F352008

General Info

Members Datasets Scaffolds Average Seq Length
239 144 478 367

Family's Representative Sequence

Representative Sequence 3300025914|Ga0207671_10178675|Ga0207671_101786752
Length 430
Sequence MTCLIYHKKKDLEIEVLNFVTSKFGSGNFLICWLLIPNHLSYFALKKINKIMKSISGVHIFLLSLVVVSFLSADVPFSNNHDKILHEPPAVKHYLYVAVPGIRDYLGYGGHGILVFDMDNNHRFVRRIATNGFHPDKTPSNVKGIAVSIPLNSIYISTIESLQRIDLSTDKLVWEKQFEGGCDRMSIAPDGKTMYLPSFEKNFWNVVDCATGNIITKIDINKRAHNTIYGHSGQKVYMADIASPWLYVADAKTNTITNKIGPFANFIRPFTINGKETLVYVNVDSLLGFEVGDLVSGKKLAHIEVQGWNMGPVRRHGNPSHGIGLSTDEKEIWLADGHNMRLHVFSAVAPYQQLTTIPLQDMPGWINFSIDGKYVYPSSGEVIDRKTRKIITRLEDEFHNYVESEKMLEIDFAGNKVVKAGDQFGIGGIR

Samples

Sample ID Description Type Environment
1 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
82 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
83 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
84 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
85 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
89 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
121 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
122 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
123 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
124 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
125 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
128 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
129 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
130 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
131 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
132 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
133 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
134 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
135 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
136 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
137 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
138 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
139 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
140 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
141 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
142 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
143 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
144 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.16
Metatranscriptomes 0
Isolates 0.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.11
Nodule 0
Rhizoplane 0
Rhizosphere 88.28
Stem 0
Stem Tuber 0
Unclassified 6.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207671_10178675 3300025914 Bacteria 1651
2 JGI24740J21852_10017619 3300001979 Bacteria 2549
3 JGI25162J39368_1000500 3300002737 Bacteria 29713
4 JGI25154J39366_1000227 3300002738 Bacteria 37673
5 JGI25165J46597_1001294 3300003214 Bacteria 14464
6 JGI25153J46596_10033434 3300003215 Unclassified 1697
7 rootH1_10055013 3300003316 Bacteria 9718
8 rootH2_10001891 3300003320 Bacteria 464318
9 rootH2_10066484 3300003320 Bacteria 3962
10 rootL2_10165511 3300003322 Bacteria 2468
11 rootH1_10015020 3300003323 Bacteria 15697
12 rootH1_10126988 3300003323 Bacteria 4958
13 JGI25160J50197_1017814 3300003354 Bacteria 2236
14 Ga0055526_1016267 3300003771 Bacteria 2923
15 Ga0055528_1002201 3300003790 Bacteria 10644
16 Ga0065165_1000259 3300005262 Bacteria 91800
17 Ga0065704_10180896 3300005289 Bacteria 1238
18 Ga0065712_10016526 3300005290 Bacteria 1847
19 Ga0070658_10033731 3300005327 Unclassified 4119
20 Ga0070683_100032752 3300005329 Bacteria 4736
21 Ga0070683_100243704 3300005329 Bacteria 1710
22 Ga0070683_100257206 3300005329 Bacteria 1661
23 Ga0070670_100031851 3300005331 Bacteria 4541
24 Ga0070670_100052949 3300005331 Bacteria 3486
25 Ga0070670_100161933 3300005331 Unclassified 1939
26 Ga0070670_100226424 3300005331 Bacteria 1627
27 Ga0068869_100024768 3300005334 Bacteria 4159
28 Ga0068869_100030380 3300005334 Unclassified 3793
29 Ga0070666_10013089 3300005335 Bacteria 5255
30 Ga0070666_10051405 3300005335 Bacteria 2775
31 Ga0070666_10134200 3300005335 Bacteria 1721
32 Ga0070666_10166707 3300005335 Bacteria 1541
33 Ga0070682_100014856 3300005337 Bacteria 4506
34 Ga0068868_100036518 3300005338 Bacteria 3804
35 Ga0068868_100173527 3300005338 Bacteria 1786
36 Ga0070660_100006403 3300005339 Bacteria 8160
37 Ga0070660_100137021 3300005339 Bacteria 1961
38 Ga0070660_100152951 3300005339 Bacteria 1856
39 Ga0070687_100024961 3300005343 Bacteria 2862
40 Ga0070661_100001392 3300005344 Bacteria 16910
41 Ga0070661_100009568 3300005344 Bacteria 6713
42 Ga0070661_100151878 3300005344 Unclassified 1751
43 Ga0070692_10068409 3300005345 Bacteria 1887
44 Ga0070669_100053388 3300005353 Bacteria 2958
45 Ga0070671_100012645 3300005355 Bacteria 6802
46 Ga0070671_100180546 3300005355 Unclassified 1787
47 Ga0070671_100234430 3300005355 Bacteria 1557
48 Ga0070671_100329925 3300005355 Bacteria 1300
49 Ga0070673_100014282 3300005364 Bacteria 5524
50 Ga0070673_100377883 3300005364 Bacteria 1263
51 Ga0070688_100009018 3300005365 Bacteria 5437
52 Ga0070667_100018120 3300005367 Bacteria 5838
53 Ga0070678_100015704 3300005456 Unclassified 4820
54 Ga0070678_100102896 3300005456 Bacteria 2217
55 Ga0070662_100090371 3300005457 Bacteria 2298
56 Ga0070698_100010513 3300005471 Bacteria 9867
57 Ga0070698_100017546 3300005471 Bacteria 7543
58 Ga0070699_100025940 3300005518 Bacteria 5054
59 Ga0070679_100004622 3300005530 Bacteria 12707
60 Ga0070679_100025462 3300005530 Bacteria 5806
61 Ga0070679_100064627 3300005530 Bacteria 3647
62 Ga0070684_100000895 3300005535 Bacteria 21094
63 Ga0070684_100011598 3300005535 Bacteria 7023
64 Ga0070684_100021987 3300005535 Bacteria 5315
65 Ga0068853_100002152 3300005539 Bacteria 14668
66 Ga0068853_100052254 3300005539 Bacteria 3520
67 Ga0068855_100000206 3300005563 Bacteria 75521
68 Ga0068855_100081708 3300005563 Bacteria 3745
69 Ga0068855_100124540 3300005563 Bacteria 2948
70 Ga0070664_100000574 3300005564 Bacteria 27973
71 Ga0070664_100019523 3300005564 Bacteria 5576
72 Ga0068857_100000415 3300005577 Bacteria 30162
73 Ga0068857_100119514 3300005577 Bacteria 2372
74 Ga0068854_100038472 3300005578 Bacteria 3365
75 Ga0068856_100003038 3300005614 Bacteria 17193
76 Ga0068856_100030893 3300005614 Bacteria 5238
77 Ga0070702_100003479 3300005615 Bacteria 7045
78 Ga0068852_100110616 3300005616 Bacteria 2497
79 Ga0068859_100077968 3300005617 Bacteria 3354
80 Ga0068864_100304985 3300005618 Bacteria 1492
81 Ga0068851_10110132 3300005834 Bacteria 1469
82 Ga0068860_100003042 3300005843 Bacteria 17317
83 Ga0068860_100005881 3300005843 Bacteria 12349
84 Ga0068860_100049815 3300005843 Bacteria 3988
85 Ga0081540_1002890 3300005983 Bacteria 13861
86 Ga0068871_100026539 3300006358 Bacteria 4521
87 Ga0075428_100038327 3300006844 Bacteria 5274
88 Ga0075430_100005946 3300006846 Bacteria 10306
89 Ga0075429_100002249 3300006880 Bacteria 16163
90 Ga0068865_100073633 3300006881 Bacteria 2429
91 Ga0097620_100077966 3300006931 Bacteria 3354
92 Ga0105240_10029701 3300009093 Bacteria 7114
93 Ga0105240_10079324 3300009093 Bacteria 4040
94 Ga0111539_10004855 3300009094 Bacteria 17516
95 Ga0111539_10048604 3300009094 Bacteria 5064
96 Ga0105241_10034465 3300009174 Bacteria 3803
97 Ga0105241_10066631 3300009174 Bacteria 2785
98 Ga0105241_10083779 3300009174 Bacteria 2502
99 Ga0105242_10147400 3300009176 Bacteria 2049
100 Ga0105237_10006690 3300009545 Bacteria 12737
101 Ga0105237_10008456 3300009545 Bacteria 11137
102 Ga0105237_10093158 3300009545 Bacteria 3002
103 Ga0105237_10342216 3300009545 Bacteria 1500
104 Ga0105237_10385806 3300009545 Unclassified 1406
105 Ga0105238_10059592 3300009551 Bacteria 3824
106 Ga0105249_10001569 3300009553 Bacteria 20057
107 Ga0105249_10006608 3300009553 Bacteria 10088
108 Ga0105249_10070383 3300009553 Bacteria 3229
109 Ga0105239_10000632 3300010375 Bacteria 50170
110 Ga0105239_10002197 3300010375 Bacteria 25096
111 Ga0105239_10135847 3300010375 Bacteria 2738
112 Ga0157373_10043649 3300013100 Unclassified 3202
113 Ga0157373_10123540 3300013100 Bacteria 1820
114 Ga0157371_10048708 3300013102 Bacteria 3012
115 Ga0157371_10065409 3300013102 Bacteria 2575
116 Ga0157370_10062500 3300013104 Bacteria 3531
117 Ga0157369_10004821 3300013105 Bacteria 15839
118 Ga0157369_10164265 3300013105 Bacteria 2342
119 Ga0157374_10001980 3300013296 Bacteria 17187
120 Ga0157374_10020982 3300013296 Bacteria 5804
121 Ga0157374_10023732 3300013296 Bacteria 5490
122 Ga0157374_10025583 3300013296 Bacteria 5301
123 Ga0157374_10177118 3300013296 Bacteria 2081
124 Ga0157374_10324620 3300013296 Unclassified 1526
125 Ga0157378_10100535 3300013297 Bacteria 2640
126 Ga0163162_10002372 3300013306 Bacteria 17704
127 Ga0163162_10030325 3300013306 Bacteria 5358
128 Ga0163162_10046235 3300013306 Bacteria 4362
129 Ga0163162_10090417 3300013306 Unclassified 3143
130 Ga0163162_10109952 3300013306 Bacteria 2853
131 Ga0157372_10003924 3300013307 Bacteria 15974
132 Ga0157372_10018030 3300013307 Bacteria 7588
133 Ga0157372_10018481 3300013307 Bacteria 7494
134 Ga0157375_10006568 3300013308 Bacteria 10125
135 Ga0157375_10024153 3300013308 Bacteria 5622
136 Ga0157375_10334440 3300013308 Bacteria 1680
137 Ga0157375_10513342 3300013308 Unclassified 1362
138 Ga0157375_10603333 3300013308 Bacteria 1257
139 Ga0163163_10001371 3300014325 Bacteria 20552
140 Ga0163163_10028707 3300014325 Bacteria 5346
141 Ga0157380_10136009 3300014326 Bacteria 2104
142 Ga0157380_10390591 3300014326 Bacteria 1316
143 Ga0157377_10009223 3300014745 Bacteria 4834
144 Ga0157377_10076183 3300014745 Bacteria 1950
145 Ga0157379_10149612 3300014968 Bacteria 2106
146 Ga0157376_10045271 3300014969 Bacteria 3621
147 Ga0207427_100146 3300025231 Bacteria 81506
148 Ga0209437_100096 3300025233 Bacteria 233558
149 Ga0209646_1000009 3300025246 Bacteria 652154
150 Ga0209026_1000188 3300025250 Bacteria 90347
151 Ga0209233_1000029 3300025261 Bacteria 641642
152 Ga0209673_1000016 3300025273 Bacteria 506202
153 Ga0209673_1000111 3300025273 Bacteria 180094
154 Ga0209676_1000686 3300025292 Bacteria 47720
155 Ga0209564_1001725 3300025295 Bacteria 20505
156 Ga0209564_1001936 3300025295 Bacteria 18486
157 Ga0209758_1002575 3300025297 Bacteria 18208
158 Ga0207426_1001723 3300025302 Bacteria 16741
159 Ga0207680_10020761 3300025903 Bacteria 3543
160 Ga0207680_10185714 3300025903 Bacteria 1409
161 Ga0207705_10000015 3300025909 Bacteria 382901
162 Ga0207695_10177479 3300025913 Bacteria 2052
163 Ga0207695_10345235 3300025913 Unclassified 1376
164 Ga0207671_10007227 3300025914 Bacteria 9669
165 Ga0207671_10025713 3300025914 Unclassified 4418
166 Ga0207671_10167094 3300025914 Bacteria 1706
167 Ga0207657_10004077 3300025919 Bacteria 15507
168 Ga0207657_10126856 3300025919 Bacteria 2095
169 Ga0207649_10001055 3300025920 Bacteria 16892
170 Ga0207652_10072707 3300025921 Bacteria 2990
171 Ga0207644_10051250 3300025931 Bacteria 2962
172 Ga0207644_10110695 3300025931 Bacteria 2076
173 Ga0207706_10017472 3300025933 Bacteria 6464
174 Ga0207706_10018021 3300025933 Bacteria 6353
175 Ga0207670_10050156 3300025936 Bacteria 2796
176 Ga0207689_10010521 3300025942 Bacteria 7966
177 Ga0207689_10010857 3300025942 Bacteria 7835
178 Ga0207689_10016290 3300025942 Bacteria 6296
179 Ga0207689_10044546 3300025942 Unclassified 3669
180 Ga0207689_10131087 3300025942 Bacteria 2063
181 Ga0207661_10001281 3300025944 Bacteria 16802
182 Ga0207661_10170114 3300025944 Bacteria 1896
183 Ga0207679_10000223 3300025945 Bacteria 44739
184 Ga0207679_10145142 3300025945 Bacteria 1924
185 Ga0207667_10000009 3300025949 Bacteria 603135
186 Ga0207667_10125210 3300025949 Bacteria 2647
187 Ga0207712_10010394 3300025961 Bacteria 5908
188 Ga0207712_10116698 3300025961 Bacteria 2012
189 Ga0207712_10127933 3300025961 Bacteria 1931
190 Ga0207668_10241452 3300025972 Bacteria 1462
191 Ga0207640_10067118 3300025981 Unclassified 2399
192 Ga0207677_10201661 3300026023 Bacteria 1582
193 Ga0207677_10225085 3300026023 Bacteria 1507
194 Ga0207639_10000831 3300026041 Bacteria 21014
195 Ga0207678_10063433 3300026067 Bacteria 3175
196 Ga0207708_10285943 3300026075 Bacteria 1337
197 Ga0207702_10024824 3300026078 Bacteria 4972
198 Ga0207648_10016096 3300026089 Bacteria 6850
199 Ga0207648_10394413 3300026089 Bacteria 1253
200 Ga0207676_10133033 3300026095 Bacteria 2118
201 Ga0207676_10255415 3300026095 Bacteria 1580
202 Ga0207674_10001466 3300026116 Bacteria 30487
203 Ga0207674_10110994 3300026116 Bacteria 2717
204 Ga0207675_100012344 3300026118 Bacteria 7980
205 Ga0207683_10008332 3300026121 Bacteria 8867
206 Ga0207683_10047034 3300026121 Bacteria 3778
207 Ga0207428_10029239 3300027907 Bacteria 4570
208 Ga0268265_10419768 3300028380 Bacteria 1242
209 Ga0268264_10002061 3300028381 Bacteria 17930
210 Ga0268264_10037521 3300028381 Bacteria 3995
211 Ga0268264_10325390 3300028381 Bacteria 1455
212 Ga0307414_10009353 3300032004 Bacteria 5624
213 Ga0307414_10083856 3300032004 Bacteria 2342
214 Ga0495616_0005607 3300046513 Bacteria 7681
215 Ga0495628_0078357 3300046516 Bacteria 2570
216 Ga0495649_0172253 3300046694 Bacteria 1132
217 Ga0501298_001308 3300049521 Bacteria 3646
218 Ga0501300_004553 3300049523 Bacteria 2051
219 Ga0501039_0064778 3300049575 Bacteria 2834
220 Ga0501047_0074505 3300049581 Bacteria 3268
221 Ga0501201_000196 3300049651 Bacteria 5300
222 Ga0501202_004547 3300049652 Bacteria 2429
223 Ga0501207_002082 3300049654 Bacteria 2555
224 Ga0501217_000055 3300049661 Bacteria 13339
225 Ga0501222_001637 3300049662 Bacteria 3112
226 Ga0501223_002138 3300049663 Bacteria 4430
227 Ga0501224_000290 3300049664 Bacteria 5799
228 Ga0501259_001977 3300049688 Bacteria 3388
229 Ga0501261_001206 3300049690 Bacteria 3174
230 Ga0501221_001796 3300049704 Bacteria 3581
231 Ga0501225_0001107 3300049705 Bacteria 8457
232 Ga0501245_004235 3300049708 Bacteria 1967
233 Ga0501044_0023233 3300049823 Bacteria 6598
234 nmdc:mga09592_7297_c1 3300050508 Bacteria 8983
235 nmdc:mga0qj67_58847_c1 3300050509 Bacteria 3047
236 nmdc:mga08y16_122808_c1 3300050511 Bacteria 2702
237 nmdc:mga08y16_7711_c1 3300050511 Bacteria 11270
238 2929924208 2929921140 Bacteria 8649150
239 8003156069 8003151029 Bacteria 8187759
240 Ga0207671_10178675
241 JGI24740J21852_10017619
242 JGI25162J39368_1000500
243 JGI25154J39366_1000227
244 JGI25165J46597_1001294
245 JGI25153J46596_10033434
246 rootH1_10055013
247 rootH2_10001891
248 rootH2_10066484
249 rootL2_10165511
250 rootH1_10015020
251 rootH1_10126988
252 JGI25160J50197_1017814
253 Ga0055526_1016267
254 Ga0055528_1002201
255 Ga0065165_1000259
256 Ga0065704_10180896
257 Ga0065712_10016526
258 Ga0070658_10033731
259 Ga0070683_100032752
260 Ga0070683_100243704
261 Ga0070683_100257206
262 Ga0070670_100031851
263 Ga0070670_100052949
264 Ga0070670_100161933
265 Ga0070670_100226424
266 Ga0068869_100024768
267 Ga0068869_100030380
268 Ga0070666_10013089
269 Ga0070666_10051405
270 Ga0070666_10134200
271 Ga0070666_10166707
272 Ga0070682_100014856
273 Ga0068868_100036518
274 Ga0068868_100173527
275 Ga0070660_100006403
276 Ga0070660_100137021
277 Ga0070660_100152951
278 Ga0070687_100024961
279 Ga0070661_100001392
280 Ga0070661_100009568
281 Ga0070661_100151878
282 Ga0070692_10068409
283 Ga0070669_100053388
284 Ga0070671_100012645
285 Ga0070671_100180546
286 Ga0070671_100234430
287 Ga0070671_100329925
288 Ga0070673_100014282
289 Ga0070673_100377883
290 Ga0070688_100009018
291 Ga0070667_100018120
292 Ga0070678_100015704
293 Ga0070678_100102896
294 Ga0070662_100090371
295 Ga0070698_100010513
296 Ga0070698_100017546
297 Ga0070699_100025940
298 Ga0070679_100004622
299 Ga0070679_100025462
300 Ga0070679_100064627
301 Ga0070684_100000895
302 Ga0070684_100011598
303 Ga0070684_100021987
304 Ga0068853_100002152
305 Ga0068853_100052254
306 Ga0068855_100000206
307 Ga0068855_100081708
308 Ga0068855_100124540
309 Ga0070664_100000574
310 Ga0070664_100019523
311 Ga0068857_100000415
312 Ga0068857_100119514
313 Ga0068854_100038472
314 Ga0068856_100003038
315 Ga0068856_100030893
316 Ga0070702_100003479
317 Ga0068852_100110616
318 Ga0068859_100077968
319 Ga0068864_100304985
320 Ga0068851_10110132
321 Ga0068860_100003042
322 Ga0068860_100005881
323 Ga0068860_100049815
324 Ga0081540_1002890
325 Ga0068871_100026539
326 Ga0075428_100038327
327 Ga0075430_100005946
328 Ga0075429_100002249
329 Ga0068865_100073633
330 Ga0097620_100077966
331 Ga0105240_10029701
332 Ga0105240_10079324
333 Ga0111539_10004855
334 Ga0111539_10048604
335 Ga0105241_10034465
336 Ga0105241_10066631
337 Ga0105241_10083779
338 Ga0105242_10147400
339 Ga0105237_10006690
340 Ga0105237_10008456
341 Ga0105237_10093158
342 Ga0105237_10342216
343 Ga0105237_10385806
344 Ga0105238_10059592
345 Ga0105249_10001569
346 Ga0105249_10006608
347 Ga0105249_10070383
348 Ga0105239_10000632
349 Ga0105239_10002197
350 Ga0105239_10135847
351 Ga0157373_10043649
352 Ga0157373_10123540
353 Ga0157371_10048708
354 Ga0157371_10065409
355 Ga0157370_10062500
356 Ga0157369_10004821
357 Ga0157369_10164265
358 Ga0157374_10001980
359 Ga0157374_10020982
360 Ga0157374_10023732
361 Ga0157374_10025583
362 Ga0157374_10177118
363 Ga0157374_10324620
364 Ga0157378_10100535
365 Ga0163162_10002372
366 Ga0163162_10030325
367 Ga0163162_10046235
368 Ga0163162_10090417
369 Ga0163162_10109952
370 Ga0157372_10003924
371 Ga0157372_10018030
372 Ga0157372_10018481
373 Ga0157375_10006568
374 Ga0157375_10024153
375 Ga0157375_10334440
376 Ga0157375_10513342
377 Ga0157375_10603333
378 Ga0163163_10001371
379 Ga0163163_10028707
380 Ga0157380_10136009
381 Ga0157380_10390591
382 Ga0157377_10009223
383 Ga0157377_10076183
384 Ga0157379_10149612
385 Ga0157376_10045271
386 Ga0207427_100146
387 Ga0209437_100096
388 Ga0209646_1000009
389 Ga0209026_1000188
390 Ga0209233_1000029
391 Ga0209673_1000016
392 Ga0209673_1000111
393 Ga0209676_1000686
394 Ga0209564_1001725
395 Ga0209564_1001936
396 Ga0209758_1002575
397 Ga0207426_1001723
398 Ga0207680_10020761
399 Ga0207680_10185714
400 Ga0207705_10000015
401 Ga0207695_10177479
402 Ga0207695_10345235
403 Ga0207671_10007227
404 Ga0207671_10025713
405 Ga0207671_10167094
406 Ga0207657_10004077
407 Ga0207657_10126856
408 Ga0207649_10001055
409 Ga0207652_10072707
410 Ga0207644_10051250
411 Ga0207644_10110695
412 Ga0207706_10017472
413 Ga0207706_10018021
414 Ga0207670_10050156
415 Ga0207689_10010521
416 Ga0207689_10010857
417 Ga0207689_10016290
418 Ga0207689_10044546
419 Ga0207689_10131087
420 Ga0207661_10001281
421 Ga0207661_10170114
422 Ga0207679_10000223
423 Ga0207679_10145142
424 Ga0207667_10000009
425 Ga0207667_10125210
426 Ga0207712_10010394
427 Ga0207712_10116698
428 Ga0207712_10127933
429 Ga0207668_10241452
430 Ga0207640_10067118
431 Ga0207677_10201661
432 Ga0207677_10225085
433 Ga0207639_10000831
434 Ga0207678_10063433
435 Ga0207708_10285943
436 Ga0207702_10024824
437 Ga0207648_10016096
438 Ga0207648_10394413
439 Ga0207676_10133033
440 Ga0207676_10255415
441 Ga0207674_10001466
442 Ga0207674_10110994
443 Ga0207675_100012344
444 Ga0207683_10008332
445 Ga0207683_10047034
446 Ga0207428_10029239
447 Ga0268265_10419768
448 Ga0268264_10002061
449 Ga0268264_10037521
450 Ga0268264_10325390
451 Ga0307414_10009353
452 Ga0307414_10083856
453 Ga0495616_0005607
454 Ga0495628_0078357
455 Ga0495649_0172253
456 Ga0501298_001308
457 Ga0501300_004553
458 Ga0501039_0064778
459 Ga0501047_0074505
460 Ga0501201_000196
461 Ga0501202_004547
462 Ga0501207_002082
463 Ga0501217_000055
464 Ga0501222_001637
465 Ga0501223_002138
466 Ga0501224_000290
467 Ga0501259_001977
468 Ga0501261_001206
469 Ga0501221_001796
470 Ga0501225_0001107
471 Ga0501245_004235
472 Ga0501044_0023233
473 nmdc:mga09592_7297_c1
474 nmdc:mga0qj67_58847_c1
475 nmdc:mga08y16_122808_c1
476 nmdc:mga08y16_7711_c1
477 2929924208
478 8003156069

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ld4-assembly1.cif.gz_B cryo-em structure of the human adenosine a1 receptor-gi2-protein complex bound to its endogenous agonist 0.8918 51 316
7n61-assembly1.cif.gz_0D structure of c2 projections and mips 0.8911 33 316
7som-assembly1.cif.gz_S ciliary c2 central pair apparatus isolated from chlamydomonas reinhardtii 0.8882 33 316
8itf-assembly1.cif.gz_B cryo-em structure of the dmcha-bound mtaar9-gs complex 0.8854 51 316
5yzv-assembly1.cif.gz_D biophysical and structural characterization of the thermostable wd40 domain of a prokaryotic protein, thermomonospora curvata pkwa 0.8818 34 316
ID Description Score Start End Superfamily
af_Q79FU0_283_386_2.40.10.500 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.9141 124 198 2.40.10.500
af_Q9Y6I7_166_305_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9031 81 200 2.130.10.10
af_I1L7B7_441_568_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8913 76 177 2.130.10.10
af_A2CEH0_185_321_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8902 79 177 2.130.10.10
af_Q9HBG6_2_117_2.110.10.10 Mainly Beta;4 Propeller;Hemopexin;Hemopexin-like domain 0.8901 113 228 2.110.10.10
ID Description Score Start End GO Terms
AF-A0A845SQ21-F1-model_v4 DUF305 domain-containing protein 0.9411 124 198
AF-A0A4Q6B5M2-F1-model_v4 YncE family protein 0.938 121 198
AF-A0A2V9NVJ1-F1-model_v4 YncE family protein 0.9352 124 198
AF-A0A7D5N8A4-F1-model_v4 YncE family protein 0.9274 132 198
AF-A0A377RPZ3-F1-model_v4 3-carboxymuconate cyclase 0.9244 79 198

Map