F352141

General Info

Members Datasets Scaffolds Average Seq Length
239 141 478 99

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_1425001|Ga0436365_1425001_1662_2021
Length 119
Sequence LLDAPEVREDAVHPTTRRSMMIVMFTARRLKPDAWEQFRRAWDPGDAWPPGLQRAYHARNIRDEDEMISFGLFDMSAQDYHRWREAADAQETQRVDRLSAFVENEHVSGVYEVVDTVEE

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
34 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
53 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
54 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
55 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
80 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
81 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
82 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
83 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
86 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
87 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
88 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
89 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
91 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
92 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
93 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
94 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
97 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
98 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
99 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
100 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
101 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
102 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
103 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
104 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
105 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
106 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
107 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
108 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
109 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
110 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
111 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
112 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
113 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
114 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
115 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
116 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
117 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
118 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
119 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
120 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
121 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
122 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
123 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
124 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
127 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
128 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
131 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
134 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
135 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
136 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
137 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
138 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
139 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
140 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
141 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.93
Nodule 0
Rhizoplane 5.86
Rhizosphere 77.82
Stem 0
Stem Tuber 0
Unclassified 23.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_1425001 3300039437 Bacteria 2735
2 JGI25407J50210_10009680 3300003373 Bacteria 2446
3 Ga0070676_10233134 3300005328 Bacteria 1221
4 Ga0068869_101150741 3300005334 Bacteria 680
5 Ga0070682_100947592 3300005337 Bacteria 711
6 Ga0070691_10027062 3300005341 Bacteria 2675
7 Ga0070661_100272104 3300005344 Bacteria 1312
8 Ga0070668_100010846 3300005347 Bacteria 6780
9 Ga0070671_100792559 3300005355 Bacteria 825
10 Ga0070671_100972827 3300005355 Bacteria 743
11 Ga0070674_100446931 3300005356 Bacteria 1066
12 Ga0070659_101325075 3300005366 Bacteria 639
13 Ga0070709_11031742 3300005434 Unclassified 655
14 Ga0070709_11670349 3300005434 Unclassified 520
15 Ga0070714_100205087 3300005435 Unclassified 1805
16 Ga0070714_101126927 3300005435 Unclassified 765
17 Ga0070714_101854440 3300005435 Bacteria 589
18 Ga0070714_102278448 3300005435 Unclassified 527
19 Ga0070710_10135383 3300005437 Bacteria 1506
20 Ga0070710_10740385 3300005437 Unclassified 697
21 Ga0070711_100918382 3300005439 Unclassified 748
22 Ga0070700_100084746 3300005441 Bacteria 2054
23 Ga0070700_101030262 3300005441 Bacteria 678
24 Ga0070700_101254898 3300005441 Unclassified 621
25 Ga0070662_100019242 3300005457 Bacteria 4634
26 Ga0070686_101537625 3300005544 Bacteria 561
27 Ga0070695_101413162 3300005545 Bacteria 577
28 Ga0068855_101412323 3300005563 Bacteria 717
29 Ga0068854_101705997 3300005578 Unclassified 576
30 Ga0068856_100387812 3300005614 Bacteria 1417
31 Ga0070702_100335782 3300005615 Bacteria 1059
32 Ga0068866_10189140 3300005718 Bacteria 1222
33 Ga0068866_10609427 3300005718 Bacteria 738
34 Ga0068861_100008516 3300005719 Bacteria 7061
35 Ga0068862_100339925 3300005844 Bacteria 1390
36 Ga0081455_10013236 3300005937 Bacteria 8170
37 Ga0081538_10000341 3300005981 Bacteria 53130
38 Ga0081538_10001609 3300005981 Bacteria 23178
39 Ga0081538_10008520 3300005981 Bacteria 8690
40 Ga0081538_10009410 3300005981 Bacteria 8163
41 Ga0081538_10009700 3300005981 Bacteria 7988
42 Ga0081538_10015802 3300005981 Bacteria 5822
43 Ga0081538_10061691 3300005981 Bacteria 2144
44 Ga0081540_1000783 3300005983 Bacteria 29165
45 Ga0081539_10006989 3300005985 Bacteria 10483
46 Ga0075365_10048811 3300006038 Unclassified 2787
47 Ga0075365_10114167 3300006038 Bacteria 1858
48 Ga0075364_10144723 3300006051 Bacteria 1600
49 Ga0075364_10348074 3300006051 Unclassified 1010
50 Ga0075432_10095323 3300006058 Bacteria 1094
51 Ga0070715_10320940 3300006163 Unclassified 836
52 Ga0070712_100205011 3300006175 Bacteria 1552
53 Ga0070712_101738743 3300006175 Bacteria 546
54 Ga0075428_100016228 3300006844 Bacteria 8232
55 Ga0075435_100104590 3300007076 Bacteria 2349
56 Ga0111539_10199482 3300009094 Bacteria 2333
57 Ga0111539_10799447 3300009094 Bacteria 1098
58 Ga0105245_10019710 3300009098 Bacteria 5912
59 Ga0114129_12390364 3300009147 Bacteria 633
60 Ga0114129_12455128 3300009147 Unclassified 624
61 Ga0105243_10789177 3300009148 Bacteria 935
62 Ga0105243_11279045 3300009148 Bacteria 750
63 Ga0105238_12449483 3300009551 Bacteria 558
64 Ga0105249_10017754 3300009553 Bacteria 6319
65 Ga0105239_12472297 3300010375 Unclassified 605
66 Ga0105239_12815236 3300010375 Unclassified 568
67 Ga0157369_11022644 3300013105 Bacteria 846
68 Ga0157378_11064875 3300013297 Bacteria 845
69 Ga0163162_10021054 3300013306 Bacteria 6414
70 Ga0157372_10364057 3300013307 Bacteria 1685
71 Ga0157380_11330339 3300014326 Bacteria 767
72 Ga0163161_10088904 3300017792 Bacteria 2284
73 Ga0206350_11091624 3300020080 Archaea 810
74 Ga0213874_10034940 3300021377 Bacteria 1474
75 Ga0213874_10120204 3300021377 Bacteria 892
76 Ga0213874_10445915 3300021377 Unclassified 510
77 Ga0213876_10037114 3300021384 Bacteria 2570
78 Ga0213876_10042997 3300021384 Bacteria 2388
79 Ga0213876_10089897 3300021384 Bacteria 1626
80 Ga0213875_10241074 3300021388 Bacteria 852
81 Ga0207692_10082072 3300025898 Bacteria 1727
82 Ga0207642_10137612 3300025899 Bacteria 1283
83 Ga0207688_10040808 3300025901 Bacteria 2579
84 Ga0207685_10482991 3300025905 Unclassified 649
85 Ga0207699_10299150 3300025906 Bacteria 1123
86 Ga0207645_10234224 3300025907 Bacteria 1212
87 Ga0207654_10321139 3300025911 Bacteria 1058
88 Ga0207693_10081243 3300025915 Bacteria 2537
89 Ga0207693_10346824 3300025915 Bacteria 1162
90 Ga0207663_10944780 3300025916 Unclassified 690
91 Ga0207657_10398798 3300025919 Bacteria 1082
92 Ga0207687_10042862 3300025927 Bacteria 3116
93 Ga0207664_10467445 3300025929 Bacteria 1127
94 Ga0207664_11219074 3300025929 Archaea 671
95 Ga0207644_10937648 3300025931 Unclassified 726
96 Ga0207706_10021915 3300025933 Bacteria 5734
97 Ga0207709_10505937 3300025935 Bacteria 943
98 Ga0207661_10161436 3300025944 Bacteria 1945
99 Ga0207712_10010855 3300025961 Bacteria 5794
100 Ga0207668_10143830 3300025972 Bacteria 1837
101 Ga0207640_10274303 3300025981 Bacteria 1321
102 Ga0207640_10301829 3300025981 Bacteria 1267
103 Ga0207640_11908698 3300025981 Bacteria 537
104 Ga0207678_10553881 3300026067 Bacteria 1006
105 Ga0207708_10145197 3300026075 Bacteria 1864
106 Ga0207708_11020119 3300026075 Bacteria 719
107 Ga0207708_11867238 3300026075 Bacteria 527
108 Ga0207702_10646074 3300026078 Bacteria 1040
109 Ga0207675_100006404 3300026118 Bacteria 11153
110 Ga0207698_10150560 3300026142 Bacteria 2019
111 Ga0207698_10269507 3300026142 Bacteria 1569
112 Ga0207428_10425697 3300027907 Bacteria 970
113 Ga0307405_10332428 3300031731 Bacteria 1165
114 Ga0307405_10626039 3300031731 Bacteria 882
115 Ga0307405_11605777 3300031731 Bacteria 574
116 Ga0307410_10792053 3300031852 Bacteria 805
117 Ga0307406_10217573 3300031901 Bacteria 1417
118 Ga0307406_10302635 3300031901 Bacteria 1229
119 Ga0307409_100126612 3300031995 Bacteria 2174
120 Ga0307416_100470360 3300032002 Bacteria 1314
121 Ga0307416_101968500 3300032002 Bacteria 687
122 Ga0307411_10146380 3300032005 Bacteria 1749
123 Ga0307415_100216498 3300032126 Bacteria 1532
124 Ga0307415_100339887 3300032126 Bacteria 1259
125 Ga0373945_0291877 3300035116 Unclassified 697
126 Ga0373946_0373709 3300035171 Unclassified 716
127 Ga0373925_0078948 3300037068 Bacteria 2500
128 Ga0395899_0070679 3300037312 Bacteria 2555
129 Ga0395899_0081513 3300037312 Bacteria 2354
130 Ga0395900_0047687 3300037418 Bacteria 4412
131 Ga0395900_0530170 3300037418 Bacteria 1124
132 Ga0395900_0589322 3300037418 Bacteria 1053
133 Ga0395900_1187672 3300037418 Unclassified 679
134 Ga0395898_0010995 3300037466 Bacteria 9431
135 Ga0395898_0064958 3300037466 Bacteria 3539
136 Ga0395898_0162391 3300037466 Unclassified 2137
137 Ga0395898_0267502 3300037466 Bacteria 1630
138 Ga0395898_0897484 3300037466 Bacteria 825
139 Ga0395905_0688286 3300037471 Unclassified 925
140 Ga0395905_1232131 3300037471 Unclassified 652
141 Ga0436364_0117673 3300037853 Bacteria 3451
142 Ga0436364_0189902 3300037853 Bacteria 7212
143 Ga0436364_0317805 3300037853 Bacteria 22106
144 Ga0436364_0383989 3300037853 Bacteria 2777
145 Ga0436364_1126564 3300037853 Bacteria 681
146 Ga0436364_1427118 3300037853 Bacteria 5526
147 Ga0395901_0001878 3300038443 Bacteria 21664
148 Ga0395901_0007454 3300038443 Bacteria 11043
149 Ga0395901_0013139 3300038443 Bacteria 8405
150 Ga0395901_0381382 3300038443 Bacteria 1451
151 Ga0395901_0720406 3300038443 Bacteria 993
152 Ga0395901_1519889 3300038443 Bacteria 625
153 Ga0436365_0112446 3300039437 Bacteria 4371
154 Ga0436365_0255655 3300039437 Unclassified 679
155 Ga0436365_0470929 3300039437 Bacteria 675
156 Ga0436365_0800865 3300039437 Unclassified 910
157 Ga0436365_1032352 3300039437 Bacteria 1692
158 Ga0436365_1587035 3300039437 Bacteria 11515
159 Ga0436365_1869280 3300039437 Bacteria 2455
160 Ga0436365_1936746 3300039437 Bacteria 17171
161 Ga0436360_0030982 3300039438 Unclassified 623
162 Ga0436361_0189823 3300039447 Bacteria 1214
163 Ga0436363_0093902 3300039450 Unclassified 634
164 Ga0436363_0395772 3300039450 Bacteria 773
165 Ga0436363_0457919 3300039450 Unclassified 792
166 Ga0436363_0646954 3300039450 Unclassified 910
167 Ga0436363_0944993 3300039450 Bacteria 838
168 Ga0436363_0997650 3300039450 Bacteria 1607
169 Ga0436363_1264020 3300039450 Bacteria 1140
170 Ga0436363_1433621 3300039450 Unclassified 632
171 Ga0436362_0665923 3300039453 Bacteria 1645
172 Ga0436362_0689107 3300039453 Bacteria 1344
173 Ga0436362_0691554 3300039453 Bacteria 2438
174 Ga0451789_0689086 3300041443 Bacteria 910
175 Ga0451807_1078766 3300041486 Bacteria 528
176 Ga0451851_1228208 3300041507 Bacteria 666
177 Ga0451853_1813788 3300041512 Unclassified 636
178 Ga0466966_0054824 3300044684 Bacteria 2525
179 Ga0466966_0230657 3300044684 Unclassified 1117
180 Ga0466961_0437785 3300044693 Unclassified 792
181 Ga0466961_0488697 3300044693 Bacteria 744
182 Ga0466963_0142608 3300044694 Unclassified 1660
183 Ga0466963_0200488 3300044694 Bacteria 1396
184 Ga0466963_0278178 3300044694 Bacteria 1176
185 Ga0466964_0506903 3300044706 Unclassified 649
186 Ga0466971_0318712 3300044719 Unclassified 749
187 Ga0466971_0691503 3300044719 Unclassified 512
188 Ga0466968_0036721 3300044735 Bacteria 2054
189 Ga0466968_0047083 3300044735 Unclassified 1833
190 Ga0466968_0159279 3300044735 Bacteria 1041
191 Ga0466968_0331174 3300044735 Bacteria 737
192 Ga0466970_0679430 3300044765 Unclassified 600
193 Ga0466959_0113894 3300045049 Bacteria 1928
194 Ga0466959_0172834 3300045049 Bacteria 1515
195 Ga0466959_0214387 3300045049 Bacteria 1337
196 Ga0466959_0439315 3300045049 Unclassified 885
197 Ga0466959_1213975 3300045049 Unclassified 501
198 Ga0466958_0003607 3300045836 Bacteria 8067
199 Ga0466958_0094541 3300045836 Unclassified 1852
200 Ga0466958_0330159 3300045836 Bacteria 981
201 Ga0466958_0346269 3300045836 Bacteria 956
202 Ga0466958_0520045 3300045836 Unclassified 772
203 Ga0466958_0762343 3300045836 Bacteria 631
204 Ga0466967_0150139 3300045976 Bacteria 2177
205 Ga0466967_0632600 3300045976 Bacteria 1057
206 Ga0466967_2399711 3300045976 Bacteria 523
207 Ga0495653_0917290 3300046463 Unclassified 521
208 Ga0495605_0256610 3300046474 Unclassified 747
209 Ga0495605_0297772 3300046474 Bacteria 683
210 Ga0495631_0042669 3300046518 Unclassified 2004
211 Ga0495635_0553360 3300046663 Unclassified 754
212 Ga0495658_0582015 3300046683 Bacteria 717
213 Ga0495670_0256413 3300046691 Bacteria 933
214 Ga0495671_0112476 3300046692 Unclassified 1330
215 Ga0495649_0626816 3300046694 Unclassified 530
216 Ga0495589_0385268 3300046794 Bacteria 644
217 Ga0495626_0121720 3300048091 Bacteria 1121
218 Ga0496100_0898473 3300048903 Unclassified 696
219 Ga0496102_0416061 3300048905 Bacteria 1263
220 Ga0496102_1642766 3300048905 Bacteria 561
221 Ga0496102_1718303 3300048905 Bacteria 545
222 Ga0496104_0195691 3300048907 Bacteria 1934
223 Ga0496105_0155555 3300048908 Bacteria 1878
224 Ga0496108_0175254 3300048911 Bacteria 1856
225 Ga0496109_0058947 3300048912 Bacteria 3507
226 Ga0496110_0146191 3300048913 Bacteria 2138
227 Ga0496111_0018180 3300048914 Bacteria 4867
228 Ga0496112_0003115 3300048915 Bacteria 13595
229 Ga0496113_0056678 3300048916 Bacteria 2943
230 Ga0501251_114115 3300049681 Unclassified 506
231 nmdc:mga00v17_694787_c1 3300050491 Bacteria 652
232 nmdc:mga0yw44_30517_c1 3300050492 Unclassified 3125
233 nmdc:mga0yw44_790024_c1 3300050492 Unclassified 645
234 nmdc:mga05p37_1514613_c1 3300050507 Bacteria 667
235 nmdc:mga08y16_740593_c1 3300050511 Bacteria 980
236 nmdc:mga0rr50_134728_c1 3300050513 Bacteria 1981
237 Ga0495612_0520939 3300053078 Bacteria 546
238 Ga0466962_0340629 3300061719 Unclassified 746
239 Ga0466962_0470498 3300061719 Unclassified 634
240 Ga0436365_1425001
241 JGI25407J50210_10009680
242 Ga0070676_10233134
243 Ga0068869_101150741
244 Ga0070682_100947592
245 Ga0070691_10027062
246 Ga0070661_100272104
247 Ga0070668_100010846
248 Ga0070671_100792559
249 Ga0070671_100972827
250 Ga0070674_100446931
251 Ga0070659_101325075
252 Ga0070709_11031742
253 Ga0070709_11670349
254 Ga0070714_100205087
255 Ga0070714_101126927
256 Ga0070714_101854440
257 Ga0070714_102278448
258 Ga0070710_10135383
259 Ga0070710_10740385
260 Ga0070711_100918382
261 Ga0070700_100084746
262 Ga0070700_101030262
263 Ga0070700_101254898
264 Ga0070662_100019242
265 Ga0070686_101537625
266 Ga0070695_101413162
267 Ga0068855_101412323
268 Ga0068854_101705997
269 Ga0068856_100387812
270 Ga0070702_100335782
271 Ga0068866_10189140
272 Ga0068866_10609427
273 Ga0068861_100008516
274 Ga0068862_100339925
275 Ga0081455_10013236
276 Ga0081538_10000341
277 Ga0081538_10001609
278 Ga0081538_10008520
279 Ga0081538_10009410
280 Ga0081538_10009700
281 Ga0081538_10015802
282 Ga0081538_10061691
283 Ga0081540_1000783
284 Ga0081539_10006989
285 Ga0075365_10048811
286 Ga0075365_10114167
287 Ga0075364_10144723
288 Ga0075364_10348074
289 Ga0075432_10095323
290 Ga0070715_10320940
291 Ga0070712_100205011
292 Ga0070712_101738743
293 Ga0075428_100016228
294 Ga0075435_100104590
295 Ga0111539_10199482
296 Ga0111539_10799447
297 Ga0105245_10019710
298 Ga0114129_12390364
299 Ga0114129_12455128
300 Ga0105243_10789177
301 Ga0105243_11279045
302 Ga0105238_12449483
303 Ga0105249_10017754
304 Ga0105239_12472297
305 Ga0105239_12815236
306 Ga0157369_11022644
307 Ga0157378_11064875
308 Ga0163162_10021054
309 Ga0157372_10364057
310 Ga0157380_11330339
311 Ga0163161_10088904
312 Ga0206350_11091624
313 Ga0213874_10034940
314 Ga0213874_10120204
315 Ga0213874_10445915
316 Ga0213876_10037114
317 Ga0213876_10042997
318 Ga0213876_10089897
319 Ga0213875_10241074
320 Ga0207692_10082072
321 Ga0207642_10137612
322 Ga0207688_10040808
323 Ga0207685_10482991
324 Ga0207699_10299150
325 Ga0207645_10234224
326 Ga0207654_10321139
327 Ga0207693_10081243
328 Ga0207693_10346824
329 Ga0207663_10944780
330 Ga0207657_10398798
331 Ga0207687_10042862
332 Ga0207664_10467445
333 Ga0207664_11219074
334 Ga0207644_10937648
335 Ga0207706_10021915
336 Ga0207709_10505937
337 Ga0207661_10161436
338 Ga0207712_10010855
339 Ga0207668_10143830
340 Ga0207640_10274303
341 Ga0207640_10301829
342 Ga0207640_11908698
343 Ga0207678_10553881
344 Ga0207708_10145197
345 Ga0207708_11020119
346 Ga0207708_11867238
347 Ga0207702_10646074
348 Ga0207675_100006404
349 Ga0207698_10150560
350 Ga0207698_10269507
351 Ga0207428_10425697
352 Ga0307405_10332428
353 Ga0307405_10626039
354 Ga0307405_11605777
355 Ga0307410_10792053
356 Ga0307406_10217573
357 Ga0307406_10302635
358 Ga0307409_100126612
359 Ga0307416_100470360
360 Ga0307416_101968500
361 Ga0307411_10146380
362 Ga0307415_100216498
363 Ga0307415_100339887
364 Ga0373945_0291877
365 Ga0373946_0373709
366 Ga0373925_0078948
367 Ga0395899_0070679
368 Ga0395899_0081513
369 Ga0395900_0047687
370 Ga0395900_0530170
371 Ga0395900_0589322
372 Ga0395900_1187672
373 Ga0395898_0010995
374 Ga0395898_0064958
375 Ga0395898_0162391
376 Ga0395898_0267502
377 Ga0395898_0897484
378 Ga0395905_0688286
379 Ga0395905_1232131
380 Ga0436364_0117673
381 Ga0436364_0189902
382 Ga0436364_0317805
383 Ga0436364_0383989
384 Ga0436364_1126564
385 Ga0436364_1427118
386 Ga0395901_0001878
387 Ga0395901_0007454
388 Ga0395901_0013139
389 Ga0395901_0381382
390 Ga0395901_0720406
391 Ga0395901_1519889
392 Ga0436365_0112446
393 Ga0436365_0255655
394 Ga0436365_0470929
395 Ga0436365_0800865
396 Ga0436365_1032352
397 Ga0436365_1587035
398 Ga0436365_1869280
399 Ga0436365_1936746
400 Ga0436360_0030982
401 Ga0436361_0189823
402 Ga0436363_0093902
403 Ga0436363_0395772
404 Ga0436363_0457919
405 Ga0436363_0646954
406 Ga0436363_0944993
407 Ga0436363_0997650
408 Ga0436363_1264020
409 Ga0436363_1433621
410 Ga0436362_0665923
411 Ga0436362_0689107
412 Ga0436362_0691554
413 Ga0451789_0689086
414 Ga0451807_1078766
415 Ga0451851_1228208
416 Ga0451853_1813788
417 Ga0466966_0054824
418 Ga0466966_0230657
419 Ga0466961_0437785
420 Ga0466961_0488697
421 Ga0466963_0142608
422 Ga0466963_0200488
423 Ga0466963_0278178
424 Ga0466964_0506903
425 Ga0466971_0318712
426 Ga0466971_0691503
427 Ga0466968_0036721
428 Ga0466968_0047083
429 Ga0466968_0159279
430 Ga0466968_0331174
431 Ga0466970_0679430
432 Ga0466959_0113894
433 Ga0466959_0172834
434 Ga0466959_0214387
435 Ga0466959_0439315
436 Ga0466959_1213975
437 Ga0466958_0003607
438 Ga0466958_0094541
439 Ga0466958_0330159
440 Ga0466958_0346269
441 Ga0466958_0520045
442 Ga0466958_0762343
443 Ga0466967_0150139
444 Ga0466967_0632600
445 Ga0466967_2399711
446 Ga0495653_0917290
447 Ga0495605_0256610
448 Ga0495605_0297772
449 Ga0495631_0042669
450 Ga0495635_0553360
451 Ga0495658_0582015
452 Ga0495670_0256413
453 Ga0495671_0112476
454 Ga0495649_0626816
455 Ga0495589_0385268
456 Ga0495626_0121720
457 Ga0496100_0898473
458 Ga0496102_0416061
459 Ga0496102_1642766
460 Ga0496102_1718303
461 Ga0496104_0195691
462 Ga0496105_0155555
463 Ga0496108_0175254
464 Ga0496109_0058947
465 Ga0496110_0146191
466 Ga0496111_0018180
467 Ga0496112_0003115
468 Ga0496113_0056678
469 Ga0501251_114115
470 nmdc:mga00v17_694787_c1
471 nmdc:mga0yw44_30517_c1
472 nmdc:mga0yw44_790024_c1
473 nmdc:mga05p37_1514613_c1
474 nmdc:mga08y16_740593_c1
475 nmdc:mga0rr50_134728_c1
476 Ga0495612_0520939
477 Ga0466962_0340629
478 Ga0466962_0470498

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bio-assembly1.cif.gz_A crystal structure of monooxygenase rslo4 from streptomyces bottropensis 0.6114 2 93
6m35-assembly1.cif.gz_A crystal structure of sulfur oxygenase reductase from sulfurisphaera tokodaii 0.5979 3 83
6qne-assembly1.cif.gz_A y102g mutated sulfur oxygenase reductase from acidianus ambivalens 0.5969 3 83
2yaw-assembly1.cif.gz_A hg inhibited sulfur oxygenase reductase 0.5967 3 83
6qo0-assembly1.cif.gz_A i47w mutated sulfur oxygenase reductase from acidianus ambivaens 0.5963 3 83
ID Description Score Start End Superfamily
af_O96211_63_165_1.10.560.10 Mainly Alpha;Orthogonal Bundle;GROEL; domain 1;GroEL-like equatorial domain 0.6394 7 99 1.10.560.10
af_C0HHH9_156_252_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.616 2 90 3.30.70.100
af_I1LT96_4_307_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.5943 5 53 1.10.510.10
af_Q96P71_296_384_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.5931 2 95 3.30.70.100
1tuwA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel. 0.5847 1 88 3.30.70.1090
ID Description Score Start End GO Terms
AF-A0A538KC83-F1-model_v4 ABM domain-containing protein 0.7492 1 95
AF-A0A2E4JLB6-F1-model_v4 ABM domain-containing protein 0.7338 7 83
AF-A0A7Y1UNM8-F1-model_v4 ABM domain-containing protein 0.7208 2 99
AF-A0A538L0J4-F1-model_v4 ABM domain-containing protein 0.7158 3 99
AF-A0A7Y1UNM8-F1-model_v4 ABM domain-containing protein 0.7093 2 99

Map