F352125

General Info

Members Datasets Scaffolds Average Seq Length
239 149 235 341

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0049013|Ga0395900_0049013_766_1848
Length 360
Sequence MHAGLGSSQTPETKGGAGVKAVRVHEYHSDPKIDDIPEPKLQGPLDVIVKIGGAGVCRTDLHILEGQWAEAMGPKLPYVIGHENAGWVHEVGEGVTNVAVGDTVILHPQPSCGLCLPCRRGHDMQCVNAFFPGLSNNDGGMAEYLRTTARACVKLNPETNPADVAALADAGITAYHAVRKALPLLHPGTTAVVQGAGGLGHIGIQALAAITAARIVVVDRNPDALALAKQIGADEIVLADGTHIDAVKDLTDGKGAEVVFDFVAEGGAENDAWHMTAPAGSQYVIGYGGELRIPTLEFVGGEKNVIGNIVGTYPDLVELMVLAQAGKVTLHTKQYPLDAALDALHDLDAGRVRGRAILVP

Samples

Sample ID Description Type Environment
1 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
2 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
3 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
4 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
5 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
8 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
97 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
98 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
99 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
100 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
103 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
104 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
105 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
112 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
113 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
114 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
115 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
116 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
119 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
120 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
121 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
122 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
123 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
124 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
125 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
126 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
127 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
130 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
131 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
132 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
136 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
137 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
138 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
139 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
140 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
141 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
142 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
143 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
144 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
145 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
146 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
147 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
149 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.23
Metatranscriptomes 2.09
Isolates 1.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.04
Rhizosphere 88.28
Stem 0
Stem Tuber 0
Unclassified 1.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24745J21846_1001495 3300002073 Bacteria 2275
2 JGI25406J46586_10002261 3300003203 Bacteria 9080
3 JGI25407J50210_10009059 3300003373 Bacteria 2515
4 Ga0007429J51699_1025233 3300003579 Bacteria 3220
5 Ga0070683_100066234 3300005329 Bacteria 3364
6 Ga0070683_100178311 3300005329 Bacteria 2017
7 Ga0070670_100181785 3300005331 Bacteria 1826
8 Ga0068869_100041150 3300005334 Bacteria 3308
9 Ga0068869_100045089 3300005334 Bacteria 3173
10 Ga0070682_100035934 3300005337 Bacteria 3027
11 Ga0070682_100110119 3300005337 Bacteria 1834
12 Ga0068868_100130245 3300005338 Bacteria 2058
13 Ga0068868_100189677 3300005338 Bacteria 1709
14 Ga0068868_100220427 3300005338 Bacteria 1588
15 Ga0070660_100037497 3300005339 Bacteria 3675
16 Ga0070660_100054451 3300005339 Bacteria 3089
17 Ga0070689_100204785 3300005340 Bacteria 1612
18 Ga0070692_10076629 3300005345 Bacteria 1793
19 Ga0070668_100054805 3300005347 Bacteria 3076
20 Ga0070668_100071578 3300005347 Bacteria 2701
21 Ga0070668_100170579 3300005347 Bacteria 1771
22 Ga0070671_100006113 3300005355 Bacteria 9588
23 Ga0070659_100102818 3300005366 Bacteria 2300
24 Ga0070659_100326757 3300005366 Bacteria 1283
25 Ga0070663_100042049 3300005455 Bacteria 3209
26 Ga0070663_100231728 3300005455 Bacteria 1454
27 Ga0070678_100018726 3300005456 Bacteria 4494
28 Ga0070662_100028309 3300005457 Bacteria 3898
29 Ga0068867_100323376 3300005459 Bacteria 1279
30 Ga0070706_100016083 3300005467 Bacteria 6909
31 Ga0070707_100281195 3300005468 Bacteria 1617
32 Ga0070693_100097723 3300005547 Bacteria 1783
33 Ga0070665_100009582 3300005548 Bacteria 9794
34 Ga0070665_100110795 3300005548 Bacteria 2747
35 Ga0068854_100041801 3300005578 Bacteria 3241
36 Ga0068856_100049576 3300005614 Bacteria 4138
37 Ga0068852_100077513 3300005616 Bacteria 2938
38 Ga0068866_10254217 3300005718 Bacteria 1076
39 Ga0068851_10074827 3300005834 Bacteria 1759
40 Ga0068863_100016324 3300005841 Bacteria 7126
41 Ga0068858_100112999 3300005842 Bacteria 2536
42 Ga0068860_100158072 3300005843 Bacteria 2185
43 Ga0068860_100237666 3300005843 Bacteria 1772
44 Ga0068860_100260388 3300005843 Bacteria 1691
45 Ga0068862_100039727 3300005844 Bacteria 3997
46 Ga0081455_10000038 3300005937 Bacteria 135510
47 Ga0081455_10026140 3300005937 Bacteria 5377
48 Ga0081538_10009371 3300005981 Bacteria 8183
49 Ga0081539_10000638 3300005985 Bacteria 70891
50 Ga0081539_10000662 3300005985 Bacteria 69140
51 Ga0081539_10005250 3300005985 Bacteria 13369
52 Ga0070717_10172725 3300006028 Bacteria 1880
53 Ga0070717_10201604 3300006028 Bacteria 1743
54 Ga0070717_10235051 3300006028 Bacteria 1614
55 Ga0075428_100531455 3300006844 Bacteria 1258
56 Ga0075430_100283818 3300006846 Bacteria 1370
57 Ga0068865_100044657 3300006881 Bacteria 3034
58 Ga0111539_10069321 3300009094 Bacteria 4164
59 Ga0105245_10028743 3300009098 Bacteria 4906
60 Ga0105245_10277488 3300009098 Bacteria 1637
61 Ga0114129_10063055 3300009147 Bacteria 5177
62 Ga0114129_10116529 3300009147 Bacteria 3681
63 Ga0114129_10138948 3300009147 Bacteria 3331
64 Ga0114129_10421372 3300009147 Bacteria 1756
65 Ga0105243_10076491 3300009148 Bacteria 2720
66 Ga0105242_10322771 3300009176 Bacteria 1417
67 Ga0105237_10280493 3300009545 Bacteria 1669
68 Ga0105239_10109559 3300010375 Bacteria 3060
69 Ga0157372_10077605 3300013307 Bacteria 3752
70 Ga0157372_10209403 3300013307 Bacteria 2259
71 Ga0157372_10335548 3300013307 Bacteria 1761
72 Ga0157375_10411159 3300013308 Bacteria 1519
73 Ga0163163_10029822 3300014325 Bacteria 5249
74 Ga0157380_10368501 3300014326 Bacteria 1351
75 Ga0157380_10429673 3300014326 Bacteria 1262
76 Ga0157377_10010410 3300014745 Bacteria 4600
77 Ga0157377_10159498 3300014745 Bacteria 1401
78 Ga0157379_10127652 3300014968 Bacteria 2288
79 Ga0197907_10494129 3300020069 Bacteria 1997
80 Ga0206356_10057707 3300020070 Bacteria 1760
81 Ga0206350_10551504 3300020080 Bacteria 1114
82 Ga0207688_10007507 3300025901 Bacteria 5931
83 Ga0207688_10073523 3300025901 Bacteria 1943
84 Ga0207688_10112139 3300025901 Bacteria 1584
85 Ga0207643_10062554 3300025908 Bacteria 2127
86 Ga0207705_10301955 3300025909 Bacteria 1228
87 Ga0207684_10016064 3300025910 Bacteria 6429
88 Ga0207662_10011407 3300025918 Bacteria 4929
89 Ga0207657_10063702 3300025919 Bacteria 3150
90 Ga0207657_10293275 3300025919 Bacteria 1289
91 Ga0207652_10412859 3300025921 Bacteria 1218
92 Ga0207681_10059073 3300025923 Bacteria 2628
93 Ga0207687_10033501 3300025927 Bacteria 3485
94 Ga0207687_10091496 3300025927 Bacteria 2219
95 Ga0207700_10176290 3300025928 Bacteria 1787
96 Ga0207644_10001987 3300025931 Bacteria 13226
97 Ga0207706_10015469 3300025933 Bacteria 6893
98 Ga0207670_10317171 3300025936 Bacteria 1225
99 Ga0207689_10011762 3300025942 Bacteria 7500
100 Ga0207661_10161164 3300025944 Bacteria 1946
101 Ga0207712_10226488 3300025961 Bacteria 1498
102 Ga0207712_10281769 3300025961 Bacteria 1357
103 Ga0207712_10394120 3300025961 Bacteria 1162
104 Ga0207668_10004896 3300025972 Bacteria 7879
105 Ga0207640_10032496 3300025981 Bacteria 3236
106 Ga0207677_10091071 3300026023 Bacteria 2217
107 Ga0207677_10380326 3300026023 Bacteria 1191
108 Ga0207703_10134807 3300026035 Bacteria 2137
109 Ga0207639_10331189 3300026041 Bacteria 1355
110 Ga0207678_10003897 3300026067 Bacteria 13417
111 Ga0207678_10114348 3300026067 Bacteria 2302
112 Ga0207708_10132189 3300026075 Bacteria 1952
113 Ga0207641_10021944 3300026088 Bacteria 5250
114 Ga0207648_10021674 3300026089 Bacteria 5773
115 Ga0207648_10321019 3300026089 Bacteria 1392
116 Ga0207676_10044593 3300026095 Bacteria 3422
117 Ga0207674_10153227 3300026116 Bacteria 2261
118 Ga0207674_10449756 3300026116 Bacteria 1245
119 Ga0207675_100002582 3300026118 Bacteria 17941
120 Ga0207675_100011020 3300026118 Bacteria 8464
121 Ga0207683_10300724 3300026121 Bacteria 1468
122 Ga0207683_10356906 3300026121 Bacteria 1342
123 Ga0268266_10018810 3300028379 Bacteria 5887
124 Ga0268266_10030694 3300028379 Bacteria 4565
125 Ga0268266_10324621 3300028379 Bacteria 1441
126 Ga0268265_10251573 3300028380 Bacteria 1565
127 Ga0268264_10097638 3300028381 Bacteria 2547
128 Ga0268264_10112176 3300028381 Bacteria 2390
129 Ga0268264_10171438 3300028381 Bacteria 1963
130 Ga0268264_10355434 3300028381 Bacteria 1396
131 Ga0268264_10391763 3300028381 Bacteria 1333
132 Ga0268264_10455323 3300028381 Bacteria 1240
133 Ga0307408_100214372 3300031548 Bacteria 1567
134 Ga0307405_10098159 3300031731 Bacteria 1957
135 Ga0307413_10093796 3300031824 Bacteria 1963
136 Ga0307410_10006141 3300031852 Bacteria 6447
137 Ga0307410_10077711 3300031852 Bacteria 2321
138 Ga0326468_10003661 3300031889 Bacteria 1312
139 Ga0307406_10143677 3300031901 Bacteria 1693
140 Ga0307407_10042955 3300031903 Bacteria 2538
141 Ga0307407_10086095 3300031903 Bacteria 1914
142 Ga0307412_10110054 3300031911 Bacteria 1965
143 Ga0307409_100007075 3300031995 Bacteria 6678
144 Ga0307409_100020767 3300031995 Bacteria 4485
145 Ga0307409_100395715 3300031995 Bacteria 1318
146 Ga0307416_100039251 3300032002 Bacteria 3663
147 Ga0307414_10150201 3300032004 Bacteria 1837
148 Ga0307414_10330427 3300032004 Bacteria 1301
149 Ga0307415_100003093 3300032126 Bacteria 8408
150 Ga0307415_100019971 3300032126 Bacteria 4080
151 Ga0307415_100047757 3300032126 Bacteria 2883
152 Ga0307415_100202752 3300032126 Bacteria 1575
153 Ga0307415_100222606 3300032126 Bacteria 1514
154 Ga0373931_0050507 3300035691 Bacteria 2213
155 Ga0395899_0022802 3300037312 Bacteria 4743
156 Ga0395900_0049013 3300037418 Bacteria 4351
157 Ga0395900_0106938 3300037418 Bacteria 2874
158 Ga0395900_0133061 3300037418 Bacteria 2548
159 Ga0395898_0056737 3300037466 Bacteria 3817
160 Ga0395898_0098829 3300037466 Bacteria 2802
161 Ga0395898_0129902 3300037466 Bacteria 2413
162 Ga0395898_0229238 3300037466 Bacteria 1772
163 Ga0395898_0527603 3300037466 Bacteria 1122
164 Ga0395905_0223122 3300037471 Bacteria 1764
165 Ga0395901_0021729 3300038443 Bacteria 6575
166 Ga0395901_0042653 3300038443 Bacteria 4704
167 Ga0395901_0148281 3300038443 Bacteria 2465
168 Ga0395901_0188091 3300038443 Bacteria 2165
169 Ga0395901_0225296 3300038443 Bacteria 1959
170 Ga0436365_1506244 3300039437 Bacteria 3549
171 Ga0466965_0015133 3300044683 Bacteria 3662
172 Ga0466961_0039215 3300044693 Bacteria 3037
173 Ga0466963_0016160 3300044694 Bacteria 4638
174 Ga0466963_0022405 3300044694 Bacteria 4001
175 Ga0466963_0024451 3300044694 Bacteria 3847
176 Ga0466963_0069632 3300044694 Bacteria 2365
177 Ga0466963_0151151 3300044694 Bacteria 1612
178 Ga0466960_0000794 3300044901 Bacteria 11089
179 Ga0466960_0136340 3300044901 Bacteria 1300
180 Ga0466959_0130383 3300045049 Bacteria 1782
181 Ga0466959_0231168 3300045049 Bacteria 1280
182 Ga0466958_0104067 3300045836 Bacteria 1768
183 Ga0466958_0145029 3300045836 Bacteria 1496
184 Ga0466958_0159611 3300045836 Bacteria 1424
185 Ga0466958_0214603 3300045836 Bacteria 1227
186 Ga0466967_0015005 3300045976 Bacteria 6058
187 Ga0466967_0021554 3300045976 Bacteria 5239
188 Ga0466967_0029965 3300045976 Bacteria 4561
189 Ga0466967_0057430 3300045976 Bacteria 3436
190 Ga0466967_0222313 3300045976 Bacteria 1795
191 Ga0496100_0059229 3300048903 Bacteria 2516
192 Ga0496102_0049880 3300048905 Bacteria 3809
193 Ga0496102_0124313 3300048905 Bacteria 2411
194 Ga0496102_0233971 3300048905 Bacteria 1732
195 Ga0496104_0054088 3300048907 Bacteria 3794
196 Ga0496105_0001773 3300048908 Bacteria 15431
197 Ga0496106_0344551 3300048909 Bacteria 1197
198 Ga0496107_0029433 3300048910 Bacteria 3906
199 Ga0496108_0019705 3300048911 Bacteria 5540
200 Ga0496108_0199278 3300048911 Bacteria 1737
201 Ga0496108_0251509 3300048911 Bacteria 1537
202 Ga0496109_0001231 3300048912 Bacteria 21278
203 Ga0496109_0068311 3300048912 Bacteria 3258
204 Ga0496109_0248096 3300048912 Bacteria 1676
205 Ga0496109_0257980 3300048912 Bacteria 1642
206 Ga0496110_0009688 3300048913 Bacteria 7802
207 Ga0496111_0045489 3300048914 Bacteria 3158
208 Ga0496111_0098503 3300048914 Bacteria 2147
209 Ga0496112_0176577 3300048915 Bacteria 2101
210 Ga0496113_0216799 3300048916 Bacteria 1525
211 Ga0496114_0025693 3300048917 Bacteria 4815
212 Ga0496114_0094885 3300048917 Bacteria 2538
213 Ga0496114_0247158 3300048917 Bacteria 1569
214 Ga0496115_0117931 3300048918 Bacteria 2183
215 Ga0501034_0288344 3300049571 Bacteria 1580
216 Ga0501046_0181801 3300049580 Bacteria 1572
217 Ga0501047_0000083 3300049581 Bacteria 121172
218 Ga0501071_0202246 3300049587 Bacteria 1492
219 Ga0501072_0058682 3300049588 Bacteria 3033
220 Ga0501075_0017253 3300049591 Bacteria 5213
221 Ga0501077_0130806 3300049593 Bacteria 1591
222 Ga0501079_0029584 3300049741 Bacteria 4206
223 Ga0501079_0168629 3300049741 Bacteria 1707
224 Ga0501081_0027805 3300049743 Bacteria 3814
225 Ga0501045_0239301 3300049824 Bacteria 1351
226 nmdc:mga05p37_162580_c1 3300050507 Bacteria 2726
227 nmdc:mga05p37_317646_c1 3300050507 Bacteria 1844
228 nmdc:mga06r32_317346_c1 3300050510 Bacteria 1544
229 nmdc:mga08y16_226191_c1 3300050511 Bacteria 1936
230 nmdc:mga08y16_49733_c1 3300050511 Bacteria 4386
231 nmdc:mga0a205_218489_c1 3300050515 Bacteria 1792
232 Ga0501084_0029631 3300054114 Bacteria 4579
233 Ga0587088_002062 3300059508 Bacteria 2214
234 Ga0501082_0301408 3300060353 Bacteria 1396
235 Ga0530510_0024084 3300061734 Bacteria 4342

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037466 Ga0395898_0098829 Ga0395898_0098829_942_1841 298
2 3300038443 Ga0395901_0188091 Ga0395901_0188091_1022_1921 298
3 3300049741 Ga0501079_0168629 Ga0501079_0168629_655_1680 302
4 3300026116 Ga0207674_10153227 Ga0207674_101532272 305
5 3300009147 Ga0114129_10063055 Ga0114129_100630554 314
6 3300050507 nmdc:mga05p37_162580_c1 nmdc:mga05p37_162580_c1_954_1997 314
7 3300050515 nmdc:mga0a205_218489_c1 nmdc:mga0a205_218489_c1_22_1065 314
8 3300045836 Ga0466958_0214603 Ga0466958_0214603_106_1134 315
9 3300005347 Ga0070668_100170579 Ga0070668_1001705792 321
10 3300005455 Ga0070663_100231728 Ga0070663_1002317281 321
11 3300009147 Ga0114129_10116529 Ga0114129_101165292 321
12 3300026067 Ga0207678_10003897 Ga0207678_1000389710 321
13 3300026075 Ga0207708_10132189 Ga0207708_101321891 322
14 3300005338 Ga0068868_100220427 Ga0068868_1002204272 323
15 3300037466 Ga0395898_0129902 Ga0395898_0129902_98_1132 324
16 3300038443 Ga0395901_0148281 Ga0395901_0148281_167_1201 324
17 3300031889 Ga0326468_10003661 Ga0326468_100036612 326
18 3300005467 Ga0070706_100016083 Ga0070706_1000160838 329
19 3300025910 Ga0207684_10016064 Ga0207684_100160644 329
20 3300049580 Ga0501046_0181801 Ga0501046_0181801_205_1233 331
21 3300049587 Ga0501071_0202246 Ga0501071_0202246_221_1249 331
22 3300049588 Ga0501072_0058682 Ga0501072_0058682_297_1325 331
23 3300049591 Ga0501075_0017253 Ga0501075_0017253_2557_3585 331
24 3300049593 Ga0501077_0130806 Ga0501077_0130806_37_1065 331
25 3300049741 Ga0501079_0029584 Ga0501079_0029584_1920_2948 331
26 3300049743 Ga0501081_0027805 Ga0501081_0027805_2635_3663 331
27 3300049824 Ga0501045_0239301 Ga0501045_0239301_128_1156 331
28 3300054114 Ga0501084_0029631 Ga0501084_0029631_2013_3041 331
29 3300061734 Ga0530510_0024084 Ga0530510_0024084_1360_2388 331
30 3300005985 Ga0081539_10000638 Ga0081539_1000063877 332
31 3300005937 Ga0081455_10026140 Ga0081455_100261408 334
32 3300013308 Ga0157375_10411159 Ga0157375_104111592 335
33 3300035691 Ga0373931_0050507 Ga0373931_0050507_43_1056 335
34 iso_pu_bacteria 2558860112 2558906590 336
35 iso_pu_bacteria 2622736605 2623501850 336
36 iso_pu_bacteria 2816332139 2816506377 336
37 iso_pu_bacteria 2870782633 2870788138 336
38 3300003203 JGI25406J46586_10002261 JGI25406J46586_100022611 340
39 3300003373 JGI25407J50210_10009059 JGI25407J50210_100090593 340
40 3300003579 Ga0007429J51699_1025233 Ga0007429J51699_10252332 340
41 3300005329 Ga0070683_100178311 Ga0070683_1001783113 340
42 3300005334 Ga0068869_100045089 Ga0068869_1000450893 340
43 3300005337 Ga0070682_100035934 Ga0070682_1000359344 340
44 3300005339 Ga0070660_100054451 Ga0070660_1000544511 340
45 3300005345 Ga0070692_10076629 Ga0070692_100766292 340
46 3300005347 Ga0070668_100054805 Ga0070668_1000548052 340
47 3300005355 Ga0070671_100006113 Ga0070671_1000061136 340
48 3300005366 Ga0070659_100102818 Ga0070659_1001028182 340
49 3300005457 Ga0070662_100028309 Ga0070662_1000283094 340
50 3300005459 Ga0068867_100323376 Ga0068867_1003233761 340
51 3300005468 Ga0070707_100281195 Ga0070707_1002811952 340
52 3300005547 Ga0070693_100097723 Ga0070693_1000977232 340
53 3300005548 Ga0070665_100009582 Ga0070665_1000095828 340
54 3300005616 Ga0068852_100077513 Ga0068852_1000775133 340
55 3300005718 Ga0068866_10254217 Ga0068866_102542171 340
56 3300005834 Ga0068851_10074827 Ga0068851_100748272 340
57 3300005841 Ga0068863_100016324 Ga0068863_1000163245 340
58 3300005843 Ga0068860_100158072 Ga0068860_1001580722 340
59 3300005843 Ga0068860_100260388 Ga0068860_1002603882 340
60 3300005844 Ga0068862_100039727 Ga0068862_1000397275 340
61 3300005937 Ga0081455_10000038 Ga0081455_1000003822 340
62 3300005981 Ga0081538_10009371 Ga0081538_100093712 340
63 3300005985 Ga0081539_10000662 Ga0081539_1000066232 340
64 3300005985 Ga0081539_10005250 Ga0081539_1000525010 340
65 3300006028 Ga0070717_10172725 Ga0070717_101727252 340
66 3300006028 Ga0070717_10235051 Ga0070717_102350512 340
67 3300006844 Ga0075428_100531455 Ga0075428_1005314552 340
68 3300006846 Ga0075430_100283818 Ga0075430_1002838182 340
69 3300006881 Ga0068865_100044657 Ga0068865_1000446572 340
70 3300009147 Ga0114129_10138948 Ga0114129_101389483 340
71 3300009147 Ga0114129_10421372 Ga0114129_104213722 340
72 3300009148 Ga0105243_10076491 Ga0105243_100764912 340
73 3300013307 Ga0157372_10077605 Ga0157372_100776053 340
74 3300013307 Ga0157372_10335548 Ga0157372_103355483 340
75 3300014745 Ga0157377_10010410 Ga0157377_100104104 340
76 3300020069 Ga0197907_10494129 Ga0197907_104941291 340
77 3300020070 Ga0206356_10057707 Ga0206356_100577071 340
78 3300020080 Ga0206350_10551504 Ga0206350_105515041 340
79 3300025901 Ga0207688_10073523 Ga0207688_100735232 340
80 3300025901 Ga0207688_10112139 Ga0207688_101121391 340
81 3300025908 Ga0207643_10062554 Ga0207643_100625541 340
82 3300025909 Ga0207705_10301955 Ga0207705_103019552 340
83 3300025918 Ga0207662_10011407 Ga0207662_100114072 340
84 3300025919 Ga0207657_10063702 Ga0207657_100637022 340
85 3300025919 Ga0207657_10293275 Ga0207657_102932752 340
86 3300025921 Ga0207652_10412859 Ga0207652_104128591 340
87 3300025927 Ga0207687_10033501 Ga0207687_100335012 340
88 3300025928 Ga0207700_10176290 Ga0207700_101762902 340
89 3300025931 Ga0207644_10001987 Ga0207644_1000198711 340
90 3300025933 Ga0207706_10015469 Ga0207706_100154697 340
91 3300025961 Ga0207712_10226488 Ga0207712_102264882 340
92 3300025961 Ga0207712_10281769 Ga0207712_102817691 340
93 3300025961 Ga0207712_10394120 Ga0207712_103941201 340
94 3300025981 Ga0207640_10032496 Ga0207640_100324962 340
95 3300026023 Ga0207677_10091071 Ga0207677_100910711 340
96 3300026041 Ga0207639_10331189 Ga0207639_103311892 340
97 3300026067 Ga0207678_10114348 Ga0207678_101143482 340
98 3300026088 Ga0207641_10021944 Ga0207641_100219443 340
99 3300026089 Ga0207648_10021674 Ga0207648_100216746 340
100 3300026095 Ga0207676_10044593 Ga0207676_100445934 340
101 3300026118 Ga0207675_100011020 Ga0207675_1000110208 340
102 3300028379 Ga0268266_10018810 Ga0268266_100188103 340
103 3300028379 Ga0268266_10324621 Ga0268266_103246212 340
104 3300028380 Ga0268265_10251573 Ga0268265_102515732 340
105 3300028381 Ga0268264_10097638 Ga0268264_100976383 340
106 3300028381 Ga0268264_10112176 Ga0268264_101121762 340
107 3300028381 Ga0268264_10355434 Ga0268264_103554342 340
108 3300028381 Ga0268264_10391763 Ga0268264_103917632 340
109 3300028381 Ga0268264_10455323 Ga0268264_104553231 340
110 3300031548 Ga0307408_100214372 Ga0307408_1002143721 340
111 3300031731 Ga0307405_10098159 Ga0307405_100981592 340
112 3300031824 Ga0307413_10093796 Ga0307413_100937962 340
113 3300031852 Ga0307410_10006141 Ga0307410_100061413 340
114 3300031852 Ga0307410_10077711 Ga0307410_100777112 340
115 3300031901 Ga0307406_10143677 Ga0307406_101436772 340
116 3300031903 Ga0307407_10042955 Ga0307407_100429551 340
117 3300031903 Ga0307407_10086095 Ga0307407_100860952 340
118 3300031911 Ga0307412_10110054 Ga0307412_101100542 340
119 3300031995 Ga0307409_100007075 Ga0307409_1000070753 340
120 3300031995 Ga0307409_100020767 Ga0307409_1000207674 340
121 3300031995 Ga0307409_100395715 Ga0307409_1003957151 340
122 3300032002 Ga0307416_100039251 Ga0307416_1000392512 340
123 3300032004 Ga0307414_10150201 Ga0307414_101502012 340
124 3300032004 Ga0307414_10330427 Ga0307414_103304271 340
125 3300032126 Ga0307415_100003093 Ga0307415_1000030933 340
126 3300032126 Ga0307415_100019971 Ga0307415_1000199714 340
127 3300032126 Ga0307415_100047757 Ga0307415_1000477572 340
128 3300032126 Ga0307415_100202752 Ga0307415_1002027522 340
129 3300032126 Ga0307415_100222606 Ga0307415_1002226062 340
130 3300037312 Ga0395899_0022802 Ga0395899_0022802_2746_3771 340
131 3300037418 Ga0395900_0049013 Ga0395900_0049013_766_1848 340
132 3300037418 Ga0395900_0106938 Ga0395900_0106938_759_1784 340
133 3300037418 Ga0395900_0133061 Ga0395900_0133061_187_1212 340
134 3300037466 Ga0395898_0056737 Ga0395898_0056737_2091_3116 340
135 3300037466 Ga0395898_0229238 Ga0395898_0229238_84_1109 340
136 3300037466 Ga0395898_0527603 Ga0395898_0527603_14_1042 340
137 3300037471 Ga0395905_0223122 Ga0395905_0223122_604_1629 340
138 3300038443 Ga0395901_0021729 Ga0395901_0021729_1675_2703 340
139 3300038443 Ga0395901_0042653 Ga0395901_0042653_3571_4596 340
140 3300038443 Ga0395901_0225296 Ga0395901_0225296_720_1745 340
141 3300044683 Ga0466965_0015133 Ga0466965_0015133_299_1327 340
142 3300044693 Ga0466961_0039215 Ga0466961_0039215_377_1402 340
143 3300044694 Ga0466963_0016160 Ga0466963_0016160_3356_4384 340
144 3300044694 Ga0466963_0022405 Ga0466963_0022405_1120_2148 340
145 3300044694 Ga0466963_0024451 Ga0466963_0024451_1640_2665 340
146 3300044694 Ga0466963_0069632 Ga0466963_0069632_1164_2192 340
147 3300044694 Ga0466963_0151151 Ga0466963_0151151_388_1416 340
148 3300044901 Ga0466960_0000794 Ga0466960_0000794_5692_6720 340
149 3300044901 Ga0466960_0136340 Ga0466960_0136340_259_1284 340
150 3300045049 Ga0466959_0130383 Ga0466959_0130383_676_1704 340
151 3300045049 Ga0466959_0231168 Ga0466959_0231168_113_1138 340
152 3300045836 Ga0466958_0104067 Ga0466958_0104067_397_1425 340
153 3300045836 Ga0466958_0145029 Ga0466958_0145029_72_1100 340
154 3300045836 Ga0466958_0159611 Ga0466958_0159611_37_1065 340
155 3300045976 Ga0466967_0015005 Ga0466967_0015005_1983_3008 340
156 3300045976 Ga0466967_0021554 Ga0466967_0021554_2993_4021 340
157 3300045976 Ga0466967_0029965 Ga0466967_0029965_495_1523 340
158 3300045976 Ga0466967_0057430 Ga0466967_0057430_270_1298 340
159 3300045976 Ga0466967_0222313 Ga0466967_0222313_275_1300 340
160 3300048905 Ga0496102_0049880 Ga0496102_0049880_712_1740 340
161 3300048909 Ga0496106_0344551 Ga0496106_0344551_38_1069 340
162 3300048910 Ga0496107_0029433 Ga0496107_0029433_2723_3751 340
163 3300048911 Ga0496108_0251509 Ga0496108_0251509_476_1507 340
164 3300048912 Ga0496109_0257980 Ga0496109_0257980_471_1499 340
165 3300048914 Ga0496111_0098503 Ga0496111_0098503_710_1741 340
166 3300048917 Ga0496114_0025693 Ga0496114_0025693_1809_2837 340
167 3300048918 Ga0496115_0117931 Ga0496115_0117931_592_1620 340
168 3300049571 Ga0501034_0288344 Ga0501034_0288344_536_1564 340
169 3300050507 nmdc:mga05p37_317646_c1 nmdc:mga05p37_317646_c1_730_1758 340
170 3300050510 nmdc:mga06r32_317346_c1 nmdc:mga06r32_317346_c1_499_1527 340
171 3300050511 nmdc:mga08y16_226191_c1 nmdc:mga08y16_226191_c1_153_1184 340
172 3300059508 Ga0587088_002062 Ga0587088_002062_1129_2154 340
173 3300060353 Ga0501082_0301408 Ga0501082_0301408_325_1350 340
174 3300006028 Ga0070717_10201604 Ga0070717_102016042 343
175 3300009098 Ga0105245_10277488 Ga0105245_102774882 343
176 3300009176 Ga0105242_10322771 Ga0105242_103227712 343
177 3300014326 Ga0157380_10368501 Ga0157380_103685011 343
178 3300026121 Ga0207683_10300724 Ga0207683_103007242 343
179 3300048903 Ga0496100_0059229 Ga0496100_0059229_1245_2282 343
180 3300048905 Ga0496102_0124313 Ga0496102_0124313_322_1359 343
181 3300048907 Ga0496104_0054088 Ga0496104_0054088_976_2013 343
182 3300048908 Ga0496105_0001773 Ga0496105_0001773_1402_2439 343
183 3300048911 Ga0496108_0019705 Ga0496108_0019705_4142_5179 343
184 3300048912 Ga0496109_0001231 Ga0496109_0001231_19667_20704 343
185 3300048913 Ga0496110_0009688 Ga0496110_0009688_3034_4071 343
186 3300048914 Ga0496111_0045489 Ga0496111_0045489_840_1877 343
187 3300048915 Ga0496112_0176577 Ga0496112_0176577_542_1579 343
188 3300048917 Ga0496114_0247158 Ga0496114_0247158_472_1509 343
189 3300002073 JGI24745J21846_1001495 JGI24745J21846_10014952 349
190 3300005329 Ga0070683_100066234 Ga0070683_1000662343 349
191 3300005331 Ga0070670_100181785 Ga0070670_1001817852 349
192 3300005334 Ga0068869_100041150 Ga0068869_1000411502 349
193 3300005337 Ga0070682_100110119 Ga0070682_1001101192 349
194 3300005338 Ga0068868_100130245 Ga0068868_1001302452 349
195 3300005338 Ga0068868_100189677 Ga0068868_1001896772 349
196 3300005339 Ga0070660_100037497 Ga0070660_1000374972 349
197 3300005340 Ga0070689_100204785 Ga0070689_1002047851 349
198 3300005347 Ga0070668_100071578 Ga0070668_1000715782 349
199 3300005366 Ga0070659_100326757 Ga0070659_1003267572 349
200 3300005455 Ga0070663_100042049 Ga0070663_1000420492 349
201 3300005456 Ga0070678_100018726 Ga0070678_1000187262 349
202 3300005548 Ga0070665_100110795 Ga0070665_1001107952 349
203 3300005578 Ga0068854_100041801 Ga0068854_1000418012 349
204 3300005614 Ga0068856_100049576 Ga0068856_1000495763 349
205 3300005842 Ga0068858_100112999 Ga0068858_1001129992 349
206 3300005843 Ga0068860_100237666 Ga0068860_1002376662 349
207 3300009094 Ga0111539_10069321 Ga0111539_100693212 349
208 3300009098 Ga0105245_10028743 Ga0105245_100287433 349
209 3300009545 Ga0105237_10280493 Ga0105237_102804932 349
210 3300010375 Ga0105239_10109559 Ga0105239_101095592 349
211 3300013307 Ga0157372_10209403 Ga0157372_102094032 349
212 3300014325 Ga0163163_10029822 Ga0163163_100298223 349
213 3300014326 Ga0157380_10429673 Ga0157380_104296732 349
214 3300014745 Ga0157377_10159498 Ga0157377_101594982 349
215 3300014968 Ga0157379_10127652 Ga0157379_101276522 349
216 3300025901 Ga0207688_10007507 Ga0207688_100075073 349
217 3300025923 Ga0207681_10059073 Ga0207681_100590733 349
218 3300025927 Ga0207687_10091496 Ga0207687_100914962 349
219 3300025936 Ga0207670_10317171 Ga0207670_103171711 349
220 3300025942 Ga0207689_10011762 Ga0207689_100117626 349
221 3300025944 Ga0207661_10161164 Ga0207661_101611642 349
222 3300025972 Ga0207668_10004896 Ga0207668_100048962 349
223 3300026023 Ga0207677_10380326 Ga0207677_103803261 349
224 3300026035 Ga0207703_10134807 Ga0207703_101348072 349
225 3300026089 Ga0207648_10321019 Ga0207648_103210192 349
226 3300026116 Ga0207674_10449756 Ga0207674_104497562 349
227 3300026118 Ga0207675_100002582 Ga0207675_10000258214 349
228 3300026121 Ga0207683_10356906 Ga0207683_103569062 349
229 3300028379 Ga0268266_10030694 Ga0268266_100306943 349
230 3300028381 Ga0268264_10171438 Ga0268264_101714382 349
231 3300039437 Ga0436365_1506244 Ga0436365_1506244_1452_2501 349
232 3300048905 Ga0496102_0233971 Ga0496102_0233971_286_1335 349
233 3300048911 Ga0496108_0199278 Ga0496108_0199278_308_1357 349
234 3300048912 Ga0496109_0068311 Ga0496109_0068311_488_1543 349
235 3300048912 Ga0496109_0248096 Ga0496109_0248096_485_1534 349
236 3300048916 Ga0496113_0216799 Ga0496113_0216799_364_1413 349
237 3300048917 Ga0496114_0094885 Ga0496114_0094885_343_1398 349
238 3300049581 Ga0501047_0000083 Ga0501047_0000083_42892_43944 349
239 3300050511 nmdc:mga08y16_49733_c1 nmdc:mga08y16_49733_c1_1474_2523 349

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

43

157

0.95

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

198

325

0.92

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

231

358

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
1h2b-assembly1.cif.gz_B crystal structure of the alcohol dehydrogenase from the hyperthermophilic archaeon aeropyrum pernix at 1.65a resolution 0.9406 1 345
1h2b-assembly1.cif.gz_B crystal structure of the alcohol dehydrogenase from the hyperthermophilic archaeon aeropyrum pernix at 1.65a resolution 0.9379 1 345
1rjw-assembly1.cif.gz_C crystal structure of nad(+)-dependent alcohol dehydrogenase from bacillus stearothermophilus strain lld-r 0.93 1 348
1llu-assembly1.cif.gz_A the ternary complex of pseudomonas aeruginosa alcohol dehydrogenase with its coenzyme and weak substrate 0.9281 1 344
4z6k-assembly1.cif.gz_B alcohol dehydrogenase from the antarctic psychrophile moraxella sp. tae 123 0.9276 1 347
ID Description Score Start End Superfamily
1h2bB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.929 154 294 3.40.50.720
af_Q17334_17_340_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9248 9 336 3.90.180.10
1lluA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9213 152 294 3.40.50.720
af_I1KB52_2_137_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9171 17 146 3.90.180.10
af_Q17334_17_340_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9167 9 336 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A528BZ19-F1-model_v4 NAD(P)-dependent alcohol dehydrogenase 0.9725 131 345
AF-A0A848DDF5-F1-model_v4 alcohol dehydrogenase (EC 1.1.1.1) 0.9712 1 345 GO:0008270
GO:0016491
AF-A0A848DDF5-F1-model_v4 alcohol dehydrogenase (EC 1.1.1.1) 0.9684 1 345 GO:0008270
GO:0016491
AF-A0A528BZ19-F1-model_v4 NAD(P)-dependent alcohol dehydrogenase 0.9636 131 345
AF-A0A842KYC3-F1-model_v4 Alcohol dehydrogenase catalytic domain-containing protein 0.9348 41 345 GO:0004022
GO:0005737
GO:0008270

Feature Viewer

pLDDT pTM Quality
93.63 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map