F352262

General Info

Members Datasets Scaffolds Average Seq Length
239 175 478 135

Family's Representative Sequence

Representative Sequence 3300048906|Ga0496103_0216370|Ga0496103_0216370_576_1130
Length 154
Sequence LLPPPEASLTGSPGTQDDAGVETTTVTVRTGRQERVHDLTGEASRFVAGRGDGLLSVFVPHATAGVAILELGAGSDDDLLAALADLLPADGRWRHAHGTPGHGRSHVMPAIIPPSLTVPVFAGRLALGTWQSIALVDLNVDNPDRTVRFSFLTG

Samples

Sample ID Description Type Environment
1 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
8 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
13 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
43 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
66 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
67 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
69 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
70 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
71 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
72 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
73 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
74 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
75 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
76 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
77 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
78 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
79 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
80 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
81 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
82 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
83 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
84 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
87 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
88 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
89 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
90 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
91 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
92 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
93 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
94 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
95 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
96 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
97 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
98 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
99 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
100 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
101 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
102 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
103 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
104 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
105 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
106 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
107 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
108 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
109 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
110 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
111 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
112 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
113 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
127 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
128 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
129 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
130 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
131 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
132 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
133 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
134 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
135 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
136 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
137 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
138 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
139 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
141 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
142 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
143 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
144 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
145 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
146 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
147 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
148 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
149 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
150 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
151 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
152 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
153 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
154 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
155 2508501039 Frankia saprophytica CN3 Isolate Nodule
156 2527291627 Frankia casuarinae Thr Isolate Nodule
157 2527291629 Frankia sp. BMG5.23 Isolate Nodule
158 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
159 2576861822 Frankia sp. CeD Isolate Nodule
160 2643221641 Nocardioides sp. Root122 Isolate Unclassified
161 2671180195 Frankia sp. CcI49 Isolate Nodule
162 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
163 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
164 2684623036 Frankia sp. CgIM4 Isolate Nodule
165 2687453737 Frankia sp. BMG5.36 Isolate Nodule
166 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
167 2710264753 Frankia sp. KB5 Isolate Nodule
168 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
169 2773857922 Frankia sp. CcI49 Isolate Nodule
170 2773857924 Frankia sp. CgIS1 Isolate Nodule
171 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
172 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
173 637000116 Frankia casuarinae CcI3 Isolate Nodule
174 8002775197 Frankia nepalensis CN7 Isolate Nodule
175 8002784119 Frankia sp. AgB1.9 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.7
Metatranscriptomes 2.51
Isolates 8.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.48
Nodule 6.69
Rhizoplane 2.51
Rhizosphere 68.62
Stem 0
Stem Tuber 0
Unclassified 2.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496103_0216370 3300048906 Bacteria 1232
2 Ga0070658_10001133 3300005327 Bacteria 22721
3 Ga0070658_10003548 3300005327 Bacteria 12806
4 Ga0070658_10024883 3300005327 Bacteria 4802
5 Ga0070680_100001507 3300005336 Bacteria 16964
6 Ga0070691_10205177 3300005341 Bacteria 1037
7 Ga0070714_100049187 3300005435 Bacteria 3588
8 Ga0070714_100434684 3300005435 Bacteria 1245
9 Ga0070713_100230918 3300005436 Bacteria 1682
10 Ga0070678_100965853 3300005456 Bacteria 782
11 Ga0070662_100115086 3300005457 Bacteria 2054
12 Ga0070681_10001724 3300005458 Bacteria 19579
13 Ga0068867_100636621 3300005459 Unclassified 934
14 Ga0070679_100030055 3300005530 Bacteria 5362
15 Ga0070672_100090874 3300005543 Bacteria 2463
16 Ga0070704_101195008 3300005549 Bacteria 693
17 Ga0068855_100003828 3300005563 Bacteria 18395
18 Ga0068854_100626142 3300005578 Bacteria 921
19 Ga0068854_100764445 3300005578 Bacteria 839
20 Ga0068856_100502837 3300005614 Bacteria 1233
21 Ga0070702_100565789 3300005615 Unclassified 846
22 Ga0068859_100002939 3300005617 Bacteria 17287
23 Ga0068866_10742291 3300005718 Bacteria 677
24 Ga0068861_100740811 3300005719 Bacteria 917
25 Ga0068870_10931245 3300005840 Bacteria 616
26 Ga0068858_100000960 3300005842 Bacteria 29847
27 Ga0068862_100000996 3300005844 Bacteria 27105
28 Ga0081455_10028919 3300005937 Bacteria 5059
29 Ga0081455_10277159 3300005937 Unclassified 1213
30 Ga0081540_1020527 3300005983 Bacteria 3968
31 Ga0070717_10120729 3300006028 Bacteria 2245
32 Ga0075365_10091914 3300006038 Bacteria 2068
33 Ga0075365_10151398 3300006038 Bacteria 1614
34 Ga0075365_10486135 3300006038 Bacteria 872
35 Ga0075365_10556985 3300006038 Bacteria 811
36 Ga0075368_10004865 3300006042 Bacteria 4579
37 Ga0075368_10076890 3300006042 Bacteria 1355
38 Ga0075363_100027248 3300006048 Bacteria 2928
39 Ga0075363_100078884 3300006048 Bacteria 1798
40 Ga0075363_100266692 3300006048 Bacteria 988
41 Ga0075364_10123595 3300006051 Bacteria 1733
42 Ga0075364_10123866 3300006051 Bacteria 1731
43 Ga0075367_10192797 3300006178 Bacteria 1272
44 Ga0075367_10213244 3300006178 Bacteria 1207
45 Ga0075367_10320869 3300006178 Bacteria 976
46 Ga0075367_10601602 3300006178 Bacteria 699
47 Ga0075370_10176748 3300006353 Bacteria 1256
48 Ga0075370_10377074 3300006353 Bacteria 849
49 Ga0097620_100002939 3300006931 Bacteria 17287
50 Ga0111539_10243273 3300009094 Bacteria 2095
51 Ga0105247_10008275 3300009101 Bacteria 6346
52 Ga0105248_10000111 3300009177 Bacteria 91627
53 Ga0105249_10003088 3300009553 Bacteria 14369
54 Ga0105030_102420 3300009987 Bacteria 1625
55 Ga0105239_10992990 3300010375 Bacteria 965
56 Ga0105239_11030248 3300010375 Bacteria 947
57 Ga0157319_1007285 3300012497 Bacteria 817
58 Ga0157370_10114566 3300013104 Bacteria 2518
59 Ga0157379_10002948 3300014968 Bacteria 14354
60 Ga0197907_11329915 3300020069 Bacteria 3999
61 Ga0206354_11113694 3300020081 Bacteria 1682
62 Ga0206354_11334801 3300020081 Bacteria 1293
63 Ga0206353_10963383 3300020082 Bacteria 3455
64 Ga0206353_11684844 3300020082 Bacteria 17655
65 Ga0224712_10001467 3300022467 Bacteria 5440
66 Ga0207710_10000012 3300025900 Bacteria 409603
67 Ga0207699_10067361 3300025906 Bacteria 2176
68 Ga0207705_10003426 3300025909 Bacteria 12066
69 Ga0207705_10003881 3300025909 Bacteria 11373
70 Ga0207705_10078705 3300025909 Bacteria 2400
71 Ga0207707_10115078 3300025912 Bacteria 2350
72 Ga0207660_10071882 3300025917 Bacteria 2518
73 Ga0207652_10000592 3300025921 Bacteria 36290
74 Ga0207700_10055676 3300025928 Bacteria 2973
75 Ga0207700_10810323 3300025928 Bacteria 838
76 Ga0207664_10017714 3300025929 Bacteria 5229
77 Ga0207691_10102334 3300025940 Bacteria 2555
78 Ga0207711_10000449 3300025941 Bacteria 43005
79 Ga0207667_10032079 3300025949 Bacteria 5663
80 Ga0207667_10484214 3300025949 Bacteria 1256
81 Ga0207651_10978294 3300025960 Bacteria 756
82 Ga0207712_10003017 3300025961 Bacteria 10751
83 Ga0207712_10573188 3300025961 Bacteria 973
84 Ga0207640_10209328 3300025981 Bacteria 1484
85 Ga0207658_10575721 3300025986 Bacteria 1010
86 Ga0207703_10000856 3300026035 Bacteria 29865
87 Ga0207648_10352132 3300026089 Unclassified 1328
88 Ga0207675_101414175 3300026118 Bacteria 716
89 Ga0209813_10013421 3300027866 Bacteria 2187
90 Ga0209813_10063486 3300027866 Bacteria 1185
91 Ga0207428_10103461 3300027907 Bacteria 2198
92 Ga0268265_10000088 3300028380 Bacteria 117017
93 Ga0316181_1245484 3300030744 Bacteria 730
94 Ga0307408_100787246 3300031548 Bacteria 862
95 Ga0316579_10123988 3300031691 Bacteria 1242
96 Ga0316579_10144533 3300031691 Bacteria 1147
97 Ga0316576_10001928 3300031727 Bacteria 11575
98 Ga0316578_10179156 3300031728 Bacteria 1277
99 Ga0316577_10002744 3300031733 Bacteria 8766
100 Ga0307413_10719669 3300031824 Bacteria 831
101 Ga0307413_11054716 3300031824 Bacteria 700
102 Ga0307409_100081582 3300031995 Bacteria 2615
103 Ga0307409_100451616 3300031995 Bacteria 1241
104 Ga0307415_100507092 3300032126 Bacteria 1056
105 Ga0307415_102178554 3300032126 Bacteria 542
106 Ga0307507_10000005 3300033179 Bacteria 281494
107 Ga0373939_0175714 3300035114 Bacteria 796
108 Ga0316582_1230235 3300036647 Bacteria 509
109 Ga0316584_0011883 3300036712 Bacteria 6134
110 Ga0395900_0052031 3300037418 Bacteria 4217
111 Ga0395900_0681981 3300037418 Unclassified 962
112 Ga0395898_0140870 3300037466 Bacteria 2309
113 Ga0395898_0231636 3300037466 Bacteria 1762
114 Ga0395898_1367882 3300037466 Bacteria 636
115 Ga0395905_0143894 3300037471 Bacteria 2243
116 Ga0316581_0112932 3300037588 Bacteria 837
117 Ga0395901_0104935 3300038443 Bacteria 2966
118 Ga0395901_0104940 3300038443 Bacteria 2966
119 Ga0436360_0084174 3300039438 Bacteria 682
120 Ga0451791_0076953 3300041451 Bacteria 1431
121 Ga0451791_1778590 3300041451 Bacteria 585
122 Ga0451793_1420526 3300041452 Bacteria 740
123 Ga0451835_0557555 3300041492 Bacteria 556
124 Ga0451837_0029341 3300041494 Bacteria 833
125 Ga0451837_0690835 3300041494 Bacteria 667
126 Ga0451843_0051934 3300041509 Bacteria 797
127 Ga0439434_0029406 3300042435 Bacteria 1666
128 Ga0466969_0032164 3300044656 Bacteria 2667
129 Ga0466961_0059774 3300044693 Bacteria 2423
130 Ga0466961_0097277 3300044693 Bacteria 1856
131 Ga0466963_0058865 3300044694 Bacteria 2563
132 Ga0466963_0294468 3300044694 Bacteria 1141
133 Ga0466971_0091993 3300044719 Bacteria 1389
134 Ga0466971_0110397 3300044719 Bacteria 1269
135 Ga0466970_0040299 3300044765 Bacteria 2481
136 Ga0466970_0450160 3300044765 Bacteria 738
137 Ga0466957_0124618 3300044842 Bacteria 1645
138 Ga0466960_0681563 3300044901 Bacteria 615
139 Ga0466959_0106229 3300045049 Bacteria 2007
140 Ga0466958_0064111 3300045836 Bacteria 2240
141 Ga0466958_0336158 3300045836 Bacteria 971
142 Ga0495590_0278757 3300046457 Bacteria 626
143 Ga0495608_0226334 3300046511 Bacteria 1172
144 Ga0495671_0530184 3300046692 Bacteria 561
145 Ga0495676_1030118 3300047321 Bacteria 525
146 Ga0495680_0162954 3300047322 Bacteria 1618
147 Ga0496106_0324282 3300048909 Bacteria 1236
148 Ga0496116_0001239 3300048919 Bacteria 29627
149 Ga0496117_0015227 3300048920 Bacteria 6575
150 Ga0496117_0024666 3300048920 Bacteria 4747
151 Ga0496118_0001008 3300048921 Bacteria 43814
152 Ga0496118_0028456 3300048921 Bacteria 4705
153 Ga0496119_0006955 3300048922 Bacteria 10322
154 Ga0496119_0024372 3300048922 Bacteria 4258
155 Ga0496121_0017184 3300048924 Bacteria 7409
156 Ga0496121_0030869 3300048924 Bacteria 4913
157 Ga0501031_0201022 3300049568 Bacteria 1300
158 Ga0501033_0001586 3300049570 Bacteria 19996
159 Ga0501033_0002764 3300049570 Bacteria 14712
160 Ga0501034_0546761 3300049571 Bacteria 1068
161 Ga0501036_0070568 3300049572 Bacteria 2954
162 Ga0501036_0103080 3300049572 Bacteria 2414
163 Ga0501037_0052119 3300049573 Bacteria 2993
164 Ga0501038_0617589 3300049574 Bacteria 819
165 Ga0501039_0004661 3300049575 Bacteria 10368
166 Ga0501039_0120784 3300049575 Bacteria 2053
167 Ga0501039_0712592 3300049575 Bacteria 784
168 Ga0501040_0001415 3300049576 Bacteria 15181
169 Ga0501041_0011964 3300049577 Bacteria 5137
170 Ga0501042_0001742 3300049578 Bacteria 13015
171 Ga0501043_0031963 3300049579 Bacteria 4137
172 Ga0501047_0125598 3300049581 Bacteria 2446
173 Ga0501048_0029724 3300049582 Bacteria 3960
174 Ga0501068_0307943 3300049584 Bacteria 1014
175 Ga0501070_0620031 3300049586 Bacteria 861
176 Ga0501071_0067761 3300049587 Bacteria 2596
177 Ga0501071_0716939 3300049587 Bacteria 770
178 Ga0501072_0001390 3300049588 Bacteria 18212
179 Ga0501072_0824383 3300049588 Bacteria 726
180 Ga0501074_0160870 3300049590 Bacteria 1604
181 Ga0501075_0002824 3300049591 Bacteria 11648
182 Ga0501076_0046713 3300049592 Bacteria 3421
183 Ga0501076_0169026 3300049592 Bacteria 1782
184 Ga0501076_0686494 3300049592 Bacteria 845
185 Ga0501077_0001132 3300049593 Bacteria 16096
186 Ga0501198_033060 3300049649 Bacteria 871
187 Ga0501079_0047777 3300049741 Bacteria 3302
188 Ga0501080_0049176 3300049742 Bacteria 3925
189 Ga0501081_1494946 3300049743 Bacteria 513
190 Ga0501083_0667939 3300049744 Bacteria 676
191 Ga0501044_0011057 3300049823 Bacteria 9789
192 Ga0501044_1144412 3300049823 Bacteria 647
193 Ga0501045_0003628 3300049824 Bacteria 10610
194 nmdc:mga03683_294403_c1 3300050489 Bacteria 760
195 nmdc:mga03n38_120034_c1 3300050490 Bacteria 1291
196 nmdc:mga03n38_238885_c1 3300050490 Bacteria 955
197 nmdc:mga03n38_73572_c1 3300050490 Bacteria 1587
198 nmdc:mga03n38_86366_c1 3300050490 Bacteria 1484
199 nmdc:mga00v17_255604_c1 3300050491 Bacteria 1136
200 nmdc:mga00v17_5673_c1 3300050491 Bacteria 6589
201 nmdc:mga0yw44_807017_c1 3300050492 Bacteria 637
202 nmdc:mga06z11_204354_c1 3300050494 Bacteria 1148
203 nmdc:mga06z11_29171_c1 3300050494 Bacteria 2655
204 nmdc:mga06z11_69477_c1 3300050494 Bacteria 1860
205 nmdc:mga04h51_14236_c1 3300050495 Bacteria 2269
206 nmdc:mga04h51_289188_c1 3300050495 Bacteria 665
207 nmdc:mga07m45_196283_c1 3300050496 Bacteria 1174
208 nmdc:mga07m45_95893_c1 3300050496 Bacteria 1702
209 nmdc:mga08y16_98465_c1 3300050511 Bacteria 3045
210 Ga0500644_0000014 3300053088 Bacteria 109650
211 Ga0500644_0010491 3300053088 Bacteria 2510
212 Ga0500583_0114903 3300053092 Bacteria 1328
213 Ga0501084_0003668 3300054114 Bacteria 12459
214 Ga0501082_0019328 3300060353 Bacteria 5871
215 Ga0501082_0870654 3300060353 Bacteria 788
216 Ga0466962_0049155 3300061719 Bacteria 2016
217 Ga0466962_0086818 3300061719 Bacteria 1498
218 Ga0530510_0003040 3300061734 Bacteria 11521
219 2508678036 2508501039 Bacteria 9978592
220 2528204517 2527291627 Bacteria 5309833
221 2528212255 2527291629 Bacteria 5267418
222 2546949913 2546825537 Bacteria 5389291
223 2579749044 2576861822 Bacteria 5004595
224 2644230315 2643221641 Bacteria 4490190
225 2671833864 2671180195 Bacteria 9757215
226 2676202169 2675902999 Bacteria 9438463
227 2686536078 2684623035 Bacteria 8032739
228 2686541095 2684623036 Bacteria 5199090
229 2689958703 2687453737 Bacteria 11203906
230 2689990318 2687453743 Bacteria 8361025
231 2710602818 2710264753 Bacteria 5455564
232 2774846745 2773857921 Bacteria 9435764
233 2774852020 2773857922 Bacteria 9757215
234 2774865840 2773857924 Bacteria 5256821
235 2837268790 2837268691 Bacteria 7850704
236 2868092986 2868088558 Bacteria 7609351
237 637880377 637000116 Bacteria 5433628
238 8002778213 8002775197 Bacteria 10728764
239 8002784261 8002784119 Bacteria 9788632
240 Ga0496103_0216370
241 Ga0070658_10001133
242 Ga0070658_10003548
243 Ga0070658_10024883
244 Ga0070680_100001507
245 Ga0070691_10205177
246 Ga0070714_100049187
247 Ga0070714_100434684
248 Ga0070713_100230918
249 Ga0070678_100965853
250 Ga0070662_100115086
251 Ga0070681_10001724
252 Ga0068867_100636621
253 Ga0070679_100030055
254 Ga0070672_100090874
255 Ga0070704_101195008
256 Ga0068855_100003828
257 Ga0068854_100626142
258 Ga0068854_100764445
259 Ga0068856_100502837
260 Ga0070702_100565789
261 Ga0068859_100002939
262 Ga0068866_10742291
263 Ga0068861_100740811
264 Ga0068870_10931245
265 Ga0068858_100000960
266 Ga0068862_100000996
267 Ga0081455_10028919
268 Ga0081455_10277159
269 Ga0081540_1020527
270 Ga0070717_10120729
271 Ga0075365_10091914
272 Ga0075365_10151398
273 Ga0075365_10486135
274 Ga0075365_10556985
275 Ga0075368_10004865
276 Ga0075368_10076890
277 Ga0075363_100027248
278 Ga0075363_100078884
279 Ga0075363_100266692
280 Ga0075364_10123595
281 Ga0075364_10123866
282 Ga0075367_10192797
283 Ga0075367_10213244
284 Ga0075367_10320869
285 Ga0075367_10601602
286 Ga0075370_10176748
287 Ga0075370_10377074
288 Ga0097620_100002939
289 Ga0111539_10243273
290 Ga0105247_10008275
291 Ga0105248_10000111
292 Ga0105249_10003088
293 Ga0105030_102420
294 Ga0105239_10992990
295 Ga0105239_11030248
296 Ga0157319_1007285
297 Ga0157370_10114566
298 Ga0157379_10002948
299 Ga0197907_11329915
300 Ga0206354_11113694
301 Ga0206354_11334801
302 Ga0206353_10963383
303 Ga0206353_11684844
304 Ga0224712_10001467
305 Ga0207710_10000012
306 Ga0207699_10067361
307 Ga0207705_10003426
308 Ga0207705_10003881
309 Ga0207705_10078705
310 Ga0207707_10115078
311 Ga0207660_10071882
312 Ga0207652_10000592
313 Ga0207700_10055676
314 Ga0207700_10810323
315 Ga0207664_10017714
316 Ga0207691_10102334
317 Ga0207711_10000449
318 Ga0207667_10032079
319 Ga0207667_10484214
320 Ga0207651_10978294
321 Ga0207712_10003017
322 Ga0207712_10573188
323 Ga0207640_10209328
324 Ga0207658_10575721
325 Ga0207703_10000856
326 Ga0207648_10352132
327 Ga0207675_101414175
328 Ga0209813_10013421
329 Ga0209813_10063486
330 Ga0207428_10103461
331 Ga0268265_10000088
332 Ga0316181_1245484
333 Ga0307408_100787246
334 Ga0316579_10123988
335 Ga0316579_10144533
336 Ga0316576_10001928
337 Ga0316578_10179156
338 Ga0316577_10002744
339 Ga0307413_10719669
340 Ga0307413_11054716
341 Ga0307409_100081582
342 Ga0307409_100451616
343 Ga0307415_100507092
344 Ga0307415_102178554
345 Ga0307507_10000005
346 Ga0373939_0175714
347 Ga0316582_1230235
348 Ga0316584_0011883
349 Ga0395900_0052031
350 Ga0395900_0681981
351 Ga0395898_0140870
352 Ga0395898_0231636
353 Ga0395898_1367882
354 Ga0395905_0143894
355 Ga0316581_0112932
356 Ga0395901_0104935
357 Ga0395901_0104940
358 Ga0436360_0084174
359 Ga0451791_0076953
360 Ga0451791_1778590
361 Ga0451793_1420526
362 Ga0451835_0557555
363 Ga0451837_0029341
364 Ga0451837_0690835
365 Ga0451843_0051934
366 Ga0439434_0029406
367 Ga0466969_0032164
368 Ga0466961_0059774
369 Ga0466961_0097277
370 Ga0466963_0058865
371 Ga0466963_0294468
372 Ga0466971_0091993
373 Ga0466971_0110397
374 Ga0466970_0040299
375 Ga0466970_0450160
376 Ga0466957_0124618
377 Ga0466960_0681563
378 Ga0466959_0106229
379 Ga0466958_0064111
380 Ga0466958_0336158
381 Ga0495590_0278757
382 Ga0495608_0226334
383 Ga0495671_0530184
384 Ga0495676_1030118
385 Ga0495680_0162954
386 Ga0496106_0324282
387 Ga0496116_0001239
388 Ga0496117_0015227
389 Ga0496117_0024666
390 Ga0496118_0001008
391 Ga0496118_0028456
392 Ga0496119_0006955
393 Ga0496119_0024372
394 Ga0496121_0017184
395 Ga0496121_0030869
396 Ga0501031_0201022
397 Ga0501033_0001586
398 Ga0501033_0002764
399 Ga0501034_0546761
400 Ga0501036_0070568
401 Ga0501036_0103080
402 Ga0501037_0052119
403 Ga0501038_0617589
404 Ga0501039_0004661
405 Ga0501039_0120784
406 Ga0501039_0712592
407 Ga0501040_0001415
408 Ga0501041_0011964
409 Ga0501042_0001742
410 Ga0501043_0031963
411 Ga0501047_0125598
412 Ga0501048_0029724
413 Ga0501068_0307943
414 Ga0501070_0620031
415 Ga0501071_0067761
416 Ga0501071_0716939
417 Ga0501072_0001390
418 Ga0501072_0824383
419 Ga0501074_0160870
420 Ga0501075_0002824
421 Ga0501076_0046713
422 Ga0501076_0169026
423 Ga0501076_0686494
424 Ga0501077_0001132
425 Ga0501198_033060
426 Ga0501079_0047777
427 Ga0501080_0049176
428 Ga0501081_1494946
429 Ga0501083_0667939
430 Ga0501044_0011057
431 Ga0501044_1144412
432 Ga0501045_0003628
433 nmdc:mga03683_294403_c1
434 nmdc:mga03n38_120034_c1
435 nmdc:mga03n38_238885_c1
436 nmdc:mga03n38_73572_c1
437 nmdc:mga03n38_86366_c1
438 nmdc:mga00v17_255604_c1
439 nmdc:mga00v17_5673_c1
440 nmdc:mga0yw44_807017_c1
441 nmdc:mga06z11_204354_c1
442 nmdc:mga06z11_29171_c1
443 nmdc:mga06z11_69477_c1
444 nmdc:mga04h51_14236_c1
445 nmdc:mga04h51_289188_c1
446 nmdc:mga07m45_196283_c1
447 nmdc:mga07m45_95893_c1
448 nmdc:mga08y16_98465_c1
449 Ga0500644_0000014
450 Ga0500644_0010491
451 Ga0500583_0114903
452 Ga0501084_0003668
453 Ga0501082_0019328
454 Ga0501082_0870654
455 Ga0466962_0049155
456 Ga0466962_0086818
457 Ga0530510_0003040
458 2508678036
459 2528204517
460 2528212255
461 2546949913
462 2579749044
463 2644230315
464 2671833864
465 2676202169
466 2686536078
467 2686541095
468 2689958703
469 2689990318
470 2710602818
471 2774846745
472 2774852020
473 2774865840
474 2837268790
475 2868092986
476 637880377
477 8002778213
478 8002784261

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01894

UPF0047

Uncharacterised protein family UPF0047

38

151

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vph-assembly2.cif.gz_E crystal structure of a ybjq-like protein of unknown function (sso2532) from sulfolobus solfataricus p2 at 1.76 a resolution 0.9036 11 143
1ve0-assembly1.cif.gz_A crystal structure of uncharacterized protein st2072 from sulfolobus tokodaii 0.8967 11 143
2p6c-assembly1.cif.gz_A crystal structure of hypothetical protein aq_2013 from aquifex aeolicus vf5. 0.8921 11 143
2cu5-assembly1.cif.gz_C crystal structure of the conserved hypothetical protein tt1486 from thermus thermophilus hb8 0.8849 14 141
2p6h-assembly1.cif.gz_A crystal structure of hypothetical protein ape1520 from aeropyrum pernix k1 0.8817 12 143
ID Description Score Start End Superfamily
af_P9WFP9_1_132_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9691 12 141 2.60.120.460
af_P9WFP9_1_132_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9477 12 141 2.60.120.460
1ve0A00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.8953 11 140 2.60.120.460
2p6cB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.8925 11 143 2.60.120.460
2p6hB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.8915 12 143 2.60.120.460
ID Description Score Start End GO Terms
AF-A0A7V9J5C8-F1-model_v4 YjbQ family protein 0.977 13 143
AF-A0A5S4ZI95-F1-model_v4 deleted 0.9736 27 143
AF-A0A4R4LTD4-F1-model_v4 deleted 0.9735 26 143
AF-A0A5C7YLB2-F1-model_v4 deleted 0.9698 16 143
AF-A0A7G9RBH8-F1-model_v4 YjbQ family protein 0.9681 12 143

Map