga0501080_0048440 3300049742 Bacteria 3955
189 Ga0501080_0058322 3300049742 Bacteria 3594
190 Ga0501080_0219689 3300049742 Bacteria 1739
191 Ga0501083_0014338 3300049744 Bacteria 5543
192 Ga0501035_0002093 3300049822 Bacteria 19862
193 Ga0501044_0007948 3300049823 Bacteria 11653
194 Ga0501044_0029015 3300049823 Bacteria 5835
195 nmdc:mga03683_18437_c1 3300050489 Bacteria 2654
196 nmdc:mga03683_26191_c1 3300050489 Bacteria 2298
197 nmdc:mga03n38_5538_c1 3300050490 Bacteria 4307
198 nmdc:mga03n38_5621_c1 3300050490 Bacteria 4286
199 nmdc:mga00v17_21046_c1 3300050491 Bacteria 3746
200 nmdc:mga00v17_36635_c1 3300050491 Bacteria 2925
201 nmdc:mga00v17_45199_c1 3300050491 Bacteria 2660
202 nmdc:mga0yw44_13640_c1 3300050492 Bacteria 4285
203 nmdc:mga0yw44_28387_c1 3300050492 Bacteria 3218
204 nmdc:mga0yw44_32477_c1 3300050492 Bacteria 3042
205 nmdc:mga0yw44_43086_c1 3300050492 Bacteria 2693
206 nmdc:mga06z11_18423_c1 3300050494 Bacteria 3189
207 nmdc:mga06z11_64348_c1 3300050494 Bacteria 1922
208 nmdc:mga04h51_2070_c1 3300050495 Bacteria 4709
209 nmdc:mga04h51_609_c1 3300050495 Bacteria 8540
210 nmdc:mga07m45_14934_c1 3300050496 Bacteria 4147
211 nmdc:mga07m45_17339_c1 3300050496 Bacteria 3866
212 nmdc:mga08y16_164828_c1 3300050511 Bacteria 2302
213 Ga0500644_0000090 3300053088 Bacteria 56710
214 Ga0500556_0000698 3300053104 Bacteria 20621
215 Ga0500593_000189 3300053117 Bacteria 25029
216 Ga0500573_0054789 3300053140 Bacteria 2290
217 Ga0500573_0120404 3300053140 Bacteria 1461
218 Ga0500616_0000076 3300053153 Bacteria 216836
219 Ga0501084_0010943 3300054114 Bacteria 7513
220 Ga0501082_0084061 3300060353 Bacteria 2745
221 Ga0466962_0007440 3300061719 Bacteria 5256
222 Ga0530510_0145411 3300061734 Bacteria 1749
223 2643889116 2643221576 Bacteria 5214352
224 2643958171 2643221590 Bacteria 5214697
225 2644034652 2643221604 Bacteria 5014917
226 2644089764 2643221615 Bacteria 5487866
227 2644099025 2643221617 Bacteria 5139111
228 2644114906 2643221620 Bacteria 5134593
229 2644319609 2643221657 Bacteria 5490246
230 2738867932 2738541305 Bacteria 4910150
231 2774393533 2773857762 Bacteria 5971770
232 2809195578 2808606439 Bacteria 5952208
233 2812332251 2811994874 Bacteria 5367947
234 2812350474 2811994878 Bacteria 5992952
235 2855387667 2855386786 Bacteria 4752232
236 2857483485 2857481737 Bacteria 4761446
237 2891971922 2891968417 Bacteria 5821697
238 2984577034 2984576629 Bacteria 4248407
239 2990258781 2990256926 Bacteria 4252839
240 Ga0501032_0034870
241 LJQas_1000280
242 JGI24740J21852_10025102
243 JGI24737J22298_10015334
244 Ga0006562J51391_1012396
245 Ga0070658_10067736
246 Ga0070683_100001281
247 Ga0070683_100047126
248 Ga0070659_100072913
249 Ga0070678_100071820
250 Ga0070685_10051672
251 Ga0070707_100176897
252 Ga0070698_100022168
253 Ga0070679_100037786
254 Ga0070672_100048393
255 Ga0070665_100002906
256 Ga0068855_100063100
257 Ga0068857_100009335
258 Ga0068856_100199237
259 Ga0068864_100066583
260 Ga0068864_100091177
261 Ga0068858_100016079
262 Ga0068860_100000451
263 Ga0068860_100096699
264 Ga0081539_10042482
265 Ga0075365_10004303
266 Ga0075365_10019903
267 Ga0075365_10032084
268 Ga0075365_10062169
269 Ga0075368_10000808
270 Ga0075363_100001152
271 Ga0075363_100003161
272 Ga0075363_100005106
273 Ga0075363_100012148
274 Ga0075364_10029080
275 Ga0075364_10046493
276 Ga0075364_10048443
277 Ga0075364_10142354
278 Ga0075362_10008546
279 Ga0075367_10001320
280 Ga0075367_10025968
281 Ga0075367_10026578
282 Ga0075370_10001552
283 Ga0068865_100092078
284 Ga0111539_10150481
285 Ga0105245_10002916
286 Ga0105243_10112414
287 Ga0105237_10141938
288 Ga0105239_10005653
289 Ga0105246_10036293
290 Ga0157369_10013423
291 Ga0157372_10015586
292 Ga0157375_10051180
293 Ga0163163_10019293
294 Ga0163163_10048860
295 Ga0157379_10006071
296 Ga0163161_10048197
297 Ga0206353_10000319
298 Ga0207688_10019263
299 Ga0207647_10015090
300 Ga0207647_10043251
301 Ga0207705_10066396
302 Ga0207657_10140212
303 Ga0207652_10029693
304 Ga0207687_10078467
305 Ga0207690_10051511
306 Ga0207661_10009573
307 Ga0207661_10221186
308 Ga0207678_10077418
309 Ga0207702_10183904
310 Ga0207674_10014570
311 Ga0207683_10097508
312 Ga0209813_10000796
313 Ga0209813_10005582
314 Ga0268266_10006568
315 Ga0268264_10003254
316 Ga0316575_10000010
317 Ga0307410_10064724
318 Ga0307412_10082832
319 Ga0307412_10094478
320 Ga0307409_100060545
321 Ga0307409_100106056
322 Ga0307416_100010065
323 Ga0307414_10092990
324 Ga0307415_100003935
325 Ga0307415_100074463
326 Ga0395900_0123280
327 Ga0395905_0019967
328 Ga0395901_0020378
329 Ga0395901_0021191
330 Ga0439438_026708
331 Ga0466965_0020913
332 Ga0466965_0066848
333 Ga0466961_0090836
334 Ga0466963_0048192
335 Ga0466964_0004578
336 Ga0466968_0039876
337 Ga0466970_0015908
338 Ga0466970_0018149
339 Ga0466970_0054319
340 Ga0466970_0085501
341 Ga0466957_0002955
342 Ga0466957_0054362
343 Ga0466960_0006340
344 Ga0466960_0046246
345 Ga0466960_0073661
346 Ga0466959_0185318
347 Ga0451576_0099410
348 Ga0466967_0016571
349 Ga0466967_0034398
350 Ga0466967_0036222
351 Ga0466967_0050418
352 Ga0466967_0082731
353 Ga0466967_0107699
354 Ga0495629_0040646
355 Ga0495658_0048936
356 Ga0496100_0193157
357 Ga0496101_0111968
358 Ga0496102_0081925
359 Ga0496102_0092663
360 Ga0496103_0103292
361 Ga0496104_0015816
362 Ga0496105_0034024
363 Ga0496105_0141548
364 Ga0496105_0268822
365 Ga0496106_0016941
366 Ga0496107_0140413
367 Ga0496108_0173396
368 Ga0496109_0016242
369 Ga0496109_0042345
370 Ga0496109_0077595
371 Ga0496110_0035151
372 Ga0496110_0233629
373 Ga0496111_0016734
374 Ga0496114_0005923
375 Ga0496114_0008064
376 Ga0496114_0045873
377 Ga0496115_0024069
378 Ga0496115_0034385
379 Ga0496115_0230452
380 Ga0496117_0000216
381 Ga0496122_0004682
382 Ga0496123_0037315
383 Ga0501031_0042226
384 Ga0501031_0072254
385 Ga0501032_0028873
386 Ga0501033_0013048
387 Ga0501034_0013194
388 Ga0501034_0040455
389 Ga0501034_0041933
390 Ga0501034_0212162
391 Ga0501036_0026729
392 Ga0501036_0128721
393 Ga0501037_0000932
394 Ga0501037_0010717
395 Ga0501038_0000978
396 Ga0501039_0015714
397 Ga0501040_0101589
398 Ga0501042_0024405
399 Ga0501043_0018326
400 Ga0501046_0006540
401 Ga0501046_0009179
402 Ga0501046_0025945
403 Ga0501048_0006482
404 Ga0501048_0105385
405 Ga0501067_0002276
406 Ga0501067_0003417
407 Ga0501067_0046139
408 Ga0501068_0021505
409 Ga0501070_0001372
410 Ga0501070_0010749
411 Ga0501070_0012896
412 Ga0501070_0039282
413 Ga0501070_0076465
414 Ga0501070_0115921
415 Ga0501071_0038869
416 Ga0501072_0014964
417 Ga0501072_0015416
418 Ga0501072_0025403
419 Ga0501073_0007184
420 Ga0501074_0012229
421 Ga0501074_0020202
422 Ga0501076_0104499
423 Ga0501077_0002848
424 Ga0501077_0083083
425 Ga0501079_0021522
426 Ga0501080_0006513
427 Ga0501080_0048440
428 Ga0501080_0058322
429 Ga0501080_0219689
430 Ga0501083_0014338
431 Ga0501035_0002093
432 Ga0501044_0007948
433 Ga0501044_0029015
434 nmdc:mga03683_18437_c1
435 nmdc:mga03683_26191_c1
436 nmdc:mga03n38_5538_c1
437 nmdc:mga03n38_5621_c1
438 nmdc:mga00v17_21046_c1
439 nmdc:mga00v17_36635_c1
440 nmdc:mga00v17_45199_c1
441 nmdc:mga0yw44_13640_c1
442 nmdc:mga0yw44_28387_c1
443 nmdc:mga0yw44_32477_c1
444 nmdc:mga0yw44_43086_c1
445 nmdc:mga06z11_18423_c1
446 nmdc:mga06z11_64348_c1
447 nmdc:mga04h51_2070_c1
448 nmdc:mga04h51_609_c1
449 nmdc:mga07m45_14934_c1
450 nmdc:mga07m45_17339_c1
451 nmdc:mga08y16_164828_c1
452 Ga0500644_0000090
453 Ga0500556_0000698
454 Ga0500593_000189
455 Ga0500573_0054789
456 Ga0500573_0120404
457 Ga0500616_0000076
458 Ga0501084_0010943
459 Ga0501082_0084061
460 Ga0466962_0007440
461 Ga0530510_0145411
462 2643889116
463 2643958171
464 2644034652
465 2644089764
466 2644099025
467 2644114906
468 2644319609
469 2738867932
470 2774393533
471 2809195578
472 2812332251
473 2812350474
474 2855387667
475 2857483485
476 2891971922
477 2984577034
478 2990258781

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02163

Peptidase_M50

Peptidase family M50

12

435

0.95

PF17820

PDZ_6

PDZ domain

219

270

0.88

PF13180

PDZ_2

PDZ domain

212

281

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zpl-assembly4.cif.gz_C crystal structure analysis of pdz domain a 0.8534 175 257
3id3-assembly1.cif.gz_B crystal structure of rsep pdz2 i304a domain 0.8388 174 283
3wkm-assembly1.cif.gz_A the periplasmic pdz tandem fragment of the rsep homologue from aquifex aeolicus in complex with the fab fragment 0.8386 173 283
7cqc-assembly1.cif.gz_A the nz-1 fab complexed with the pdz tandem fragment of a. aeolicus s2p homolog with the pa14 tag inserted between the residues 181 and 184 0.8373 175 283
7xft-assembly1.cif.gz_A-2 mucp pdz2 domain 0.8067 173 281
ID Description Score Start End Superfamily
af_Q2G1Z5_167_256_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.8809 176 283 2.30.42.10
af_Q2G1Z5_167_256_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.8624 176 283 2.30.42.10
2zplC00 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.8463 175 257 2.30.42.10
3pv4A03 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.8417 196 257 2.30.42.10
3id3B00 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.8388 174 283 2.30.42.10
ID Description Score Start End GO Terms
AF-A0A6B3H9H0-F1-model_v4 Site-2 protease family protein 0.946 7 139 GO:0004222
GO:0006508
GO:0016020
AF-A0A356TKY7-F1-model_v4 RIP metalloprotease RseP 0.9415 10 153 GO:0004222
GO:0006508
GO:0016020
AF-A0A496MTS6-F1-model_v4 Zinc metalloprotease Rip1 0.9413 6 158 GO:0004222
GO:0006508
GO:0016020
AF-A0A317HTD0-F1-model_v4 Peptidase M50 domain-containing protein 0.9188 11 155 GO:0004222
GO:0006508
GO:0016020
AF-A0A496MTS6-F1-model_v4 Zinc metalloprotease Rip1 0.902 6 158 GO:0004222
GO:0006508
GO:0016020

Map