F351796

General Info

Members Datasets Scaffolds Average Seq Length
239 153 239 134

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_101565299|Ga0068860_1015652991
Length 164
Sequence VAKTRFTRLELQILEALWANGKASIREIQEAFPEPRPAYTTIQTTVYRLETKKAVRRVRKISNAHIFEPIVSRDVTRHGVLDEILSFFGGRAQPMMAQLAEAGKLTRDDVRELEKLIEQRDQAADWRVEDAPIPSGAGNQGPRERRREGVRRDEVPRENKARPK

Samples

Sample ID Description Type Environment
1 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
72 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
73 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
105 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
106 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
107 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
113 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
115 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
116 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
117 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
118 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
119 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
120 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
123 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
127 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
128 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
129 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
130 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
131 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
132 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
133 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
134 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
135 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
136 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
137 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
138 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
139 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
140 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
141 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
142 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
143 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
144 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
145 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
146 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
147 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
148 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
149 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
150 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
151 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
152 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
153 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.33
Metatranscriptomes 1.67
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.42
Nodule 0
Rhizoplane 0
Rhizosphere 96.23
Stem 0
Stem Tuber 0
Unclassified 3.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058861_11970607 3300004800 Bacteria 1060
2 Ga0065707_10009138 3300005295 Unclassified 2222
3 Ga0065707_10172359 3300005295 Bacteria 1475
4 Ga0070676_10760792 3300005328 Bacteria 712
5 Ga0070683_100031104 3300005329 Bacteria 4850
6 Ga0070690_101532933 3300005330 Bacteria 539
7 Ga0068869_100224855 3300005334 Bacteria 1489
8 Ga0070680_100789521 3300005336 Bacteria 818
9 Ga0070687_101523582 3300005343 Unclassified 503
10 Ga0070668_101344223 3300005347 Unclassified 650
11 Ga0070675_100824947 3300005354 Unclassified 848
12 Ga0070671_100254241 3300005355 Unclassified 1493
13 Ga0070714_100005312 3300005435 Bacteria 9819
14 Ga0070711_100075592 3300005439 Bacteria 2386
15 Ga0070711_101763621 3300005439 Unclassified 543
16 Ga0070708_100487188 3300005445 Bacteria 1163
17 Ga0070663_100958458 3300005455 Unclassified 742
18 Ga0070681_10971764 3300005458 Unclassified 769
19 Ga0068867_100096026 3300005459 Unclassified 2256
20 Ga0070706_100320345 3300005467 Unclassified 1446
21 Ga0070706_102014392 3300005467 Unclassified 523
22 Ga0070698_100193481 3300005471 Bacteria 1971
23 Ga0070698_100428287 3300005471 Bacteria 1258
24 Ga0070699_100635708 3300005518 Bacteria 974
25 Ga0070679_100357192 3300005530 Bacteria 1409
26 Ga0070684_100697700 3300005535 Unclassified 946
27 Ga0070695_100095146 3300005545 Unclassified 1996
28 Ga0070696_101301281 3300005546 Bacteria 617
29 Ga0070665_100164121 3300005548 Bacteria 2224
30 Ga0070704_101280414 3300005549 Unclassified 670
31 Ga0070664_101285126 3300005564 Bacteria 691
32 Ga0068857_102431101 3300005577 Unclassified 514
33 Ga0068864_100127241 3300005618 Unclassified 2284
34 Ga0068864_100849799 3300005618 Bacteria 899
35 Ga0068863_100055448 3300005841 Unclassified 3753
36 Ga0068863_100339255 3300005841 Unclassified 1462
37 Ga0068860_100643384 3300005843 Unclassified 1068
38 Ga0068860_101565299 3300005843 Unclassified 681
39 Ga0070717_10535385 3300006028 Unclassified 1060
40 Ga0070717_11920622 3300006028 Unclassified 534
41 Ga0075364_10831369 3300006051 Bacteria 629
42 Ga0070716_100515435 3300006173 Unclassified 885
43 Ga0097621_100680368 3300006237 Unclassified 946
44 Ga0097621_100691984 3300006237 Unclassified 938
45 Ga0097621_100822249 3300006237 Unclassified 862
46 Ga0097621_101218832 3300006237 Unclassified 709
47 Ga0068871_100191041 3300006358 Bacteria 1764
48 Ga0068871_100626075 3300006358 Unclassified 980
49 Ga0068871_101300503 3300006358 Unclassified 684
50 Ga0075428_100060422 3300006844 Bacteria 4150
51 Ga0075428_100112921 3300006844 Unclassified 2960
52 Ga0075428_100431424 3300006844 Bacteria 1412
53 Ga0075428_101906845 3300006844 Unclassified 617
54 Ga0075430_100015888 3300006846 Bacteria 6411
55 Ga0075430_100048830 3300006846 Bacteria 3573
56 Ga0075431_100033986 3300006847 Bacteria 5255
57 Ga0075431_100079721 3300006847 Bacteria 3380
58 Ga0075431_100087427 3300006847 Unclassified 3216
59 Ga0075431_100428990 3300006847 Unclassified 1320
60 Ga0075431_100793962 3300006847 Unclassified 920
61 Ga0075433_10003457 3300006852 Bacteria 12193
62 Ga0075433_10380132 3300006852 Bacteria 1247
63 Ga0075433_10580502 3300006852 Unclassified 985
64 Ga0075434_100066304 3300006871 Bacteria 3596
65 Ga0075429_100105611 3300006880 Unclassified 2460
66 Ga0075429_100140683 3300006880 Bacteria 2112
67 Ga0075429_100174200 3300006880 Bacteria 1885
68 Ga0075429_100279510 3300006880 Unclassified 1462
69 Ga0068865_101063651 3300006881 Bacteria 711
70 Ga0075435_100106861 3300007076 Unclassified 2324
71 Ga0105240_10006679 3300009093 Bacteria 16914
72 Ga0105240_10140973 3300009093 Bacteria 2882
73 Ga0105240_10308523 3300009093 Unclassified 1808
74 Ga0105240_11272997 3300009093 Bacteria 776
75 Ga0111539_10002635 3300009094 Bacteria 23767
76 Ga0111539_10028524 3300009094 Bacteria 6808
77 Ga0111539_10051518 3300009094 Bacteria 4902
78 Ga0111539_10427660 3300009094 Unclassified 1542
79 Ga0111539_12370629 3300009094 Bacteria 616
80 Ga0111539_12717130 3300009094 Unclassified 574
81 Ga0105245_10879689 3300009098 Bacteria 937
82 Ga0105245_11254403 3300009098 Bacteria 790
83 Ga0105247_10348655 3300009101 Unclassified 1041
84 Ga0114129_10042227 3300009147 Bacteria 6420
85 Ga0114129_10163257 3300009147 Bacteria 3041
86 Ga0114129_10164059 3300009147 Unclassified 3033
87 Ga0114129_12486937 3300009147 Bacteria 619
88 Ga0105243_10074734 3300009148 Bacteria 2749
89 Ga0105242_10175642 3300009176 Bacteria 1886
90 Ga0105242_10368810 3300009176 Unclassified 1331
91 Ga0105242_10670360 3300009176 Bacteria 1011
92 Ga0105242_11703036 3300009176 Unclassified 667
93 Ga0105248_10010925 3300009177 Bacteria 10017
94 Ga0105248_10310012 3300009177 Unclassified 1777
95 Ga0105248_10456201 3300009177 Unclassified 1441
96 Ga0105248_10533155 3300009177 Bacteria 1324
97 Ga0105248_10592716 3300009177 Bacteria 1251
98 Ga0105248_10701107 3300009177 Unclassified 1142
99 Ga0105248_10891957 3300009177 Bacteria 1004
100 Ga0105248_10894049 3300009177 Unclassified 1003
101 Ga0105237_10001004 3300009545 Bacteria 37992
102 Ga0105238_10207034 3300009551 Unclassified 1938
103 Ga0105238_10611793 3300009551 Unclassified 1098
104 Ga0105238_11027829 3300009551 Bacteria 845
105 Ga0105249_10535139 3300009553 Unclassified 1221
106 Ga0105239_10100498 3300010375 Bacteria 3199
107 Ga0105246_11485386 3300011119 Unclassified 636
108 Ga0157370_10168985 3300013104 Bacteria 2033
109 Ga0157370_10202579 3300013104 Bacteria 1841
110 Ga0157370_10703824 3300013104 Bacteria 922
111 Ga0157369_10204034 3300013105 Bacteria 2074
112 Ga0157369_11293462 3300013105 Unclassified 743
113 Ga0157374_11907245 3300013296 Unclassified 620
114 Ga0157378_11345598 3300013297 Bacteria 756
115 Ga0163162_10242356 3300013306 Unclassified 1934
116 Ga0163162_10536578 3300013306 Unclassified 1299
117 Ga0157372_11396868 3300013307 Bacteria 807
118 Ga0157375_10591433 3300013308 Unclassified 1269
119 Ga0157375_11625530 3300013308 Bacteria 764
120 Ga0163163_10101209 3300014325 Bacteria 2904
121 Ga0163163_10842189 3300014325 Unclassified 980
122 Ga0163163_10856900 3300014325 Bacteria 972
123 Ga0157380_10285834 3300014326 Unclassified 1512
124 Ga0157379_11097354 3300014968 Bacteria 762
125 Ga0163161_10075592 3300017792 Bacteria 2472
126 Ga0197907_11021850 3300020069 Unclassified 821
127 Ga0206350_10061381 3300020080 Bacteria 1418
128 Ga0213874_10259375 3300021377 Unclassified 643
129 Ga0213875_10230295 3300021388 Unclassified 873
130 Ga0213875_10425028 3300021388 Unclassified 635
131 Ga0224712_10033400 3300022467 Bacteria 1883
132 Ga0207710_10239238 3300025900 Bacteria 905
133 Ga0207710_10399236 3300025900 Unclassified 705
134 Ga0207645_10477329 3300025907 Bacteria 843
135 Ga0207705_10188983 3300025909 Unclassified 1557
136 Ga0207684_11626640 3300025910 Unclassified 522
137 Ga0207695_10048314 3300025913 Unclassified 4495
138 Ga0207695_10143293 3300025913 Bacteria 2336
139 Ga0207695_10772932 3300025913 Bacteria 841
140 Ga0207671_10050073 3300025914 Unclassified 3093
141 Ga0207663_10095129 3300025916 Bacteria 1987
142 Ga0207694_10623289 3300025924 Unclassified 908
143 Ga0207650_11878069 3300025925 Unclassified 506
144 Ga0207659_10863313 3300025926 Unclassified 778
145 Ga0207687_10215708 3300025927 Bacteria 1508
146 Ga0207700_10215387 3300025928 Unclassified 1625
147 Ga0207700_11816094 3300025928 Unclassified 536
148 Ga0207664_10329297 3300025929 Unclassified 1349
149 Ga0207644_10213055 3300025931 Unclassified 1528
150 Ga0207686_10196437 3300025934 Bacteria 1442
151 Ga0207686_11345018 3300025934 Unclassified 587
152 Ga0207709_10763838 3300025935 Bacteria 778
153 Ga0207665_10465139 3300025939 Unclassified 972
154 Ga0207711_10378493 3300025941 Bacteria 1313
155 Ga0207711_10855164 3300025941 Unclassified 846
156 Ga0207711_10860097 3300025941 Bacteria 844
157 Ga0207711_11078867 3300025941 Unclassified 744
158 Ga0207689_10221100 3300025942 Unclassified 1565
159 Ga0207661_10191573 3300025944 Bacteria 1793
160 Ga0207668_11197959 3300025972 Unclassified 682
161 Ga0207703_10017250 3300026035 Bacteria 5634
162 Ga0207639_10804188 3300026041 Bacteria 876
163 Ga0207678_11094812 3300026067 Unclassified 705
164 Ga0207702_10474784 3300026078 Bacteria 1216
165 Ga0207641_10009360 3300026088 Bacteria 8080
166 Ga0207641_11005398 3300026088 Unclassified 831
167 Ga0207648_10838702 3300026089 Bacteria 857
168 Ga0207648_11712685 3300026089 Unclassified 590
169 Ga0207674_10579208 3300026116 Unclassified 1084
170 Ga0207428_10035496 3300027907 Bacteria 4075
171 Ga0207428_10146107 3300027907 Bacteria 1802
172 Ga0268266_10130654 3300028379 Bacteria 2246
173 Ga0265342_10642446 3300031712 Unclassified 533
174 Ga0307405_10060515 3300031731 Bacteria 2390
175 Ga0307410_10053340 3300031852 Unclassified 2736
176 Ga0307407_10239771 3300031903 Bacteria 1236
177 Ga0307409_100047235 3300031995 Bacteria 3266
178 Ga0307416_100654967 3300032002 Bacteria 1135
179 Ga0307414_10132229 3300032004 Unclassified 1939
180 Ga0307411_10214317 3300032005 Bacteria 1489
181 Ga0373944_0020514 3300035089 Bacteria 1905
182 Ga0373923_0025927 3300035111 Bacteria 2328
183 Ga0373923_0171237 3300035111 Unclassified 994
184 Ga0373936_0025998 3300035113 Bacteria 2292
185 Ga0373953_0476063 3300035117 Unclassified 553
186 Ga0373954_0074971 3300035118 Bacteria 1611
187 Ga0373954_0141591 3300035118 Bacteria 1173
188 Ga0373954_0469919 3300035118 Unclassified 623
189 Ga0373943_0070630 3300035170 Bacteria 1767
190 Ga0373946_0022265 3300035171 Bacteria 2465
191 Ga0373955_0347106 3300035172 Bacteria 899
192 Ga0373955_0405646 3300035172 Unclassified 828
193 Ga0373924_0327008 3300035410 Unclassified 682
194 Ga0373935_0667326 3300035692 Unclassified 763
195 Ga0373927_0449317 3300035695 Unclassified 851
196 Ga0373947_0102135 3300035725 Bacteria 1803
197 Ga0373937_0689278 3300036401 Bacteria 968
198 Ga0373937_0990458 3300036401 Unclassified 789
199 Ga0373937_1197543 3300036401 Unclassified 708
200 Ga0373937_1240117 3300036401 Unclassified 694
201 Ga0373925_0033964 3300037068 Bacteria 3759
202 Ga0436364_0479586 3300037853 Unclassified 1159
203 Ga0436364_0705464 3300037853 Unclassified 628
204 Ga0436364_1403847 3300037853 Unclassified 914
205 Ga0436363_1139167 3300039450 Unclassified 1186
206 Ga0436362_0247417 3300039453 Bacteria 713
207 Ga0451835_0016953 3300041492 Unclassified 524
208 Ga0495629_0033372 3300046459 Unclassified 3641
209 Ga0495594_0191097 3300046499 Bacteria 1166
210 Ga0495608_0276631 3300046511 Unclassified 1043
211 Ga0495618_0179181 3300046514 Bacteria 1347
212 Ga0495628_0429460 3300046516 Bacteria 962
213 Ga0495630_0523755 3300046517 Unclassified 909
214 Ga0495586_0129642 3300046535 Unclassified 1412
215 Ga0495667_0055063 3300046559 Bacteria 2616
216 Ga0495634_0181367 3300046642 Unclassified 1318
217 Ga0495657_0009126 3300046675 Bacteria 7537
218 Ga0495657_0075921 3300046675 Bacteria 2184
219 Ga0495599_0736336 3300046678 Unclassified 566
220 Ga0495613_0148442 3300046689 Bacteria 1673
221 Ga0495613_0348769 3300046689 Bacteria 1017
222 Ga0495636_0493920 3300047318 Unclassified 591
223 Ga0495674_0046759 3300047319 Bacteria 3841
224 Ga0495674_0098047 3300047319 Bacteria 2496
225 Ga0495680_0754781 3300047322 Unclassified 639
226 Ga0495684_0219768 3300047471 Bacteria 1393
227 Ga0495684_0828461 3300047471 Unclassified 602
228 nmdc:mga05p37_130358_c1 3300050507 Unclassified 3085
229 nmdc:mga05p37_15_c1 3300050507 Bacteria 134650
230 nmdc:mga05p37_383826_c1 3300050507 Bacteria 1645
231 nmdc:mga05p37_57801_c1 3300050507 Unclassified 4777
232 nmdc:mga09592_106299_c1 3300050508 Unclassified 2407
233 nmdc:mga0qj67_44537_c1 3300050509 Unclassified 3498
234 nmdc:mga06r32_174989_c1 3300050510 Unclassified 2131
235 nmdc:mga08y16_10196_c1 3300050511 Bacteria 9868
236 nmdc:mga08y16_70869_c1 3300050511 Unclassified 3633
237 nmdc:mga0n895_106265_c1 3300050512 Bacteria 2820
238 nmdc:mga0rr50_844741_c1 3300050513 Unclassified 781
239 nmdc:mga0a205_1842_c1 3300050515 Bacteria 18355

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006844 Ga0075428_100060422 Ga0075428_1000604223 131
2 3300006844 Ga0075428_100431424 Ga0075428_1004314241 131
3 3300006844 Ga0075428_101906845 Ga0075428_1019068451 131
4 3300006846 Ga0075430_100015888 Ga0075430_1000158885 131
5 3300006846 Ga0075430_100048830 Ga0075430_1000488303 131
6 3300006847 Ga0075431_100079721 Ga0075431_1000797213 131
7 3300006847 Ga0075431_100428990 Ga0075431_1004289901 131
8 3300006847 Ga0075431_100793962 Ga0075431_1007939622 131
9 3300006880 Ga0075429_100140683 Ga0075429_1001406832 131
10 3300006880 Ga0075429_100279510 Ga0075429_1002795103 131
11 3300009094 Ga0111539_10002635 Ga0111539_1000263524 131
12 3300009094 Ga0111539_10051518 Ga0111539_100515184 131
13 3300009094 Ga0111539_10427660 Ga0111539_104276602 131
14 3300009094 Ga0111539_12370629 Ga0111539_123706291 131
15 3300013306 Ga0163162_10536578 Ga0163162_105365782 131
16 3300026089 Ga0207648_11712685 Ga0207648_117126851 131
17 3300046499 Ga0495594_0191097 Ga0495594_0191097_345_743 131
18 3300005295 Ga0065707_10009138 Ga0065707_100091382 132
19 3300005295 Ga0065707_10172359 Ga0065707_101723592 132
20 3300005435 Ga0070714_100005312 Ga0070714_10000531211 132
21 3300005471 Ga0070698_100193481 Ga0070698_1001934811 132
22 3300006844 Ga0075428_100112921 Ga0075428_1001129215 132
23 3300006852 Ga0075433_10580502 Ga0075433_105805022 132
24 3300009094 Ga0111539_10028524 Ga0111539_100285245 132
25 3300009147 Ga0114129_10042227 Ga0114129_100422278 132
26 3300009177 Ga0105248_10701107 Ga0105248_107011072 132
27 3300013296 Ga0157374_11907245 Ga0157374_119072451 132
28 3300021377 Ga0213874_10259375 Ga0213874_102593752 132
29 3300021388 Ga0213875_10425028 Ga0213875_104250282 132
30 3300025929 Ga0207664_10329297 Ga0207664_103292972 132
31 3300026078 Ga0207702_10474784 Ga0207702_104747842 132
32 3300027907 Ga0207428_10146107 Ga0207428_101461072 132
33 3300031731 Ga0307405_10060515 Ga0307405_100605152 132
34 3300031852 Ga0307410_10053340 Ga0307410_100533403 132
35 3300031903 Ga0307407_10239771 Ga0307407_102397712 132
36 3300031995 Ga0307409_100047235 Ga0307409_1000472352 132
37 3300032002 Ga0307416_100654967 Ga0307416_1006549672 132
38 3300032004 Ga0307414_10132229 Ga0307414_101322292 132
39 3300032005 Ga0307411_10214317 Ga0307411_102143171 132
40 3300035118 Ga0373954_0469919 Ga0373954_0469919_157_564 132
41 3300037853 Ga0436364_0479586 Ga0436364_0479586_186_584 132
42 3300039450 Ga0436363_1139167 Ga0436363_1139167_659_1057 132
43 3300050507 nmdc:mga05p37_15_c1 nmdc:mga05p37_15_c1_42333_42734 132
44 3300050511 nmdc:mga08y16_10196_c1 nmdc:mga08y16_10196_c1_801_1202 132
45 3300005330 Ga0070690_101532933 Ga0070690_1015329331 133
46 3300005343 Ga0070687_101523582 Ga0070687_1015235821 133
47 3300005347 Ga0070668_101344223 Ga0070668_1013442231 133
48 3300005354 Ga0070675_100824947 Ga0070675_1008249471 133
49 3300005355 Ga0070671_100254241 Ga0070671_1002542412 133
50 3300005439 Ga0070711_100075592 Ga0070711_1000755922 133
51 3300005439 Ga0070711_101763621 Ga0070711_1017636211 133
52 3300005445 Ga0070708_100487188 Ga0070708_1004871882 133
53 3300005459 Ga0068867_100096026 Ga0068867_1000960262 133
54 3300005467 Ga0070706_100320345 Ga0070706_1003203451 133
55 3300005467 Ga0070706_102014392 Ga0070706_1020143921 133
56 3300005471 Ga0070698_100428287 Ga0070698_1004282872 133
57 3300005518 Ga0070699_100635708 Ga0070699_1006357082 133
58 3300005535 Ga0070684_100697700 Ga0070684_1006977001 133
59 3300005545 Ga0070695_100095146 Ga0070695_1000951464 133
60 3300005546 Ga0070696_101301281 Ga0070696_1013012811 133
61 3300005548 Ga0070665_100164121 Ga0070665_1001641212 133
62 3300005549 Ga0070704_101280414 Ga0070704_1012804141 133
63 3300005564 Ga0070664_101285126 Ga0070664_1012851262 133
64 3300005577 Ga0068857_102431101 Ga0068857_1024311011 133
65 3300005618 Ga0068864_100127241 Ga0068864_1001272412 133
66 3300005618 Ga0068864_100849799 Ga0068864_1008497992 133
67 3300005841 Ga0068863_100055448 Ga0068863_1000554483 133
68 3300005841 Ga0068863_100339255 Ga0068863_1003392552 133
69 3300005843 Ga0068860_100643384 Ga0068860_1006433842 133
70 3300006028 Ga0070717_10535385 Ga0070717_105353852 133
71 3300006028 Ga0070717_11920622 Ga0070717_119206221 133
72 3300006051 Ga0075364_10831369 Ga0075364_108313692 133
73 3300006173 Ga0070716_100515435 Ga0070716_1005154352 133
74 3300006237 Ga0097621_100680368 Ga0097621_1006803681 133
75 3300006237 Ga0097621_100691984 Ga0097621_1006919842 133
76 3300006237 Ga0097621_100822249 Ga0097621_1008222492 133
77 3300006237 Ga0097621_101218832 Ga0097621_1012188322 133
78 3300006358 Ga0068871_100191041 Ga0068871_1001910412 133
79 3300006358 Ga0068871_100626075 Ga0068871_1006260751 133
80 3300006358 Ga0068871_101300503 Ga0068871_1013005032 133
81 3300006847 Ga0075431_100033986 Ga0075431_1000339863 133
82 3300006847 Ga0075431_100087427 Ga0075431_1000874274 133
83 3300006852 Ga0075433_10003457 Ga0075433_100034576 133
84 3300006852 Ga0075433_10380132 Ga0075433_103801322 133
85 3300006871 Ga0075434_100066304 Ga0075434_1000663044 133
86 3300006880 Ga0075429_100105611 Ga0075429_1001056112 133
87 3300006880 Ga0075429_100174200 Ga0075429_1001742002 133
88 3300006881 Ga0068865_101063651 Ga0068865_1010636512 133
89 3300007076 Ga0075435_100106861 Ga0075435_1001068612 133
90 3300009093 Ga0105240_10006679 Ga0105240_100066791 133
91 3300009093 Ga0105240_10140973 Ga0105240_101409734 133
92 3300009093 Ga0105240_10308523 Ga0105240_103085232 133
93 3300009093 Ga0105240_11272997 Ga0105240_112729972 133
94 3300009094 Ga0111539_12717130 Ga0111539_127171301 133
95 3300009098 Ga0105245_10879689 Ga0105245_108796892 133
96 3300009101 Ga0105247_10348655 Ga0105247_103486552 133
97 3300009147 Ga0114129_10163257 Ga0114129_101632572 133
98 3300009147 Ga0114129_10164059 Ga0114129_101640592 133
99 3300009147 Ga0114129_12486937 Ga0114129_124869372 133
100 3300009176 Ga0105242_10368810 Ga0105242_103688102 133
101 3300009176 Ga0105242_11703036 Ga0105242_117030361 133
102 3300009177 Ga0105248_10010925 Ga0105248_100109254 133
103 3300009177 Ga0105248_10310012 Ga0105248_103100122 133
104 3300009177 Ga0105248_10456201 Ga0105248_104562011 133
105 3300009177 Ga0105248_10592716 Ga0105248_105927162 133
106 3300009177 Ga0105248_10891957 Ga0105248_108919572 133
107 3300009177 Ga0105248_10894049 Ga0105248_108940491 133
108 3300009545 Ga0105237_10001004 Ga0105237_100010041 133
109 3300009551 Ga0105238_10207034 Ga0105238_102070341 133
110 3300009551 Ga0105238_10611793 Ga0105238_106117932 133
111 3300009553 Ga0105249_10535139 Ga0105249_105351392 133
112 3300010375 Ga0105239_10100498 Ga0105239_101004982 133
113 3300011119 Ga0105246_11485386 Ga0105246_114853862 133
114 3300013104 Ga0157370_10703824 Ga0157370_107038241 133
115 3300013306 Ga0163162_10242356 Ga0163162_102423562 133
116 3300013307 Ga0157372_11396868 Ga0157372_113968681 133
117 3300013308 Ga0157375_10591433 Ga0157375_105914332 133
118 3300014325 Ga0163163_10101209 Ga0163163_101012093 133
119 3300014325 Ga0163163_10842189 Ga0163163_108421892 133
120 3300014325 Ga0163163_10856900 Ga0163163_108569002 133
121 3300014326 Ga0157380_10285834 Ga0157380_102858342 133
122 3300014968 Ga0157379_11097354 Ga0157379_110973541 133
123 3300017792 Ga0163161_10075592 Ga0163161_100755923 133
124 3300025900 Ga0207710_10239238 Ga0207710_102392382 133
125 3300025900 Ga0207710_10399236 Ga0207710_103992362 133
126 3300025909 Ga0207705_10188983 Ga0207705_101889833 133
127 3300025910 Ga0207684_11626640 Ga0207684_116266401 133
128 3300025913 Ga0207695_10048314 Ga0207695_100483142 133
129 3300025913 Ga0207695_10143293 Ga0207695_101432932 133
130 3300025913 Ga0207695_10772932 Ga0207695_107729322 133
131 3300025914 Ga0207671_10050073 Ga0207671_100500733 133
132 3300025916 Ga0207663_10095129 Ga0207663_100951291 133
133 3300025924 Ga0207694_10623289 Ga0207694_106232892 133
134 3300025925 Ga0207650_11878069 Ga0207650_118780691 133
135 3300025926 Ga0207659_10863313 Ga0207659_108633131 133
136 3300025928 Ga0207700_10215387 Ga0207700_102153872 133
137 3300025928 Ga0207700_11816094 Ga0207700_118160941 133
138 3300025931 Ga0207644_10213055 Ga0207644_102130552 133
139 3300025934 Ga0207686_11345018 Ga0207686_113450181 133
140 3300025939 Ga0207665_10465139 Ga0207665_104651392 133
141 3300025941 Ga0207711_10855164 Ga0207711_108551641 133
142 3300025941 Ga0207711_10860097 Ga0207711_108600972 133
143 3300025941 Ga0207711_11078867 Ga0207711_110788672 133
144 3300025972 Ga0207668_11197959 Ga0207668_111979591 133
145 3300026035 Ga0207703_10017250 Ga0207703_100172503 133
146 3300026041 Ga0207639_10804188 Ga0207639_108041882 133
147 3300026088 Ga0207641_10009360 Ga0207641_100093602 133
148 3300026088 Ga0207641_11005398 Ga0207641_110053982 133
149 3300026089 Ga0207648_10838702 Ga0207648_108387022 133
150 3300026116 Ga0207674_10579208 Ga0207674_105792082 133
151 3300027907 Ga0207428_10035496 Ga0207428_100354962 133
152 3300028379 Ga0268266_10130654 Ga0268266_101306544 133
153 3300035089 Ga0373944_0020514 Ga0373944_0020514_923_1324 133
154 3300035111 Ga0373923_0025927 Ga0373923_0025927_282_683 133
155 3300035111 Ga0373923_0171237 Ga0373923_0171237_567_968 133
156 3300035113 Ga0373936_0025998 Ga0373936_0025998_1851_2252 133
157 3300035117 Ga0373953_0476063 Ga0373953_0476063_15_416 133
158 3300035118 Ga0373954_0074971 Ga0373954_0074971_963_1364 133
159 3300035118 Ga0373954_0141591 Ga0373954_0141591_272_673 133
160 3300035170 Ga0373943_0070630 Ga0373943_0070630_543_944 133
161 3300035171 Ga0373946_0022265 Ga0373946_0022265_1583_1984 133
162 3300035172 Ga0373955_0347106 Ga0373955_0347106_441_851 133
163 3300035172 Ga0373955_0405646 Ga0373955_0405646_361_762 133
164 3300035410 Ga0373924_0327008 Ga0373924_0327008_159_560 133
165 3300035692 Ga0373935_0667326 Ga0373935_0667326_145_546 133
166 3300035695 Ga0373927_0449317 Ga0373927_0449317_28_429 133
167 3300035725 Ga0373947_0102135 Ga0373947_0102135_142_543 133
168 3300036401 Ga0373937_0990458 Ga0373937_0990458_286_687 133
169 3300036401 Ga0373937_1197543 Ga0373937_1197543_285_686 133
170 3300036401 Ga0373937_1240117 Ga0373937_1240117_235_636 133
171 3300037068 Ga0373925_0033964 Ga0373925_0033964_2561_2962 133
172 3300037853 Ga0436364_0705464 Ga0436364_0705464_180_581 133
173 3300039453 Ga0436362_0247417 Ga0436362_0247417_123_524 133
174 3300041492 Ga0451835_0016953 Ga0451835_0016953_11_412 133
175 3300046459 Ga0495629_0033372 Ga0495629_0033372_1116_1517 133
176 3300046511 Ga0495608_0276631 Ga0495608_0276631_256_657 133
177 3300046514 Ga0495618_0179181 Ga0495618_0179181_810_1211 133
178 3300046516 Ga0495628_0429460 Ga0495628_0429460_468_869 133
179 3300046517 Ga0495630_0523755 Ga0495630_0523755_445_846 133
180 3300046535 Ga0495586_0129642 Ga0495586_0129642_904_1305 133
181 3300046559 Ga0495667_0055063 Ga0495667_0055063_63_464 133
182 3300046642 Ga0495634_0181367 Ga0495634_0181367_830_1231 133
183 3300046675 Ga0495657_0009126 Ga0495657_0009126_847_1248 133
184 3300046675 Ga0495657_0075921 Ga0495657_0075921_15_416 133
185 3300046678 Ga0495599_0736336 Ga0495599_0736336_97_498 133
186 3300046689 Ga0495613_0148442 Ga0495613_0148442_1152_1553 133
187 3300046689 Ga0495613_0348769 Ga0495613_0348769_134_535 133
188 3300047319 Ga0495674_0046759 Ga0495674_0046759_1348_1749 133
189 3300047319 Ga0495674_0098047 Ga0495674_0098047_2013_2414 133
190 3300047322 Ga0495680_0754781 Ga0495680_0754781_122_523 133
191 3300047471 Ga0495684_0219768 Ga0495684_0219768_690_1091 133
192 3300047471 Ga0495684_0828461 Ga0495684_0828461_38_439 133
193 3300050507 nmdc:mga05p37_130358_c1 nmdc:mga05p37_130358_c1_952_1353 133
194 3300050507 nmdc:mga05p37_383826_c1 nmdc:mga05p37_383826_c1_1044_1445 133
195 3300050507 nmdc:mga05p37_57801_c1 nmdc:mga05p37_57801_c1_3506_3910 133
196 3300050508 nmdc:mga09592_106299_c1 nmdc:mga09592_106299_c1_1588_1992 133
197 3300050509 nmdc:mga0qj67_44537_c1 nmdc:mga0qj67_44537_c1_2400_2804 133
198 3300050510 nmdc:mga06r32_174989_c1 nmdc:mga06r32_174989_c1_588_992 133
199 3300050511 nmdc:mga08y16_70869_c1 nmdc:mga08y16_70869_c1_132_560 133
200 3300050512 nmdc:mga0n895_106265_c1 nmdc:mga0n895_106265_c1_1967_2371 133
201 3300050513 nmdc:mga0rr50_844741_c1 nmdc:mga0rr50_844741_c1_281_682 133
202 3300050515 nmdc:mga0a205_1842_c1 nmdc:mga0a205_1842_c1_6227_6631 133
203 3300005328 Ga0070676_10760792 Ga0070676_107607921 134
204 3300005334 Ga0068869_100224855 Ga0068869_1002248551 134
205 3300009098 Ga0105245_11254403 Ga0105245_112544032 134
206 3300009148 Ga0105243_10074734 Ga0105243_100747341 134
207 3300009176 Ga0105242_10175642 Ga0105242_101756423 134
208 3300009176 Ga0105242_10670360 Ga0105242_106703602 134
209 3300009177 Ga0105248_10533155 Ga0105248_105331552 134
210 3300013297 Ga0157378_11345598 Ga0157378_113455982 134
211 3300013308 Ga0157375_11625530 Ga0157375_116255302 134
212 3300025907 Ga0207645_10477329 Ga0207645_104773293 134
213 3300025927 Ga0207687_10215708 Ga0207687_102157082 134
214 3300025934 Ga0207686_10196437 Ga0207686_101964373 134
215 3300025935 Ga0207709_10763838 Ga0207709_107638382 134
216 3300025941 Ga0207711_10378493 Ga0207711_103784932 134
217 3300025942 Ga0207689_10221100 Ga0207689_102211002 134
218 3300031712 Ga0265342_10642446 Ga0265342_106424461 134
219 3300036401 Ga0373937_0689278 Ga0373937_0689278_407_826 134
220 3300047318 Ga0495636_0493920 Ga0495636_0493920_97_516 134
221 3300004800 Ga0058861_11970607 Ga0058861_119706071 135
222 3300005329 Ga0070683_100031104 Ga0070683_1000311045 135
223 3300005336 Ga0070680_100789521 Ga0070680_1007895212 135
224 3300005455 Ga0070663_100958458 Ga0070663_1009584582 135
225 3300005458 Ga0070681_10971764 Ga0070681_109717642 135
226 3300005530 Ga0070679_100357192 Ga0070679_1003571922 135
227 3300005843 Ga0068860_101565299 Ga0068860_1015652991 135
228 3300009551 Ga0105238_11027829 Ga0105238_110278291 135
229 3300013104 Ga0157370_10168985 Ga0157370_101689852 135
230 3300013104 Ga0157370_10202579 Ga0157370_102025792 135
231 3300013105 Ga0157369_10204034 Ga0157369_102040342 135
232 3300013105 Ga0157369_11293462 Ga0157369_112934622 135
233 3300020069 Ga0197907_11021850 Ga0197907_110218501 135
234 3300020080 Ga0206350_10061381 Ga0206350_100613812 135
235 3300021388 Ga0213875_10230295 Ga0213875_102302952 135
236 3300022467 Ga0224712_10033400 Ga0224712_100334001 135
237 3300025944 Ga0207661_10191573 Ga0207661_101915731 135
238 3300026067 Ga0207678_11094812 Ga0207678_110948122 135
239 3300037853 Ga0436364_1403847 Ga0436364_1403847_332_739 135

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03965

Penicillinase_R

Penicillinase repressor

6

119

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lb5-assembly1.cif.gz_B crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.8916 8 71
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.88 8 71
4ija-assembly1.cif.gz_A structure of s. aureus methicillin resistance factor mecr2 0.8798 9 69
7ne9-assembly1.cif.gz_DDD a single sensor controls large variations in zinc quotas in a marine cyanobacterium 0.8734 4 72
6j0e-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.8717 7 69
ID Description Score Start End Superfamily
af_Q58651_380_469_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9261 6 69 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8965 6 68 1.10.10.10
4lb5B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8916 8 71 1.10.10.10
af_Q58793_322_389_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8862 7 69 1.10.10.10
5j6xB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.88 8 71 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2N9MV04-F1-model_v4 Transcriptional repressor, CopY family 0.9516 1 76 GO:0003677
GO:0045892
AF-A0A7J7AZU7-F1-model_v4 deleted 0.9279 4 82
AF-A0A2N2VVW2-F1-model_v4 Transcriptional regulator 0.9245 4 76 GO:0003677
GO:0005737
GO:0045892
AF-H1DIA1-F1-model_v4 Penicillinase repressor 0.9201 1 77 GO:0003677
GO:0005737
GO:0045892
AF-A0A3A6BQ02-F1-model_v4 deleted 0.9152 4 82

Feature Viewer

pLDDT pTM Quality
77.84 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map