F351938

General Info

Members Datasets Scaffolds Average Seq Length
239 182 237 385

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10054772|Ga0157374_100547722
Length 425
Sequence MLNSSRKSPRVEITKQHDIGRIAIELMPNDLQIPIASKDGSKRFAARLALFYGTTFGTMGTHLPFFTIWLKAVGIDASWIGIISAVPALTRFTVLPFVTSAAEKHYSLRGALTVTALATALGFALIGTQHLPLAVLLAYAATCSLWTPMVPLTDAYALRGVARYGLNYGPLRLWGSAAFVVGALICGLLVDIIAARHLIWVIASVAALGAFASLGLQPLDRPKPAATSVQGGSHLLRDRGFLAIILAAALIQGSHAAYYTFASITWQASGLGGLTIAGLWVLGVLAEIVVFALSPRFTLAPALLVVIGGLSAVARWLITAQEPSVAVLSVVQLAHGLTYGLTQVGTMGLLVRHVPIHAMARGQGYLAACGGIVTSTASILSGIVYAGYGQGVYYLMAAMALIAAILMWFSRKRLAHQPHSAASGG

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2643221651 Afipia sp. Root123D2 Isolate Unclassified
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
59 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
84 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
85 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
86 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
87 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
88 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
89 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
90 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
91 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
92 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
93 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
94 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
95 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
96 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
97 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
98 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
99 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
100 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
101 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
102 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
103 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
104 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
105 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
106 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
107 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
108 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
109 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
110 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
111 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
112 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
113 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
114 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
115 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
116 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
117 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
118 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
119 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
120 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
121 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
122 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
123 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
124 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
125 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
126 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
127 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
128 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
129 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
130 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
131 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
132 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
133 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
136 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
142 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
143 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
144 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
145 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
146 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
158 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
159 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
160 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
161 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
162 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
163 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
164 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
165 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
166 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
167 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
171 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
172 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
173 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
174 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
175 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
176 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
177 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
178 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
179 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
180 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
181 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
182 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.16
Metatranscriptomes 0
Isolates 0.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.18
Nodule 0.42
Rhizoplane 8.37
Rhizosphere 80.75
Stem 0
Stem Tuber 0
Unclassified 6.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000014 3300003203 Bacteria 93855
2 JGI25406J46586_10014118 3300003203 Bacteria 3404
3 rootH2_10057491 3300003320 Bacteria 2353
4 rootL2_10122219 3300003322 Bacteria 2337
5 rootL2_10189409 3300003322 Bacteria 1497
6 rootH1_10039143 3300003323 Bacteria 2499
7 JGI25404J52841_10006345 3300003659 Bacteria 2471
8 Ga0070658_10138148 3300005327 Bacteria 2034
9 Ga0070683_100121866 3300005329 Bacteria 2464
10 Ga0068869_100063994 3300005334 Bacteria 2704
11 Ga0070680_100010118 3300005336 Bacteria 7272
12 Ga0070680_100080982 3300005336 Bacteria 2678
13 Ga0070689_100038231 3300005340 Bacteria 3671
14 Ga0070661_100080720 3300005344 Bacteria 2401
15 Ga0070668_100159115 3300005347 Bacteria 1831
16 Ga0070669_100172580 3300005353 Bacteria 1687
17 Ga0070674_100046026 3300005356 Bacteria 2983
18 Ga0070667_100059315 3300005367 Bacteria 3237
19 Ga0070709_10001792 3300005434 Bacteria 11670
20 Ga0070714_100006488 3300005435 Bacteria 9040
21 Ga0070713_100004478 3300005436 Bacteria 9391
22 Ga0070713_100176244 3300005436 Bacteria 1919
23 Ga0070710_10027408 3300005437 Bacteria 3037
24 Ga0070663_100064886 3300005455 Bacteria 2640
25 Ga0070663_100178742 3300005455 Bacteria 1644
26 Ga0070678_100013836 3300005456 Bacteria 5071
27 Ga0070662_100039822 3300005457 Bacteria 3344
28 Ga0070681_10024825 3300005458 Bacteria 6030
29 Ga0070698_100145585 3300005471 Bacteria 2319
30 Ga0070679_100087296 3300005530 Bacteria 3106
31 Ga0070684_100089805 3300005535 Bacteria 2731
32 Ga0068853_100005066 3300005539 Bacteria 10280
33 Ga0070672_100183277 3300005543 Bacteria 1745
34 Ga0070665_100044886 3300005548 Bacteria 4437
35 Ga0068855_100025511 3300005563 Bacteria 7071
36 Ga0068857_100045789 3300005577 Bacteria 3881
37 Ga0068854_100033569 3300005578 Bacteria 3578
38 Ga0081455_10004709 3300005937 Bacteria 15165
39 Ga0081455_10103588 3300005937 Bacteria 2279
40 Ga0081540_1012545 3300005983 Bacteria 5569
41 Ga0081540_1012774 3300005983 Bacteria 5499
42 Ga0081540_1023561 3300005983 Bacteria 3596
43 Ga0081540_1034782 3300005983 Bacteria 2711
44 Ga0081540_1043466 3300005983 Bacteria 2305
45 Ga0081539_10000008 3300005985 Bacteria 525071
46 Ga0081539_10000864 3300005985 Bacteria 58047
47 Ga0081539_10016895 3300005985 Bacteria 5172
48 Ga0070717_10021454 3300006028 Bacteria 5089
49 Ga0070715_10002558 3300006163 Bacteria 5607
50 Ga0070716_100028019 3300006173 Bacteria 3032
51 Ga0070712_100029515 3300006175 Bacteria 3677
52 Ga0097621_100142996 3300006237 Bacteria 2045
53 Ga0075434_100123648 3300006871 Bacteria 2604
54 Ga0068865_100080327 3300006881 Bacteria 2338
55 Ga0075436_100103694 3300006914 Bacteria 1982
56 Ga0105240_10056764 3300009093 Bacteria 4897
57 Ga0105237_10034276 3300009545 Bacteria 5141
58 Ga0105237_10066738 3300009545 Bacteria 3592
59 Ga0105238_10003423 3300009551 Bacteria 15820
60 Ga0157369_10009343 3300013105 Bacteria 11215
61 Ga0157374_10054772 3300013296 Bacteria 3721
62 Ga0157378_10194378 3300013297 Bacteria 1916
63 Ga0163162_10134076 3300013306 Bacteria 2587
64 Ga0163162_10288722 3300013306 Bacteria 1772
65 Ga0157375_10016545 3300013308 Bacteria 6630
66 Ga0157375_10070176 3300013308 Bacteria 3513
67 Ga0163163_10019481 3300014325 Bacteria 6373
68 Ga0163163_10059012 3300014325 Bacteria 3794
69 Ga0157377_10053748 3300014745 Bacteria 2278
70 Ga0157379_10102570 3300014968 Bacteria 2568
71 Ga0157376_10035015 3300014969 Bacteria 4058
72 Ga0209758_1019261 3300025297 Bacteria 3299
73 Ga0207692_10006426 3300025898 Bacteria 4762
74 Ga0207699_10002589 3300025906 Bacteria 8532
75 Ga0207707_10001221 3300025912 Bacteria 24149
76 Ga0207693_10000587 3300025915 Bacteria 32588
77 Ga0207663_10000147 3300025916 Bacteria 32518
78 Ga0207657_10001936 3300025919 Bacteria 22360
79 Ga0207652_10003582 3300025921 Bacteria 12811
80 Ga0207687_10263561 3300025927 Bacteria 1375
81 Ga0207700_10031510 3300025928 Bacteria 3768
82 Ga0207664_10031218 3300025929 Bacteria 4074
83 Ga0207644_10034545 3300025931 Bacteria 3539
84 Ga0207704_10086384 3300025938 Bacteria 2045
85 Ga0207665_10000559 3300025939 Bacteria 25048
86 Ga0207691_10075061 3300025940 Bacteria 3049
87 Ga0207679_10013580 3300025945 Bacteria 5338
88 Ga0207667_10039707 3300025949 Bacteria 5014
89 Ga0207639_10015926 3300026041 Bacteria 5309
90 Ga0207678_10004323 3300026067 Bacteria 12751
91 Ga0207648_10026505 3300026089 Bacteria 5149
92 Ga0207676_10158006 3300026095 Bacteria 1961
93 Ga0207674_10002416 3300026116 Bacteria 23583
94 Ga0207683_10007596 3300026121 Bacteria 9285
95 Ga0207683_10023207 3300026121 Bacteria 5333
96 Ga0207698_10042992 3300026142 Bacteria 3382
97 Ga0268266_10194902 3300028379 Bacteria 1851
98 Ga0265332_10069396 3300031238 Bacteria 1502
99 Ga0265331_10055551 3300031250 Bacteria 1883
100 Ga0307513_10176135 3300031456 Bacteria 2009
101 Ga0307508_10086404 3300031616 Bacteria 2720
102 Ga0265314_10007272 3300031711 Bacteria 9620
103 Ga0307516_10008676 3300031730 Bacteria 11442
104 Ga0307516_10202209 3300031730 Bacteria 1705
105 Ga0373953_0008571 3300035117 Bacteria 3478
106 Ga0373954_0009290 3300035118 Bacteria 4326
107 Ga0373954_0107431 3300035118 Bacteria 1348
108 Ga0373957_0007583 3300035120 Bacteria 3477
109 Ga0373946_0028970 3300035171 Bacteria 2200
110 Ga0373955_0013811 3300035172 Bacteria 3917
111 Ga0373955_0021212 3300035172 Bacteria 3275
112 Ga0373924_0082229 3300035410 Bacteria 1371
113 Ga0373935_0068732 3300035692 Bacteria 2280
114 Ga0373927_0026366 3300035695 Bacteria 3798
115 Ga0373927_0050223 3300035695 Bacteria 2696
116 Ga0373933_0000159 3300035724 Bacteria 43953
117 Ga0373933_0012605 3300035724 Bacteria 4671
118 Ga0373947_0015845 3300035725 Bacteria 4330
119 Ga0373937_0011826 3300036401 Bacteria 7664
120 Ga0373937_0050728 3300036401 Bacteria 3801
121 Ga0373937_0097179 3300036401 Bacteria 2731
122 Ga0495592_0019981 3300046454 Bacteria 5092
123 Ga0495603_0092165 3300046455 Bacteria 1771
124 Ga0495651_0011190 3300046462 Bacteria 6896
125 Ga0495651_0050238 3300046462 Bacteria 3217
126 Ga0495651_0108622 3300046462 Bacteria 2054
127 Ga0495653_0005796 3300046463 Bacteria 10104
128 Ga0495653_0021893 3300046463 Bacteria 5175
129 Ga0495664_0029250 3300046477 Bacteria 3221
130 Ga0495585_0113659 3300046492 Bacteria 1438
131 Ga0495606_0003130 3300046507 Bacteria 17951
132 Ga0495608_0009095 3300046511 Bacteria 6944
133 Ga0495608_0060506 3300046511 Bacteria 2492
134 Ga0495628_0020126 3300046516 Bacteria 5507
135 Ga0495628_0022235 3300046516 Bacteria 5211
136 Ga0495648_0001376 3300046524 Bacteria 23940
137 Ga0495648_0005337 3300046524 Bacteria 10711
138 Ga0495652_0024177 3300046529 Bacteria 5378
139 Ga0495652_0084640 3300046529 Bacteria 2607
140 Ga0495640_0024406 3300046533 Bacteria 4399
141 Ga0495587_0027287 3300046536 Bacteria 3478
142 Ga0495587_0065341 3300046536 Bacteria 2124
143 Ga0495598_0021809 3300046537 Bacteria 1707
144 Ga0495667_0002613 3300046559 Bacteria 12030
145 Ga0495667_0031351 3300046559 Bacteria 3568
146 Ga0495668_0064585 3300046616 Bacteria 2015
147 Ga0495634_0006378 3300046642 Bacteria 8969
148 Ga0495634_0080202 3300046642 Bacteria 2136
149 Ga0495635_0030634 3300046663 Bacteria 3737
150 Ga0495657_0044554 3300046675 Bacteria 3017
151 Ga0495657_0048270 3300046675 Bacteria 2873
152 Ga0495599_0021063 3300046678 Bacteria 4064
153 Ga0495599_0030700 3300046678 Bacteria 3373
154 Ga0495623_0025334 3300046679 Bacteria 3820
155 Ga0495646_0042644 3300046680 Bacteria 2783
156 Ga0495613_0036818 3300046689 Bacteria 3629
157 Ga0495624_0142891 3300046690 Bacteria 1465
158 Ga0495600_0043818 3300046809 Bacteria 2918
159 Ga0495581_0064847 3300047315 Bacteria 2111
160 Ga0495674_0037529 3300047319 Bacteria 4354
161 Ga0495680_0012474 3300047322 Bacteria 7477
162 Ga0495680_0013482 3300047322 Bacteria 7130
163 Ga0495675_0007964 3300047444 Bacteria 6552
164 Ga0495675_0066026 3300047444 Bacteria 2287
165 Ga0495684_0001515 3300047471 Bacteria 18612
166 Ga0495684_0109554 3300047471 Bacteria 2085
167 Ga0495593_0006218 3300047673 Bacteria 7022
168 Ga0495602_0029241 3300048088 Bacteria 5253
169 Ga0496101_0232092 3300048904 Bacteria 1435
170 Ga0496102_0001934 3300048905 Bacteria 17831
171 Ga0496102_0157124 3300048905 Bacteria 2138
172 Ga0496104_0005334 3300048907 Bacteria 11246
173 Ga0496104_0011605 3300048907 Bacteria 7898
174 Ga0496105_0003235 3300048908 Bacteria 12003
175 Ga0496105_0136852 3300048908 Bacteria 2018
176 Ga0496106_0011466 3300048909 Bacteria 6555
177 Ga0496106_0102326 3300048909 Bacteria 2222
178 Ga0496108_0003939 3300048911 Bacteria 11918
179 Ga0496108_0056416 3300048911 Bacteria 3300
180 Ga0496109_0064930 3300048912 Bacteria 3341
181 Ga0496110_0012027 3300048913 Bacteria 7111
182 Ga0496110_0033917 3300048913 Bacteria 4418
183 Ga0496110_0057124 3300048913 Bacteria 3435
184 Ga0496112_0000008 3300048915 Bacteria 310323
185 Ga0496112_0008127 3300048915 Bacteria 9374
186 Ga0496112_0015924 3300048915 Bacteria 7027
187 Ga0496112_0060088 3300048915 Bacteria 3745
188 Ga0496115_0000997 3300048918 Bacteria 20521
189 Ga0496117_0021692 3300048920 Bacteria 5184
190 Ga0496118_0016341 3300048921 Bacteria 6813
191 Ga0496121_0001934 3300048924 Bacteria 33033
192 Ga0496121_0013137 3300048924 Bacteria 8932
193 Ga0496126_0025442 3300048929 Bacteria 5694
194 Ga0496126_0119049 3300048929 Bacteria 2292
195 Ga0501031_0000296 3300049568 Bacteria 28394
196 Ga0501032_0000244 3300049569 Bacteria 45114
197 Ga0501033_0001015 3300049570 Bacteria 25486
198 Ga0501034_0001010 3300049571 Bacteria 40327
199 Ga0501036_0000405 3300049572 Bacteria 30399
200 Ga0501036_0197431 3300049572 Bacteria 1693
201 Ga0501037_0000139 3300049573 Bacteria 67890
202 Ga0501038_0000404 3300049574 Bacteria 37454
203 Ga0501038_0235199 3300049574 Bacteria 1456
204 Ga0501039_0000323 3300049575 Bacteria 34020
205 Ga0501043_0000021 3300049579 Bacteria 155025
206 Ga0501047_0000041 3300049581 Bacteria 184355
207 Ga0501047_0138241 3300049581 Bacteria 2315
208 Ga0501048_0000077 3300049582 Bacteria 51021
209 Ga0501067_0000775 3300049583 Bacteria 17180
210 Ga0501067_0023393 3300049583 Bacteria 3424
211 Ga0501068_0031588 3300049584 Bacteria 3145
212 Ga0501069_0000444 3300049585 Bacteria 18810
213 Ga0501070_0002561 3300049586 Bacteria 15914
214 Ga0501072_0008749 3300049588 Bacteria 7684
215 Ga0501073_0001489 3300049589 Bacteria 17352
216 Ga0501074_0001762 3300049590 Bacteria 14778
217 Ga0501079_0002042 3300049741 Bacteria 14462
218 Ga0501080_0001580 3300049742 Bacteria 19294
219 Ga0501083_0000708 3300049744 Bacteria 21721
220 Ga0501035_0000090 3300049822 Bacteria 112445
221 Ga0501044_0000054 3300049823 Bacteria 141399
222 nmdc:mga0n895_314820_c1 3300050512 Bacteria 1586
223 Ga0495612_0018483 3300053078 Bacteria 2791
224 Ga0495595_0016517 3300053084 Bacteria 3159
225 Ga0495595_0070783 3300053084 Bacteria 1648
226 Ga0495619_0002811 3300053085 Bacteria 11339
227 Ga0500647_0039030 3300053091 Bacteria 2275
228 Ga0500595_000204 3300053119 Bacteria 40538
229 Ga0500595_005423 3300053119 Bacteria 5567
230 Ga0500559_0116707 3300053136 Bacteria 1239
231 Ga0500619_035884 3300053154 Bacteria 1541
232 Ga0500638_003336 3300053162 Bacteria 5923
233 Ga0500636_0003542 3300053177 Bacteria 8790
234 Ga0500637_0000404 3300053178 Bacteria 16483
235 Ga0501084_0005052 3300054114 Bacteria 10794
236 Ga0500661_000157 3300055283 Bacteria 11713
237 Ga0501082_0001981 3300060353 Bacteria 18015

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048088 Ga0495602_0029241 Ga0495602_0029241_4168_5229 292
2 3300035410 Ga0373924_0082229 Ga0373924_0082229_177_1307 315
3 3300035118 Ga0373954_0107431 Ga0373954_0107431_135_1334 338
4 3300035120 Ga0373957_0007583 Ga0373957_0007583_1538_2737 338
5 3300035172 Ga0373955_0021212 Ga0373955_0021212_1173_2372 338
6 3300035692 Ga0373935_0068732 Ga0373935_0068732_892_2091 338
7 3300036401 Ga0373937_0097179 Ga0373937_0097179_1024_2223 338
8 3300046462 Ga0495651_0108622 Ga0495651_0108622_621_1820 338
9 3300046477 Ga0495664_0029250 Ga0495664_0029250_1693_2892 338
10 3300046511 Ga0495608_0060506 Ga0495608_0060506_970_2169 338
11 3300046516 Ga0495628_0022235 Ga0495628_0022235_136_1335 338
12 3300046529 Ga0495652_0084640 Ga0495652_0084640_707_1906 338
13 3300046536 Ga0495587_0027287 Ga0495587_0027287_284_1483 338
14 3300046559 Ga0495667_0031351 Ga0495667_0031351_832_2031 338
15 3300046642 Ga0495634_0080202 Ga0495634_0080202_924_2123 338
16 3300046675 Ga0495657_0048270 Ga0495657_0048270_1390_2589 338
17 3300046809 Ga0495600_0043818 Ga0495600_0043818_819_2018 338
18 3300047319 Ga0495674_0037529 Ga0495674_0037529_494_1693 338
19 3300047322 Ga0495680_0012474 Ga0495680_0012474_360_1559 338
20 3300047444 Ga0495675_0007964 Ga0495675_0007964_5194_6393 338
21 3300047471 Ga0495684_0109554 Ga0495684_0109554_836_2035 338
22 3300053078 Ga0495612_0018483 Ga0495612_0018483_548_1747 338
23 3300053084 Ga0495595_0016517 Ga0495595_0016517_1538_2737 338
24 3300046463 Ga0495653_0005796 Ga0495653_0005796_363_1562 359
25 3300046680 Ga0495646_0042644 Ga0495646_0042644_772_1971 359
26 3300046678 Ga0495599_0030700 Ga0495599_0030700_2004_3203 363
27 3300049568 Ga0501031_0000296 Ga0501031_0000296_7832_9049 365
28 3300049569 Ga0501032_0000244 Ga0501032_0000244_32051_33268 365
29 3300049570 Ga0501033_0001015 Ga0501033_0001015_10967_12184 365
30 3300049571 Ga0501034_0001010 Ga0501034_0001010_15395_16612 365
31 3300049572 Ga0501036_0000405 Ga0501036_0000405_15752_16969 365
32 3300049573 Ga0501037_0000139 Ga0501037_0000139_35013_36230 365
33 3300049574 Ga0501038_0000404 Ga0501038_0000404_31768_32985 365
34 3300049575 Ga0501039_0000323 Ga0501039_0000323_2116_3333 365
35 3300049579 Ga0501043_0000021 Ga0501043_0000021_128539_129756 365
36 3300049581 Ga0501047_0000041 Ga0501047_0000041_23716_24933 365
37 3300049582 Ga0501048_0000077 Ga0501048_0000077_14770_15987 365
38 3300049583 Ga0501067_0000775 Ga0501067_0000775_14803_16020 365
39 3300049584 Ga0501068_0031588 Ga0501068_0031588_55_1272 365
40 3300049585 Ga0501069_0000444 Ga0501069_0000444_4500_5717 365
41 3300049586 Ga0501070_0002561 Ga0501070_0002561_11386_12603 365
42 3300049588 Ga0501072_0008749 Ga0501072_0008749_4491_5708 365
43 3300049589 Ga0501073_0001489 Ga0501073_0001489_11666_12883 365
44 3300049590 Ga0501074_0001762 Ga0501074_0001762_3038_4255 365
45 3300049741 Ga0501079_0002042 Ga0501079_0002042_10015_11232 365
46 3300049742 Ga0501080_0001580 Ga0501080_0001580_1728_2945 365
47 3300049744 Ga0501083_0000708 Ga0501083_0000708_8550_9767 365
48 3300049822 Ga0501035_0000090 Ga0501035_0000090_80808_82025 365
49 3300049823 Ga0501044_0000054 Ga0501044_0000054_116467_117684 365
50 3300054114 Ga0501084_0005052 Ga0501084_0005052_8215_9432 365
51 3300060353 Ga0501082_0001981 Ga0501082_0001981_763_1980 365
52 3300005983 Ga0081540_1043466 Ga0081540_10434662 367
53 3300005455 Ga0070663_100178742 Ga0070663_1001787422 369
54 3300005334 Ga0068869_100063994 Ga0068869_1000639942 370
55 3300005347 Ga0070668_100159115 Ga0070668_1001591151 370
56 3300026121 Ga0207683_10023207 Ga0207683_100232072 370
57 3300048905 Ga0496102_0157124 Ga0496102_0157124_223_1419 370
58 3300005336 Ga0070680_100010118 Ga0070680_1000101183 371
59 3300005458 Ga0070681_10024825 Ga0070681_100248253 371
60 3300013297 Ga0157378_10194378 Ga0157378_101943782 371
61 3300014325 Ga0163163_10019481 Ga0163163_100194814 371
62 3300046537 Ga0495598_0021809 Ga0495598_0021809_332_1609 371
63 3300048907 Ga0496104_0011605 Ga0496104_0011605_6726_7841 371
64 3300048908 Ga0496105_0003235 Ga0496105_0003235_5994_7109 371
65 3300048911 Ga0496108_0056416 Ga0496108_0056416_529_1644 371
66 3300048913 Ga0496110_0057124 Ga0496110_0057124_1412_2527 371
67 3300048915 Ga0496112_0015924 Ga0496112_0015924_4174_5289 371
68 3300049572 Ga0501036_0197431 Ga0501036_0197431_487_1683 373
69 3300005353 Ga0070669_100172580 Ga0070669_1001725802 374
70 3300005356 Ga0070674_100046026 Ga0070674_1000460263 374
71 3300005367 Ga0070667_100059315 Ga0070667_1000593151 374
72 3300005455 Ga0070663_100064886 Ga0070663_1000648862 374
73 3300005456 Ga0070678_100013836 Ga0070678_1000138361 374
74 3300005457 Ga0070662_100039822 Ga0070662_1000398223 374
75 3300005543 Ga0070672_100183277 Ga0070672_1001832772 374
76 3300006881 Ga0068865_100080327 Ga0068865_1000803272 374
77 3300014968 Ga0157379_10102570 Ga0157379_101025702 374
78 3300025927 Ga0207687_10263561 Ga0207687_102635611 374
79 3300025938 Ga0207704_10086384 Ga0207704_100863842 374
80 3300026089 Ga0207648_10026505 Ga0207648_100265054 374
81 3300028379 Ga0268266_10194902 Ga0268266_101949022 374
82 3300046492 Ga0495585_0113659 Ga0495585_0113659_117_1316 374
83 3300013306 Ga0163162_10288722 Ga0163162_102887222 375
84 3300013308 Ga0157375_10070176 Ga0157375_100701763 375
85 3300025940 Ga0207691_10075061 Ga0207691_100750612 375
86 3300035171 Ga0373946_0028970 Ga0373946_0028970_582_1781 377
87 3300035695 Ga0373927_0026366 Ga0373927_0026366_743_1942 377
88 3300046455 Ga0495603_0092165 Ga0495603_0092165_50_1252 377
89 3300046690 Ga0495624_0142891 Ga0495624_0142891_170_1369 377
90 3300047315 Ga0495581_0064847 Ga0495581_0064847_215_1414 377
91 3300048915 Ga0496112_0000008 Ga0496112_0000008_304970_306169 377
92 3300048909 Ga0496106_0102326 Ga0496106_0102326_1003_2154 378
93 3300048912 Ga0496109_0064930 Ga0496109_0064930_1691_2842 378
94 3300036401 Ga0373937_0011826 Ga0373937_0011826_2124_3347 385
95 3300003322 rootL2_10122219 rootL2_101222192 386
96 3300053119 Ga0500595_000204 Ga0500595_000204_14181_15380 387
97 3300053162 Ga0500638_003336 Ga0500638_003336_3730_4929 387
98 3300053177 Ga0500636_0003542 Ga0500636_0003542_5302_6513 387
99 3300053178 Ga0500637_0000404 Ga0500637_0000404_1963_3162 387
100 3300055283 Ga0500661_000157 Ga0500661_000157_2864_4063 387
101 3300035117 Ga0373953_0008571 Ga0373953_0008571_756_1922 388
102 3300035118 Ga0373954_0009290 Ga0373954_0009290_1921_3087 388
103 3300035172 Ga0373955_0013811 Ga0373955_0013811_2312_3478 388
104 3300035724 Ga0373933_0012605 Ga0373933_0012605_249_1415 388
105 3300036401 Ga0373937_0050728 Ga0373937_0050728_2353_3519 388
106 3300046454 Ga0495592_0019981 Ga0495592_0019981_3376_4542 388
107 3300046462 Ga0495651_0011190 Ga0495651_0011190_5707_6873 388
108 3300046462 Ga0495651_0050238 Ga0495651_0050238_1296_2462 388
109 3300046463 Ga0495653_0021893 Ga0495653_0021893_1198_2364 388
110 3300046511 Ga0495608_0009095 Ga0495608_0009095_5070_6236 388
111 3300046516 Ga0495628_0020126 Ga0495628_0020126_2853_4019 388
112 3300046529 Ga0495652_0024177 Ga0495652_0024177_2814_3980 388
113 3300046533 Ga0495640_0024406 Ga0495640_0024406_1063_2229 388
114 3300046536 Ga0495587_0065341 Ga0495587_0065341_250_1416 388
115 3300046559 Ga0495667_0002613 Ga0495667_0002613_6995_8161 388
116 3300046642 Ga0495634_0006378 Ga0495634_0006378_4573_5739 388
117 3300046663 Ga0495635_0030634 Ga0495635_0030634_1435_2601 388
118 3300046675 Ga0495657_0044554 Ga0495657_0044554_709_1875 388
119 3300046678 Ga0495599_0021063 Ga0495599_0021063_2282_3448 388
120 3300046679 Ga0495623_0025334 Ga0495623_0025334_2020_3186 388
121 3300047322 Ga0495680_0013482 Ga0495680_0013482_1574_2740 388
122 3300047444 Ga0495675_0066026 Ga0495675_0066026_709_1875 388
123 3300047471 Ga0495684_0001515 Ga0495684_0001515_15481_16647 388
124 3300047673 Ga0495593_0006218 Ga0495593_0006218_2712_3878 388
125 3300053084 Ga0495595_0070783 Ga0495595_0070783_271_1437 388
126 3300053085 Ga0495619_0002811 Ga0495619_0002811_6474_7640 388
127 3300048909 Ga0496106_0011466 Ga0496106_0011466_1730_2911 391
128 3300048913 Ga0496110_0033917 Ga0496110_0033917_246_1421 391
129 3300048915 Ga0496112_0008127 Ga0496112_0008127_3029_4204 391
130 3300048921 Ga0496118_0016341 Ga0496118_0016341_1659_2840 391
131 3300048924 Ga0496121_0013137 Ga0496121_0013137_1563_2744 391
132 3300053091 Ga0500647_0039030 Ga0500647_0039030_27_1208 391
133 3300053136 Ga0500559_0116707 Ga0500559_0116707_47_1228 391
134 3300053154 Ga0500619_035884 Ga0500619_035884_327_1508 391
135 3300031711 Ga0265314_10007272 Ga0265314_100072727 392
136 iso_pu_bacteria 2643221651 2644287661 392
137 3300048920 Ga0496117_0021692 Ga0496117_0021692_3655_4836 393
138 3300048924 Ga0496121_0001934 Ga0496121_0001934_18234_19415 393
139 3300053119 Ga0500595_005423 Ga0500595_005423_122_1303 393
140 3300003203 JGI25406J46586_10014118 JGI25406J46586_100141183 394
141 3300005336 Ga0070680_100080982 Ga0070680_1000809822 394
142 3300005340 Ga0070689_100038231 Ga0070689_1000382312 394
143 3300005563 Ga0068855_100025511 Ga0068855_1000255117 394
144 3300005985 Ga0081539_10000864 Ga0081539_100008646 394
145 3300026142 Ga0207698_10042992 Ga0207698_100429922 394
146 3300046616 Ga0495668_0064585 Ga0495668_0064585_458_1723 394
147 3300048915 Ga0496112_0060088 Ga0496112_0060088_1767_2957 394
148 iso_pu_bacteria 2508501128 2509151157 394
149 3300048929 Ga0496126_0025442 Ga0496126_0025442_41_1255 396
150 3300049574 Ga0501038_0235199 Ga0501038_0235199_119_1312 396
151 3300049581 Ga0501047_0138241 Ga0501047_0138241_950_2143 396
152 3300005434 Ga0070709_10001792 Ga0070709_100017929 398
153 3300005435 Ga0070714_100006488 Ga0070714_1000064883 398
154 3300005436 Ga0070713_100004478 Ga0070713_10000447810 398
155 3300005437 Ga0070710_10027408 Ga0070710_100274082 398
156 3300006028 Ga0070717_10021454 Ga0070717_100214545 398
157 3300006163 Ga0070715_10002558 Ga0070715_100025585 398
158 3300006173 Ga0070716_100028019 Ga0070716_1000280192 398
159 3300006175 Ga0070712_100029515 Ga0070712_1000295153 398
160 3300006914 Ga0075436_100103694 Ga0075436_1001036942 398
161 3300025898 Ga0207692_10006426 Ga0207692_100064265 398
162 3300025906 Ga0207699_10002589 Ga0207699_100025893 398
163 3300025915 Ga0207693_10000587 Ga0207693_100005878 398
164 3300025916 Ga0207663_10000147 Ga0207663_1000014725 398
165 3300025928 Ga0207700_10031510 Ga0207700_100315101 398
166 3300025929 Ga0207664_10031218 Ga0207664_100312182 398
167 3300025939 Ga0207665_10000559 Ga0207665_1000055915 398
168 3300003203 JGI25406J46586_10000014 JGI25406J46586_1000001471 399
169 3300003320 rootH2_10057491 rootH2_100574912 399
170 3300003322 rootL2_10189409 rootL2_101894091 399
171 3300003323 rootH1_10039143 rootH1_100391432 399
172 3300003659 JGI25404J52841_10006345 JGI25404J52841_100063452 399
173 3300005327 Ga0070658_10138148 Ga0070658_101381482 399
174 3300005329 Ga0070683_100121866 Ga0070683_1001218662 399
175 3300005344 Ga0070661_100080720 Ga0070661_1000807202 399
176 3300005436 Ga0070713_100176244 Ga0070713_1001762442 399
177 3300005471 Ga0070698_100145585 Ga0070698_1001455852 399
178 3300005530 Ga0070679_100087296 Ga0070679_1000872962 399
179 3300005535 Ga0070684_100089805 Ga0070684_1000898052 399
180 3300005539 Ga0068853_100005066 Ga0068853_1000050666 399
181 3300005548 Ga0070665_100044886 Ga0070665_1000448863 399
182 3300005577 Ga0068857_100045789 Ga0068857_1000457893 399
183 3300005578 Ga0068854_100033569 Ga0068854_1000335692 399
184 3300005937 Ga0081455_10004709 Ga0081455_1000470919 399
185 3300005937 Ga0081455_10103588 Ga0081455_101035882 399
186 3300005983 Ga0081540_1012545 Ga0081540_10125455 399
187 3300005983 Ga0081540_1012774 Ga0081540_10127744 399
188 3300005983 Ga0081540_1023561 Ga0081540_10235613 399
189 3300005983 Ga0081540_1034782 Ga0081540_10347822 399
190 3300005985 Ga0081539_10000008 Ga0081539_10000008213 399
191 3300005985 Ga0081539_10016895 Ga0081539_100168953 399
192 3300006237 Ga0097621_100142996 Ga0097621_1001429962 399
193 3300006871 Ga0075434_100123648 Ga0075434_1001236481 399
194 3300009093 Ga0105240_10056764 Ga0105240_100567642 399
195 3300009545 Ga0105237_10034276 Ga0105237_100342763 399
196 3300009545 Ga0105237_10066738 Ga0105237_100667384 399
197 3300009551 Ga0105238_10003423 Ga0105238_1000342311 399
198 3300013105 Ga0157369_10009343 Ga0157369_100093436 399
199 3300013296 Ga0157374_10054772 Ga0157374_100547722 399
200 3300013306 Ga0163162_10134076 Ga0163162_101340762 399
201 3300013308 Ga0157375_10016545 Ga0157375_100165452 399
202 3300014325 Ga0163163_10059012 Ga0163163_100590122 399
203 3300014745 Ga0157377_10053748 Ga0157377_100537481 399
204 3300014969 Ga0157376_10035015 Ga0157376_100350153 399
205 3300025297 Ga0209758_1019261 Ga0209758_10192613 399
206 3300025912 Ga0207707_10001221 Ga0207707_1000122123 399
207 3300025919 Ga0207657_10001936 Ga0207657_100019365 399
208 3300025921 Ga0207652_10003582 Ga0207652_1000358212 399
209 3300025931 Ga0207644_10034545 Ga0207644_100345452 399
210 3300025945 Ga0207679_10013580 Ga0207679_100135802 399
211 3300025949 Ga0207667_10039707 Ga0207667_100397073 399
212 3300026041 Ga0207639_10015926 Ga0207639_100159262 399
213 3300026067 Ga0207678_10004323 Ga0207678_100043233 399
214 3300026095 Ga0207676_10158006 Ga0207676_101580062 399
215 3300026116 Ga0207674_10002416 Ga0207674_100024168 399
216 3300026121 Ga0207683_10007596 Ga0207683_100075962 399
217 3300031238 Ga0265332_10069396 Ga0265332_100693962 399
218 3300031250 Ga0265331_10055551 Ga0265331_100555512 399
219 3300031456 Ga0307513_10176135 Ga0307513_101761352 399
220 3300031616 Ga0307508_10086404 Ga0307508_100864042 399
221 3300031730 Ga0307516_10008676 Ga0307516_100086768 399
222 3300031730 Ga0307516_10202209 Ga0307516_102022092 399
223 3300035695 Ga0373927_0050223 Ga0373927_0050223_729_1934 399
224 3300035724 Ga0373933_0000159 Ga0373933_0000159_1778_2977 399
225 3300035725 Ga0373947_0015845 Ga0373947_0015845_490_1695 399
226 3300046507 Ga0495606_0003130 Ga0495606_0003130_4154_5353 399
227 3300046524 Ga0495648_0001376 Ga0495648_0001376_14020_15219 399
228 3300046524 Ga0495648_0005337 Ga0495648_0005337_3514_4731 399
229 3300046689 Ga0495613_0036818 Ga0495613_0036818_1687_2892 399
230 3300048904 Ga0496101_0232092 Ga0496101_0232092_17_1216 399
231 3300048905 Ga0496102_0001934 Ga0496102_0001934_4145_5344 399
232 3300048907 Ga0496104_0005334 Ga0496104_0005334_9923_11200 399
233 3300048908 Ga0496105_0136852 Ga0496105_0136852_325_1524 399
234 3300048911 Ga0496108_0003939 Ga0496108_0003939_10620_11897 399
235 3300048913 Ga0496110_0012027 Ga0496110_0012027_364_1641 399
236 3300048918 Ga0496115_0000997 Ga0496115_0000997_10068_11267 399
237 3300048929 Ga0496126_0119049 Ga0496126_0119049_229_1431 399
238 3300049583 Ga0501067_0023393 Ga0501067_0023393_937_2136 399
239 3300050512 nmdc:mga0n895_314820_c1 nmdc:mga0n895_314820_c1_55_1254 399

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12832

MFS_1_like

MFS_1 like family

45

396

0.9

PF03825

Nuc_H_symport

Nucleoside H+ symporter

43

415

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
7dla-assembly1.cif.gz_A crystal structure of nucleoside transporter nupg (d323a mutant) 0.8791 18 383
7dl9-assembly2.cif.gz_B crystal structure of nucleoside transporter nupg 0.8723 18 383
1pv6-assembly2.cif.gz_B crystal structure of lactose permease 0.8717 20 383
2y5y-assembly1.cif.gz_A crystal structure of lacy in complex with an affinity inactivator 0.829 16 382
7yr5-assembly1.cif.gz_A embigin facilitates monocarboxylate transporter 1 localization to plasma membrane and transition to a decoupling state 0.8282 18 393
ID Description Score Start End Superfamily
af_Q8T043_601_868_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9192 209 382 1.20.1250.20
af_Q47142_189_373_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9178 199 381 1.20.1250.20
af_Q55F73_59_238_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9153 24 188 1.20.1250.20
af_A4I8Z5_294_489_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.909 197 386 1.20.1250.20
af_E7FB53_277_463_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.906 215 389 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A5C1DE99-F1-model_v4 MFS transporter 0.947 19 382 GO:0005886
GO:0015528
GO:0030395
AF-W4Q3G3-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9421 17 389 GO:0005886
GO:0015528
GO:0030395
AF-A0A4Q9DYA9-F1-model_v4 MFS transporter 0.9394 20 389 GO:0005886
GO:0015528
GO:0030395
AF-A0A7G5LJ77-F1-model_v4 MFS transporter 0.9319 21 396 GO:0005886
GO:0015528
GO:0030395
AF-A0A7G5LJ77-F1-model_v4 MFS transporter 0.9201 21 396 GO:0005886
GO:0015528
GO:0030395

Feature Viewer

pLDDT pTM Quality
87.5 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map