F352256

General Info

Members Datasets Scaffolds Average Seq Length
239 144 239 389

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0018210|Ga0495686_0018210_500_1723
Length 397
Sequence MNDFQPTLRCVSKLNAHAETVEHRFGDYGGQYVPETLMPALQELEEAWVSARDDADFHSELHTLLCDYAGRPTSLYLAERLSDHIGYPVYLKREDLLHTGAHKINNALGQALIAKRIGKRRIIAETGAGQHGVATATACARLDLECEIFMGEEDMRRQAPNVARMGLLGAKVIPVTAGSKTLKEAVSAAIRNWVETVADTHYILGSAVGPAPFPAMVRDLQRVIGDEARGQICQMSGRLPARVIACVGAGSNAIGTFKAFEDDSSELIGVEAGGHGLSSXXXXATLTRSSVLQDEDGQILEAHSISAGLDYPGVGPEHSYLRDIGRVKYYSATDAEALEALQLVCKLEGIIPALESSHAIAWMLDNPGGDMDLVTLSGRGDKDLDEILRLTGRNDTV

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
23 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
38 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
40 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
41 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
42 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
43 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
66 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
68 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
69 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
70 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
71 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
72 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
73 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
74 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
75 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
76 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
77 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
78 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
79 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
80 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
81 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
82 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
83 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
84 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
85 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
86 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
87 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
88 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
89 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
90 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
91 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
92 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
93 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
94 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
95 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
96 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
97 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
98 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
99 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
100 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
101 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
102 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
103 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
104 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
105 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
106 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
107 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
108 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
109 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
110 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
111 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
112 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
113 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
114 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
115 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
116 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
117 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
118 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
119 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
127 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
128 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
129 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
130 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
131 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
133 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
134 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
135 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
136 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
137 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
138 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
139 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
140 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
141 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
142 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
143 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
144 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.77
Nodule 0
Rhizoplane 11.3
Rhizosphere 74.48
Stem 0
Stem Tuber 0
Unclassified 10.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10002762 3300003203 Bacteria 8250
2 Ga0070683_100025028 3300005329 Bacteria 5354
3 Ga0070683_100052857 3300005329 Bacteria 3764
4 Ga0070683_100089920 3300005329 Bacteria 2882
5 Ga0070683_100224410 3300005329 Bacteria 1786
6 Ga0070683_100306571 3300005329 Bacteria 1511
7 Ga0070680_100001012 3300005336 Bacteria 20047
8 Ga0070682_100009080 3300005337 Bacteria 5621
9 Ga0070682_100175419 3300005337 Bacteria 1493
10 Ga0070692_10059521 3300005345 Bacteria 2008
11 Ga0070659_100025119 3300005366 Bacteria 4573
12 Ga0070714_100010420 3300005435 Bacteria 7347
13 Ga0070713_100144699 3300005436 Bacteria 2109
14 Ga0070713_100275679 3300005436 Bacteria 1541
15 Ga0070710_10008052 3300005437 Bacteria 5122
16 Ga0070701_10030746 3300005438 Bacteria 2659
17 Ga0070711_100071698 3300005439 Bacteria 2442
18 Ga0070681_10005635 3300005458 Bacteria 12099
19 Ga0070679_100000204 3300005530 Bacteria 48597
20 Ga0070684_100022008 3300005535 Bacteria 5312
21 Ga0070684_100237216 3300005535 Bacteria 1666
22 Ga0070684_100307429 3300005535 Bacteria 1455
23 Ga0068854_100006276 3300005578 Bacteria 7556
24 Ga0068854_100044694 3300005578 Bacteria 3146
25 Ga0068856_100018427 3300005614 Bacteria 6767
26 Ga0068856_100053570 3300005614 Bacteria 3978
27 Ga0070702_100002774 3300005615 Bacteria 7679
28 Ga0068852_100009176 3300005616 Bacteria 7328
29 Ga0068851_10000126 3300005834 Bacteria 41437
30 Ga0068851_10125853 3300005834 Bacteria 1382
31 Ga0068863_100026859 3300005841 Bacteria 5491
32 Ga0081455_10005423 3300005937 Bacteria 13991
33 Ga0081538_10001795 3300005981 Bacteria 21667
34 Ga0081538_10007931 3300005981 Bacteria 9088
35 Ga0081538_10022624 3300005981 Bacteria 4549
36 Ga0081540_1047655 3300005983 Bacteria 2153
37 Ga0081539_10004464 3300005985 Bacteria 15425
38 Ga0070717_10015040 3300006028 Bacteria 5964
39 Ga0070717_10031766 3300006028 Bacteria 4251
40 Ga0075365_10000342 3300006038 Bacteria 16642
41 Ga0075365_10002261 3300006038 Bacteria 9336
42 Ga0075365_10013269 3300006038 Bacteria 4918
43 Ga0075365_10195035 3300006038 Bacteria 1418
44 Ga0075428_100076709 3300006844 Bacteria 3649
45 Ga0075431_100002725 3300006847 Bacteria 17141
46 Ga0111539_10017607 3300009094 Bacteria 8843
47 Ga0105245_10000201 3300009098 Bacteria 57152
48 Ga0105245_10007008 3300009098 Bacteria 9888
49 Ga0105245_10007551 3300009098 Bacteria 9527
50 Ga0105245_10019375 3300009098 Bacteria 5959
51 Ga0114129_10105969 3300009147 Bacteria 3884
52 Ga0114129_10176676 3300009147 Bacteria 2908
53 Ga0114129_10254745 3300009147 Bacteria 2355
54 Ga0105243_10100003 3300009148 Bacteria 2405
55 Ga0105242_10095993 3300009176 Bacteria 2503
56 Ga0105238_10019985 3300009551 Bacteria 6817
57 Ga0105249_10000050 3300009553 Bacteria 169617
58 Ga0157370_10036948 3300013104 Bacteria 4737
59 Ga0157377_10046153 3300014745 Bacteria 2435
60 Ga0206353_11601920 3300020082 Bacteria 8750
61 Ga0213874_10000224 3300021377 Bacteria 10546
62 Ga0213876_10010890 3300021384 Bacteria 4872
63 Ga0213876_10018563 3300021384 Bacteria 3673
64 Ga0213876_10048941 3300021384 Bacteria 2232
65 Ga0213875_10018301 3300021388 Bacteria 3378
66 Ga0213875_10051260 3300021388 Bacteria 1933
67 Ga0207426_1024187 3300025302 Bacteria 2064
68 Ga0207656_10003059 3300025321 Bacteria 5716
69 Ga0207682_10000018 3300025893 Bacteria 66215
70 Ga0207707_10010279 3300025912 Bacteria 8122
71 Ga0207693_10000942 3300025915 Bacteria 26110
72 Ga0207663_10162710 3300025916 Bacteria 1577
73 Ga0207657_10236960 3300025919 Bacteria 1458
74 Ga0207652_10015879 3300025921 Bacteria 6135
75 Ga0207687_10000020 3300025927 Bacteria 228407
76 Ga0207687_10000851 3300025927 Bacteria 20636
77 Ga0207700_10128942 3300025928 Bacteria 2062
78 Ga0207664_10015670 3300025929 Bacteria 5510
79 Ga0207664_10026775 3300025929 Bacteria 4362
80 Ga0207686_10054552 3300025934 Bacteria 2504
81 Ga0207704_10129705 3300025938 Bacteria 1743
82 Ga0207665_10040968 3300025939 Bacteria 3092
83 Ga0207661_10000787 3300025944 Bacteria 20667
84 Ga0207712_10000019 3300025961 Bacteria 317060
85 Ga0207640_10006888 3300025981 Bacteria 6250
86 Ga0207639_10022175 3300026041 Bacteria 4571
87 Ga0207678_10246818 3300026067 Bacteria 1529
88 Ga0207708_10027974 3300026075 Bacteria 4269
89 Ga0207702_10010875 3300026078 Bacteria 7590
90 Ga0207702_10242676 3300026078 Bacteria 1689
91 Ga0207641_10013041 3300026088 Bacteria 6817
92 Ga0207648_10218877 3300026089 Bacteria 1692
93 Ga0207428_10022667 3300027907 Bacteria 5296
94 Ga0207428_10041685 3300027907 Bacteria 3715
95 Ga0268266_10026375 3300028379 Bacteria 4943
96 Ga0265319_1000014 3300028563 Bacteria 177623
97 Ga0265318_10003151 3300028577 Bacteria 8437
98 Ga0265322_10029703 3300028654 Bacteria 1562
99 Ga0265338_10000185 3300028800 Bacteria 116333
100 Ga0265338_10032091 3300028800 Bacteria 5133
101 Ga0265320_10025488 3300031240 Bacteria 3107
102 Ga0265316_10106908 3300031344 Bacteria 2122
103 Ga0307406_10155580 3300031901 Bacteria 1637
104 Ga0307409_100130266 3300031995 Bacteria 2148
105 Ga0307415_100125937 3300032126 Bacteria 1931
106 Ga0373923_0051274 3300035111 Bacteria 1731
107 Ga0373941_0023479 3300035115 Bacteria 1761
108 Ga0395898_0002434 3300037466 Bacteria 21997
109 Ga0395898_0003507 3300037466 Bacteria 17499
110 Ga0395898_0182815 3300037466 Bacteria 2004
111 Ga0395905_0115596 3300037471 Bacteria 2521
112 Ga0436364_0023304 3300037853 Bacteria 14882
113 Ga0436364_0306250 3300037853 Bacteria 3006
114 Ga0436364_0453611 3300037853 Bacteria 18573
115 Ga0436364_1186703 3300037853 Bacteria 9290
116 Ga0436364_1279568 3300037853 Bacteria 8397
117 Ga0395901_0013568 3300038443 Bacteria 8287
118 Ga0395901_0186907 3300038443 Bacteria 2173
119 Ga0436365_0603548 3300039437 Bacteria 6269
120 Ga0436365_0669928 3300039437 Bacteria 11910
121 Ga0436365_0921224 3300039437 Bacteria 16349
122 Ga0436365_1019895 3300039437 Bacteria 2500
123 Ga0436365_1063845 3300039437 Bacteria 2051
124 Ga0436365_1128146 3300039437 Bacteria 12263
125 Ga0436365_1734079 3300039437 Bacteria 9502
126 Ga0436365_1748676 3300039437 Bacteria 11932
127 Ga0436363_0023518 3300039450 Bacteria 29320
128 Ga0436363_0868947 3300039450 Bacteria 10771
129 Ga0436363_1395526 3300039450 Bacteria 1268
130 Ga0436363_1448547 3300039450 Bacteria 6106
131 Ga0436362_0859919 3300039453 Bacteria 5102
132 Ga0436362_0996344 3300039453 Bacteria 1488
133 Ga0466966_0026689 3300044684 Bacteria 3770
134 Ga0466966_0027990 3300044684 Bacteria 3673
135 Ga0466961_0137046 3300044693 Bacteria 1533
136 Ga0466963_0000127 3300044694 Bacteria 28865
137 Ga0466963_0006735 3300044694 Bacteria 6827
138 Ga0466963_0017407 3300044694 Bacteria 4480
139 Ga0466963_0021929 3300044694 Bacteria 4038
140 Ga0466963_0023442 3300044694 Bacteria 3921
141 Ga0466963_0036052 3300044694 Bacteria 3224
142 Ga0466963_0060160 3300044694 Bacteria 2536
143 Ga0466968_0054149 3300044735 Bacteria 1720
144 Ga0466959_0095182 3300045049 Bacteria 2136
145 Ga0466967_0012960 3300045976 Bacteria 6413
146 Ga0466967_0015203 3300045976 Bacteria 6027
147 Ga0466967_0018386 3300045976 Bacteria 5582
148 Ga0466967_0020376 3300045976 Bacteria 5358
149 Ga0466967_0028985 3300045976 Bacteria 4628
150 Ga0466967_0044749 3300045976 Bacteria 3842
151 Ga0466967_0230896 3300045976 Bacteria 1762
152 Ga0466967_0368483 3300045976 Bacteria 1393
153 Ga0466967_0428506 3300045976 Bacteria 1290
154 Ga0495629_0268561 3300046459 Bacteria 1172
155 Ga0495641_0000278 3300046461 Bacteria 40927
156 Ga0495641_0041089 3300046461 Bacteria 2149
157 Ga0495594_0087964 3300046499 Bacteria 1739
158 Ga0495644_0014057 3300046523 Bacteria 3068
159 Ga0495652_0046971 3300046529 Bacteria 3705
160 Ga0495640_0016698 3300046533 Bacteria 5490
161 Ga0495667_0017989 3300046559 Bacteria 4774
162 Ga0495656_0018237 3300046615 Bacteria 2691
163 Ga0495646_0038533 3300046680 Bacteria 2951
164 Ga0495658_0007538 3300046683 Bacteria 5392
165 Ga0495674_0037928 3300047319 Bacteria 4329
166 Ga0495676_0037720 3300047321 Bacteria 4019
167 Ga0495684_0050501 3300047471 Bacteria 3175
168 Ga0495686_0000008 3300047472 Bacteria 727479
169 Ga0495686_0012972 3300047472 Bacteria 5807
170 Ga0495686_0018210 3300047472 Bacteria 4718
171 Ga0495686_0171741 3300047472 Bacteria 1260
172 Ga0496100_0005942 3300048903 Bacteria 6618
173 Ga0496102_0014116 3300048905 Bacteria 6939
174 Ga0496102_0077035 3300048905 Bacteria 3069
175 Ga0496104_0000024 3300048907 Bacteria 229913
176 Ga0496104_0077933 3300048907 Bacteria 3158
177 Ga0496104_0193001 3300048907 Bacteria 1948
178 Ga0496105_0000013 3300048908 Bacteria 229894
179 Ga0496105_0112561 3300048908 Bacteria 2246
180 Ga0496106_0095338 3300048909 Bacteria 2301
181 Ga0496108_0000006 3300048911 Bacteria 469473
182 Ga0496108_0000232 3300048911 Bacteria 49846
183 Ga0496108_0005533 3300048911 Bacteria 10220
184 Ga0496108_0183612 3300048911 Bacteria 1812
185 Ga0496109_0000004 3300048912 Bacteria 404818
186 Ga0496109_0000044 3300048912 Bacteria 133779
187 Ga0496109_0006643 3300048912 Bacteria 9741
188 Ga0496109_0032585 3300048912 Bacteria 4684
189 Ga0496109_0159965 3300048912 Bacteria 2110
190 Ga0496109_0465282 3300048912 Bacteria 1194
191 Ga0496111_0104574 3300048914 Bacteria 2083
192 Ga0496112_0038279 3300048915 Bacteria 4683
193 Ga0496112_0060919 3300048915 Bacteria 3719
194 Ga0496112_0090552 3300048915 Bacteria 3028
195 Ga0496113_0047073 3300048916 Bacteria 3204
196 Ga0496114_0049233 3300048917 Bacteria 3506
197 Ga0496114_0060273 3300048917 Bacteria 3171
198 Ga0496115_0004900 3300048918 Bacteria 9715
199 Ga0496117_0002686 3300048920 Bacteria 21983
200 Ga0496118_0002280 3300048921 Bacteria 26182
201 Ga0501031_0013391 3300049568 Bacteria 5351
202 Ga0501031_0079188 3300049568 Bacteria 2141
203 Ga0501033_0274653 3300049570 Bacteria 1191
204 Ga0501040_0010569 3300049576 Bacteria 6036
205 Ga0501041_0008670 3300049577 Bacteria 5989
206 Ga0501042_0027613 3300049578 Bacteria 3992
207 Ga0501042_0072322 3300049578 Bacteria 2467
208 Ga0501047_0077842 3300049581 Bacteria 3189
209 Ga0501048_0008471 3300049582 Bacteria 7776
210 Ga0501068_0052018 3300049584 Bacteria 2479
211 Ga0501072_0021679 3300049588 Bacteria 4983
212 Ga0501072_0027652 3300049588 Bacteria 4424
213 Ga0501075_0055327 3300049591 Bacteria 2986
214 Ga0501079_0022517 3300049741 Bacteria 4832
215 Ga0501081_0013111 3300049743 Bacteria 5450
216 Ga0501035_0272947 3300049822 Bacteria 1431
217 Ga0501045_0028573 3300049824 Bacteria 4024
218 Ga0501045_0037277 3300049824 Bacteria 3533
219 Ga0501045_0058162 3300049824 Bacteria 2830
220 nmdc:mga0yw44_128364_c1 3300050492 Bacteria 1639
221 nmdc:mga0yw44_13827_c1 3300050492 Bacteria 4264
222 nmdc:mga0yw44_226009_c1 3300050492 Bacteria 1241
223 nmdc:mga0yw44_38747_c1 3300050492 Bacteria 2822
224 nmdc:mga05p37_123584_c1 3300050507 Bacteria 3179
225 nmdc:mga05p37_207250_c1 3300050507 Bacteria 2371
226 nmdc:mga09592_349013_c1 3300050508 Bacteria 1281
227 nmdc:mga06r32_18223_c1 3300050510 Bacteria 6425
228 nmdc:mga08y16_80128_c1 3300050511 Bacteria 3404
229 nmdc:mga08y16_8138_c1 3300050511 Bacteria 10969
230 nmdc:mga0n895_11741_c1 3300050512 Bacteria 7829
231 nmdc:mga0n895_2669_c1 3300050512 Bacteria 14078
232 nmdc:mga0a205_110094_c1 3300050515 Bacteria 2653
233 Ga0495619_0000010 3300053085 Bacteria 302390
234 Ga0495619_0000146 3300053085 Bacteria 52136
235 Ga0501084_0078270 3300054114 Bacteria 2771
236 Ga0501082_0070661 3300060353 Bacteria 3006
237 Ga0466962_0005750 3300061719 Bacteria 5958
238 Ga0466962_0024131 3300061719 Bacteria 2922
239 Ga0530510_0244278 3300061734 Bacteria 1337

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046459 Ga0495629_0268561 Ga0495629_0268561_98_1162 322
2 3300048912 Ga0496109_0465282 Ga0496109_0465282_178_1179 333
3 3300005841 Ga0068863_100026859 Ga0068863_1000268597 363
4 3300026088 Ga0207641_10013041 Ga0207641_100130419 363
5 3300047472 Ga0495686_0171741 Ga0495686_0171741_135_1250 363
6 3300047472 Ga0495686_0000008 Ga0495686_0000008_348054_349271 364
7 3300005329 Ga0070683_100089920 Ga0070683_1000899205 365
8 3300005336 Ga0070680_100001012 Ga0070680_10000101210 365
9 3300005337 Ga0070682_100009080 Ga0070682_1000090804 365
10 3300005345 Ga0070692_10059521 Ga0070692_100595212 365
11 3300005366 Ga0070659_100025119 Ga0070659_1000251193 365
12 3300005458 Ga0070681_10005635 Ga0070681_100056358 365
13 3300005530 Ga0070679_100000204 Ga0070679_10000020412 365
14 3300005535 Ga0070684_100022008 Ga0070684_1000220085 365
15 3300005614 Ga0068856_100053570 Ga0068856_1000535702 365
16 3300005616 Ga0068852_100009176 Ga0068852_1000091762 365
17 3300009551 Ga0105238_10019985 Ga0105238_100199852 365
18 3300013104 Ga0157370_10036948 Ga0157370_100369483 365
19 3300020082 Ga0206353_11601920 Ga0206353_116019207 365
20 3300025912 Ga0207707_10010279 Ga0207707_100102797 365
21 3300025919 Ga0207657_10236960 Ga0207657_102369601 365
22 3300025921 Ga0207652_10015879 Ga0207652_100158795 365
23 3300025944 Ga0207661_10000787 Ga0207661_1000078710 365
24 3300026078 Ga0207702_10242676 Ga0207702_102426761 365
25 3300048920 Ga0496117_0002686 Ga0496117_0002686_15472_16674 365
26 3300048921 Ga0496118_0002280 Ga0496118_0002280_3019_4221 365
27 3300046461 Ga0495641_0000278 Ga0495641_0000278_32297_33523 366
28 3300046523 Ga0495644_0014057 Ga0495644_0014057_1372_2598 366
29 3300046683 Ga0495658_0007538 Ga0495658_0007538_4012_5238 366
30 3300047472 Ga0495686_0012972 Ga0495686_0012972_2655_3881 366
31 3300045976 Ga0466967_0230896 Ga0466967_0230896_603_1730 370
32 3300035115 Ga0373941_0023479 Ga0373941_0023479_84_1289 371
33 3300005981 Ga0081538_10022624 Ga0081538_100226243 372
34 3300045976 Ga0466967_0012960 Ga0466967_0012960_45_1187 372
35 3300048911 Ga0496108_0000232 Ga0496108_0000232_45567_46748 373
36 3300048912 Ga0496109_0000044 Ga0496109_0000044_129475_130656 373
37 3300047472 Ga0495686_0018210 Ga0495686_0018210_500_1723 374
38 3300028563 Ga0265319_1000014 Ga0265319_100001419 375
39 3300028800 Ga0265338_10000185 Ga0265338_1000018517 375
40 3300045976 Ga0466967_0368483 Ga0466967_0368483_37_1170 375
41 3300050507 nmdc:mga05p37_123584_c1 nmdc:mga05p37_123584_c1_1649_2845 375
42 3300050512 nmdc:mga0n895_11741_c1 nmdc:mga0n895_11741_c1_1530_2726 375
43 3300050515 nmdc:mga0a205_110094_c1 nmdc:mga0a205_110094_c1_192_1388 375
44 3300006038 Ga0075365_10195035 Ga0075365_101950352 378
45 3300050492 nmdc:mga0yw44_226009_c1 nmdc:mga0yw44_226009_c1_49_1215 378
46 3300005329 Ga0070683_100306571 Ga0070683_1003065712 379
47 3300035111 Ga0373923_0051274 Ga0373923_0051274_366_1592 379
48 3300048908 Ga0496105_0112561 Ga0496105_0112561_919_2091 380
49 3300049570 Ga0501033_0274653 Ga0501033_0274653_13_1167 380
50 3300006038 Ga0075365_10000342 Ga0075365_1000034212 382
51 3300050492 nmdc:mga0yw44_13827_c1 nmdc:mga0yw44_13827_c1_130_1401 382
52 3300050508 nmdc:mga09592_349013_c1 nmdc:mga09592_349013_c1_36_1202 383
53 3300044694 Ga0466963_0006735 Ga0466963_0006735_1067_2227 385
54 3300009553 Ga0105249_10000050 Ga0105249_1000005028 386
55 3300025961 Ga0207712_10000019 Ga0207712_10000019139 386
56 3300045976 Ga0466967_0018386 Ga0466967_0018386_3803_4966 386
57 3300048907 Ga0496104_0000024 Ga0496104_0000024_173716_174888 386
58 3300048908 Ga0496105_0000013 Ga0496105_0000013_55026_56198 386
59 3300005337 Ga0070682_100175419 Ga0070682_1001754192 387
60 3300005438 Ga0070701_10030746 Ga0070701_100307462 387
61 3300005615 Ga0070702_100002774 Ga0070702_1000027745 387
62 3300005834 Ga0068851_10125853 Ga0068851_101258532 387
63 3300009098 Ga0105245_10019375 Ga0105245_100193756 387
64 3300009148 Ga0105243_10100003 Ga0105243_101000033 387
65 3300026075 Ga0207708_10027974 Ga0207708_100279742 387
66 3300039437 Ga0436365_1734079 Ga0436365_1734079_4521_5687 387
67 3300039450 Ga0436363_1395526 Ga0436363_1395526_38_1201 387
68 3300045976 Ga0466967_0028985 Ga0466967_0028985_1522_2688 387
69 3300045976 Ga0466967_0428506 Ga0466967_0428506_88_1254 387
70 3300048905 Ga0496102_0077035 Ga0496102_0077035_932_2104 387
71 3300048909 Ga0496106_0095338 Ga0496106_0095338_189_1361 387
72 3300048911 Ga0496108_0183612 Ga0496108_0183612_592_1764 387
73 3300048912 Ga0496109_0006643 Ga0496109_0006643_396_1577 387
74 3300048912 Ga0496109_0159965 Ga0496109_0159965_502_1674 387
75 3300005329 Ga0070683_100025028 Ga0070683_1000250285 388
76 3300005329 Ga0070683_100052857 Ga0070683_1000528574 388
77 3300005937 Ga0081455_10005423 Ga0081455_1000542315 388
78 3300037466 Ga0395898_0182815 Ga0395898_0182815_68_1243 388
79 3300037853 Ga0436364_1186703 Ga0436364_1186703_3711_4877 388
80 3300039437 Ga0436365_1063845 Ga0436365_1063845_375_1541 388
81 3300039453 Ga0436362_0996344 Ga0436362_0996344_281_1447 388
82 3300044694 Ga0466963_0023442 Ga0466963_0023442_101_1276 388
83 3300044694 Ga0466963_0036052 Ga0466963_0036052_1755_2930 388
84 3300045976 Ga0466967_0015203 Ga0466967_0015203_2990_4165 388
85 3300047471 Ga0495684_0050501 Ga0495684_0050501_719_1897 388
86 3300048915 Ga0496112_0090552 Ga0496112_0090552_843_2018 388
87 3300061719 Ga0466962_0024131 Ga0466962_0024131_375_1550 388
88 3300005435 Ga0070714_100010420 Ga0070714_1000104207 389
89 3300005436 Ga0070713_100144699 Ga0070713_1001446992 389
90 3300005436 Ga0070713_100275679 Ga0070713_1002756792 389
91 3300005834 Ga0068851_10000126 Ga0068851_1000012639 389
92 3300005981 Ga0081538_10007931 Ga0081538_100079315 389
93 3300006028 Ga0070717_10031766 Ga0070717_100317663 389
94 3300006038 Ga0075365_10002261 Ga0075365_100022617 389
95 3300006038 Ga0075365_10013269 Ga0075365_100132695 389
96 3300006844 Ga0075428_100076709 Ga0075428_1000767093 389
97 3300006847 Ga0075431_100002725 Ga0075431_10000272512 389
98 3300009098 Ga0105245_10007008 Ga0105245_100070084 389
99 3300009098 Ga0105245_10007551 Ga0105245_100075513 389
100 3300009147 Ga0114129_10105969 Ga0114129_101059694 389
101 3300009147 Ga0114129_10176676 Ga0114129_101766762 389
102 3300009147 Ga0114129_10254745 Ga0114129_102547452 389
103 3300021377 Ga0213874_10000224 Ga0213874_100002242 389
104 3300021384 Ga0213876_10010890 Ga0213876_100108906 389
105 3300021384 Ga0213876_10048941 Ga0213876_100489413 389
106 3300021388 Ga0213875_10018301 Ga0213875_100183012 389
107 3300021388 Ga0213875_10051260 Ga0213875_100512602 389
108 3300025321 Ga0207656_10003059 Ga0207656_100030592 389
109 3300025927 Ga0207687_10000851 Ga0207687_100008514 389
110 3300025928 Ga0207700_10128942 Ga0207700_101289422 389
111 3300025929 Ga0207664_10015670 Ga0207664_100156702 389
112 3300025929 Ga0207664_10026775 Ga0207664_100267754 389
113 3300025938 Ga0207704_10129705 Ga0207704_101297052 389
114 3300026041 Ga0207639_10022175 Ga0207639_100221752 389
115 3300026067 Ga0207678_10246818 Ga0207678_102468182 389
116 3300027907 Ga0207428_10022667 Ga0207428_100226672 389
117 3300028577 Ga0265318_10003151 Ga0265318_100031515 389
118 3300028654 Ga0265322_10029703 Ga0265322_100297032 389
119 3300028800 Ga0265338_10032091 Ga0265338_100320912 389
120 3300031240 Ga0265320_10025488 Ga0265320_100254882 389
121 3300031344 Ga0265316_10106908 Ga0265316_101069082 389
122 3300037466 Ga0395898_0003507 Ga0395898_0003507_2551_3828 389
123 3300037471 Ga0395905_0115596 Ga0395905_0115596_814_2091 389
124 3300037853 Ga0436364_0023304 Ga0436364_0023304_6412_7581 389
125 3300037853 Ga0436364_0306250 Ga0436364_0306250_1447_2616 389
126 3300037853 Ga0436364_0453611 Ga0436364_0453611_13966_15135 389
127 3300038443 Ga0395901_0013568 Ga0395901_0013568_5908_7185 389
128 3300038443 Ga0395901_0186907 Ga0395901_0186907_526_1701 389
129 3300039437 Ga0436365_0603548 Ga0436365_0603548_3905_5074 389
130 3300039437 Ga0436365_0921224 Ga0436365_0921224_12769_13938 389
131 3300039437 Ga0436365_1019895 Ga0436365_1019895_1107_2276 389
132 3300039437 Ga0436365_1748676 Ga0436365_1748676_5713_6882 389
133 3300039450 Ga0436363_0023518 Ga0436363_0023518_22352_23521 389
134 3300039450 Ga0436363_0868947 Ga0436363_0868947_2026_3195 389
135 3300039450 Ga0436363_1448547 Ga0436363_1448547_3433_4602 389
136 3300039453 Ga0436362_0859919 Ga0436362_0859919_3595_4764 389
137 3300044684 Ga0466966_0026689 Ga0466966_0026689_29_1198 389
138 3300044684 Ga0466966_0027990 Ga0466966_0027990_1128_2297 389
139 3300044693 Ga0466961_0137046 Ga0466961_0137046_243_1412 389
140 3300044694 Ga0466963_0060160 Ga0466963_0060160_1218_2387 389
141 3300045049 Ga0466959_0095182 Ga0466959_0095182_608_1777 389
142 3300046499 Ga0495594_0087964 Ga0495594_0087964_276_1496 389
143 3300046615 Ga0495656_0018237 Ga0495656_0018237_24_1202 389
144 3300047321 Ga0495676_0037720 Ga0495676_0037720_197_1417 389
145 3300048903 Ga0496100_0005942 Ga0496100_0005942_4174_5382 389
146 3300048905 Ga0496102_0014116 Ga0496102_0014116_2417_3625 389
147 3300048907 Ga0496104_0193001 Ga0496104_0193001_451_1659 389
148 3300048911 Ga0496108_0005533 Ga0496108_0005533_666_1874 389
149 3300048912 Ga0496109_0032585 Ga0496109_0032585_3227_4435 389
150 3300048915 Ga0496112_0038279 Ga0496112_0038279_1437_2645 389
151 3300048917 Ga0496114_0060273 Ga0496114_0060273_1583_2791 389
152 3300048918 Ga0496115_0004900 Ga0496115_0004900_3374_4582 389
153 3300049578 Ga0501042_0072322 Ga0501042_0072322_165_1334 389
154 3300049581 Ga0501047_0077842 Ga0501047_0077842_679_1851 389
155 3300049588 Ga0501072_0021679 Ga0501072_0021679_1469_2638 389
156 3300049822 Ga0501035_0272947 Ga0501035_0272947_21_1229 389
157 3300049824 Ga0501045_0058162 Ga0501045_0058162_1181_2350 389
158 3300050492 nmdc:mga0yw44_128364_c1 nmdc:mga0yw44_128364_c1_392_1591 389
159 3300050492 nmdc:mga0yw44_38747_c1 nmdc:mga0yw44_38747_c1_920_2116 389
160 3300050507 nmdc:mga05p37_207250_c1 nmdc:mga05p37_207250_c1_837_2021 389
161 3300050510 nmdc:mga06r32_18223_c1 nmdc:mga06r32_18223_c1_3027_4211 389
162 3300050512 nmdc:mga0n895_2669_c1 nmdc:mga0n895_2669_c1_7866_9050 389
163 3300061719 Ga0466962_0005750 Ga0466962_0005750_1983_3152 389
164 3300061734 Ga0530510_0244278 Ga0530510_0244278_64_1272 389
165 3300005437 Ga0070710_10008052 Ga0070710_100080525 390
166 3300005439 Ga0070711_100071698 Ga0070711_1000716982 390
167 3300005578 Ga0068854_100006276 Ga0068854_1000062764 390
168 3300005614 Ga0068856_100018427 Ga0068856_1000184276 390
169 3300005981 Ga0081538_10001795 Ga0081538_100017957 390
170 3300006028 Ga0070717_10015040 Ga0070717_100150406 390
171 3300009098 Ga0105245_10000201 Ga0105245_1000020130 390
172 3300009176 Ga0105242_10095993 Ga0105242_100959933 390
173 3300014745 Ga0157377_10046153 Ga0157377_100461533 390
174 3300021384 Ga0213876_10018563 Ga0213876_100185633 390
175 3300025893 Ga0207682_10000018 Ga0207682_1000001822 390
176 3300025915 Ga0207693_10000942 Ga0207693_1000094227 390
177 3300025916 Ga0207663_10162710 Ga0207663_101627102 390
178 3300025927 Ga0207687_10000020 Ga0207687_10000020167 390
179 3300025934 Ga0207686_10054552 Ga0207686_100545523 390
180 3300025939 Ga0207665_10040968 Ga0207665_100409682 390
181 3300025981 Ga0207640_10006888 Ga0207640_100068882 390
182 3300026078 Ga0207702_10010875 Ga0207702_100108754 390
183 3300028379 Ga0268266_10026375 Ga0268266_100263753 390
184 3300031995 Ga0307409_100130266 Ga0307409_1001302662 390
185 3300032126 Ga0307415_100125937 Ga0307415_1001259372 390
186 3300037466 Ga0395898_0002434 Ga0395898_0002434_4751_5962 390
187 3300037853 Ga0436364_1279568 Ga0436364_1279568_5307_6506 390
188 3300039437 Ga0436365_0669928 Ga0436365_0669928_6244_7443 390
189 3300039437 Ga0436365_1128146 Ga0436365_1128146_4433_5614 390
190 3300044694 Ga0466963_0000127 Ga0466963_0000127_24650_25834 390
191 3300044694 Ga0466963_0017407 Ga0466963_0017407_3233_4405 390
192 3300044735 Ga0466968_0054149 Ga0466968_0054149_226_1401 390
193 3300045976 Ga0466967_0044749 Ga0466967_0044749_834_2006 390
194 3300046461 Ga0495641_0041089 Ga0495641_0041089_359_1531 390
195 3300046529 Ga0495652_0046971 Ga0495652_0046971_474_1646 390
196 3300046533 Ga0495640_0016698 Ga0495640_0016698_604_1776 390
197 3300046559 Ga0495667_0017989 Ga0495667_0017989_13_1185 390
198 3300046680 Ga0495646_0038533 Ga0495646_0038533_1177_2349 390
199 3300047319 Ga0495674_0037928 Ga0495674_0037928_38_1210 390
200 3300048907 Ga0496104_0077933 Ga0496104_0077933_1239_2411 390
201 3300048911 Ga0496108_0000006 Ga0496108_0000006_55235_56419 390
202 3300048912 Ga0496109_0000004 Ga0496109_0000004_227978_229162 390
203 3300048916 Ga0496113_0047073 Ga0496113_0047073_409_1581 390
204 3300048917 Ga0496114_0049233 Ga0496114_0049233_2157_3329 390
205 3300053085 Ga0495619_0000010 Ga0495619_0000010_225137_226321 390
206 3300053085 Ga0495619_0000146 Ga0495619_0000146_3163_4356 390
207 3300005535 Ga0070684_100237216 Ga0070684_1002372162 391
208 3300005983 Ga0081540_1047655 Ga0081540_10476551 391
209 3300031901 Ga0307406_10155580 Ga0307406_101555802 391
210 3300044694 Ga0466963_0021929 Ga0466963_0021929_2155_3348 391
211 3300048914 Ga0496111_0104574 Ga0496111_0104574_126_1301 391
212 3300048915 Ga0496112_0060919 Ga0496112_0060919_2439_3614 391
213 3300049568 Ga0501031_0013391 Ga0501031_0013391_1378_2553 391
214 3300049824 Ga0501045_0028573 Ga0501045_0028573_1169_2344 391
215 3300003203 JGI25406J46586_10002762 JGI25406J46586_1000276210 392
216 3300005329 Ga0070683_100224410 Ga0070683_1002244102 392
217 3300005535 Ga0070684_100307429 Ga0070684_1003074291 392
218 3300005578 Ga0068854_100044694 Ga0068854_1000446942 392
219 3300005985 Ga0081539_10004464 Ga0081539_100044642 392
220 3300009094 Ga0111539_10017607 Ga0111539_100176074 392
221 3300025302 Ga0207426_1024187 Ga0207426_10241872 392
222 3300026089 Ga0207648_10218877 Ga0207648_102188772 392
223 3300027907 Ga0207428_10041685 Ga0207428_100416852 392
224 3300045976 Ga0466967_0020376 Ga0466967_0020376_1933_3120 392
225 3300049568 Ga0501031_0079188 Ga0501031_0079188_675_1853 392
226 3300049576 Ga0501040_0010569 Ga0501040_0010569_2143_3321 392
227 3300049577 Ga0501041_0008670 Ga0501041_0008670_2477_3655 392
228 3300049578 Ga0501042_0027613 Ga0501042_0027613_2355_3578 392
229 3300049582 Ga0501048_0008471 Ga0501048_0008471_3442_4665 392
230 3300049584 Ga0501068_0052018 Ga0501068_0052018_1203_2381 392
231 3300049588 Ga0501072_0027652 Ga0501072_0027652_1130_2308 392
232 3300049591 Ga0501075_0055327 Ga0501075_0055327_555_1778 392
233 3300049741 Ga0501079_0022517 Ga0501079_0022517_2527_3705 392
234 3300049743 Ga0501081_0013111 Ga0501081_0013111_2158_3336 392
235 3300049824 Ga0501045_0037277 Ga0501045_0037277_1833_3056 392
236 3300050511 nmdc:mga08y16_80128_c1 nmdc:mga08y16_80128_c1_795_1973 392
237 3300050511 nmdc:mga08y16_8138_c1 nmdc:mga08y16_8138_c1_3890_5068 392
238 3300054114 Ga0501084_0078270 Ga0501084_0078270_450_1628 392
239 3300060353 Ga0501082_0070661 Ga0501082_0070661_366_1544 392

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00291

PALP

Pyridoxal-phosphate dependent enzyme

67

372

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
6cut-assembly1.cif.gz_A engineered holo trpb from pyrococcus furiosus, pftrpb7e6 with (2s,3s)-isopropylserine bound as the external aldimine 0.9536 7 385
7rnp-assembly2.cif.gz_B engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9_h275e with 4-cl-trp non-covalently bound 0.9526 8 384
6amh-assembly2.cif.gz_D engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb4d11 with ser bound as e(aex1) 0.9522 7 385
5ey5-assembly1.cif.gz_D lbcats 0.9504 7 382
6am9-assembly2.cif.gz_D engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9, with ser-bound in a predominantly closed state. 0.9504 7 385
ID Description Score Start End Superfamily
af_P14671_91_282_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9777 18 200 3.40.50.1100
2rhgB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.976 8 201 3.40.50.1100
af_P43283_44_197_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.966 52 195 3.60.21.10
2rhgB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.962 8 201 3.40.50.1100
af_Q60179_69_392_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9423 56 377 3.40.50.1100
ID Description Score Start End GO Terms
AF-G5SXB3-F1-model_v4 tryptophan synthase (EC 4.2.1.20) 1.009 106 170 GO:0004834
GO:0005737
AF-A0A317YN28-F1-model_v4 tryptophan synthase (EC 4.2.1.20) 0.9953 99 202 GO:0004834
GO:0005737
AF-A0A2X3CN98-F1-model_v4 Tryptophan synthase beta chain (EC 4.2.1.20) 0.9927 89 218 GO:0004834
GO:0005737
AF-Q3HUY4-F1-model_v4 tryptophan synthase (EC 4.2.1.20) 0.99 87 235 GO:0004834
GO:0005737
AF-A0A7R9NBY4-F1-model_v4 deleted 0.9874 109 253

Feature Viewer

pLDDT pTM Quality
85.02 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map