F351796
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 239 | 153 | 239 | 134 |
Family's Representative Sequence
| Representative Sequence | 3300005843|Ga0068860_101565299|Ga0068860_1015652991 |
| Length | 164 |
| Sequence | VAKTRFTRLELQILEALWANGKASIREIQEAFPEPRPAYTTIQTTVYRLETKKAVRRVRKISNAHIFEPIVSRDVTRHGVLDEILSFFGGRAQPMMAQLAEAGKLTRDDVRELEKLIEQRDQAADWRVEDAPIPSGAGNQGPRERRREGVRRDEVPRENKARPK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 18 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 29 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 30 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 31 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 32 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 34 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 37 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 38 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 39 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 40 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 41 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 42 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 43 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 44 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 45 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 70 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 71 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 72 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 73 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 74 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 103 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 105 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 106 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 107 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 108 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 109 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 110 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 111 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 112 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 113 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 114 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 115 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 116 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 117 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 118 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 119 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 120 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 121 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 122 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 123 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 124 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 125 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 126 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 127 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 128 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 129 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 130 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 147 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 148 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 149 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 150 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 151 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 152 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 153 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.33 |
| Metatranscriptomes | 1.67 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.42 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 96.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0058861_11970607 | 3300004800 | Bacteria | 1060 |
| 2 | Ga0065707_10009138 | 3300005295 | Unclassified | 2222 |
| 3 | Ga0065707_10172359 | 3300005295 | Bacteria | 1475 |
| 4 | Ga0070676_10760792 | 3300005328 | Bacteria | 712 |
| 5 | Ga0070683_100031104 | 3300005329 | Bacteria | 4850 |
| 6 | Ga0070690_101532933 | 3300005330 | Bacteria | 539 |
| 7 | Ga0068869_100224855 | 3300005334 | Bacteria | 1489 |
| 8 | Ga0070680_100789521 | 3300005336 | Bacteria | 818 |
| 9 | Ga0070687_101523582 | 3300005343 | Unclassified | 503 |
| 10 | Ga0070668_101344223 | 3300005347 | Unclassified | 650 |
| 11 | Ga0070675_100824947 | 3300005354 | Unclassified | 848 |
| 12 | Ga0070671_100254241 | 3300005355 | Unclassified | 1493 |
| 13 | Ga0070714_100005312 | 3300005435 | Bacteria | 9819 |
| 14 | Ga0070711_100075592 | 3300005439 | Bacteria | 2386 |
| 15 | Ga0070711_101763621 | 3300005439 | Unclassified | 543 |
| 16 | Ga0070708_100487188 | 3300005445 | Bacteria | 1163 |
| 17 | Ga0070663_100958458 | 3300005455 | Unclassified | 742 |
| 18 | Ga0070681_10971764 | 3300005458 | Unclassified | 769 |
| 19 | Ga0068867_100096026 | 3300005459 | Unclassified | 2256 |
| 20 | Ga0070706_100320345 | 3300005467 | Unclassified | 1446 |
| 21 | Ga0070706_102014392 | 3300005467 | Unclassified | 523 |
| 22 | Ga0070698_100193481 | 3300005471 | Bacteria | 1971 |
| 23 | Ga0070698_100428287 | 3300005471 | Bacteria | 1258 |
| 24 | Ga0070699_100635708 | 3300005518 | Bacteria | 974 |
| 25 | Ga0070679_100357192 | 3300005530 | Bacteria | 1409 |
| 26 | Ga0070684_100697700 | 3300005535 | Unclassified | 946 |
| 27 | Ga0070695_100095146 | 3300005545 | Unclassified | 1996 |
| 28 | Ga0070696_101301281 | 3300005546 | Bacteria | 617 |
| 29 | Ga0070665_100164121 | 3300005548 | Bacteria | 2224 |
| 30 | Ga0070704_101280414 | 3300005549 | Unclassified | 670 |
| 31 | Ga0070664_101285126 | 3300005564 | Bacteria | 691 |
| 32 | Ga0068857_102431101 | 3300005577 | Unclassified | 514 |
| 33 | Ga0068864_100127241 | 3300005618 | Unclassified | 2284 |
| 34 | Ga0068864_100849799 | 3300005618 | Bacteria | 899 |
| 35 | Ga0068863_100055448 | 3300005841 | Unclassified | 3753 |
| 36 | Ga0068863_100339255 | 3300005841 | Unclassified | 1462 |
| 37 | Ga0068860_100643384 | 3300005843 | Unclassified | 1068 |
| 38 | Ga0068860_101565299 | 3300005843 | Unclassified | 681 |
| 39 | Ga0070717_10535385 | 3300006028 | Unclassified | 1060 |
| 40 | Ga0070717_11920622 | 3300006028 | Unclassified | 534 |
| 41 | Ga0075364_10831369 | 3300006051 | Bacteria | 629 |
| 42 | Ga0070716_100515435 | 3300006173 | Unclassified | 885 |
| 43 | Ga0097621_100680368 | 3300006237 | Unclassified | 946 |
| 44 | Ga0097621_100691984 | 3300006237 | Unclassified | 938 |
| 45 | Ga0097621_100822249 | 3300006237 | Unclassified | 862 |
| 46 | Ga0097621_101218832 | 3300006237 | Unclassified | 709 |
| 47 | Ga0068871_100191041 | 3300006358 | Bacteria | 1764 |
| 48 | Ga0068871_100626075 | 3300006358 | Unclassified | 980 |
| 49 | Ga0068871_101300503 | 3300006358 | Unclassified | 684 |
| 50 | Ga0075428_100060422 | 3300006844 | Bacteria | 4150 |
| 51 | Ga0075428_100112921 | 3300006844 | Unclassified | 2960 |
| 52 | Ga0075428_100431424 | 3300006844 | Bacteria | 1412 |
| 53 | Ga0075428_101906845 | 3300006844 | Unclassified | 617 |
| 54 | Ga0075430_100015888 | 3300006846 | Bacteria | 6411 |
| 55 | Ga0075430_100048830 | 3300006846 | Bacteria | 3573 |
| 56 | Ga0075431_100033986 | 3300006847 | Bacteria | 5255 |
| 57 | Ga0075431_100079721 | 3300006847 | Bacteria | 3380 |
| 58 | Ga0075431_100087427 | 3300006847 | Unclassified | 3216 |
| 59 | Ga0075431_100428990 | 3300006847 | Unclassified | 1320 |
| 60 | Ga0075431_100793962 | 3300006847 | Unclassified | 920 |
| 61 | Ga0075433_10003457 | 3300006852 | Bacteria | 12193 |
| 62 | Ga0075433_10380132 | 3300006852 | Bacteria | 1247 |
| 63 | Ga0075433_10580502 | 3300006852 | Unclassified | 985 |
| 64 | Ga0075434_100066304 | 3300006871 | Bacteria | 3596 |
| 65 | Ga0075429_100105611 | 3300006880 | Unclassified | 2460 |
| 66 | Ga0075429_100140683 | 3300006880 | Bacteria | 2112 |
| 67 | Ga0075429_100174200 | 3300006880 | Bacteria | 1885 |
| 68 | Ga0075429_100279510 | 3300006880 | Unclassified | 1462 |
| 69 | Ga0068865_101063651 | 3300006881 | Bacteria | 711 |
| 70 | Ga0075435_100106861 | 3300007076 | Unclassified | 2324 |
| 71 | Ga0105240_10006679 | 3300009093 | Bacteria | 16914 |
| 72 | Ga0105240_10140973 | 3300009093 | Bacteria | 2882 |
| 73 | Ga0105240_10308523 | 3300009093 | Unclassified | 1808 |
| 74 | Ga0105240_11272997 | 3300009093 | Bacteria | 776 |
| 75 | Ga0111539_10002635 | 3300009094 | Bacteria | 23767 |
| 76 | Ga0111539_10028524 | 3300009094 | Bacteria | 6808 |
| 77 | Ga0111539_10051518 | 3300009094 | Bacteria | 4902 |
| 78 | Ga0111539_10427660 | 3300009094 | Unclassified | 1542 |
| 79 | Ga0111539_12370629 | 3300009094 | Bacteria | 616 |
| 80 | Ga0111539_12717130 | 3300009094 | Unclassified | 574 |
| 81 | Ga0105245_10879689 | 3300009098 | Bacteria | 937 |
| 82 | Ga0105245_11254403 | 3300009098 | Bacteria | 790 |
| 83 | Ga0105247_10348655 | 3300009101 | Unclassified | 1041 |
| 84 | Ga0114129_10042227 | 3300009147 | Bacteria | 6420 |
| 85 | Ga0114129_10163257 | 3300009147 | Bacteria | 3041 |
| 86 | Ga0114129_10164059 | 3300009147 | Unclassified | 3033 |
| 87 | Ga0114129_12486937 | 3300009147 | Bacteria | 619 |
| 88 | Ga0105243_10074734 | 3300009148 | Bacteria | 2749 |
| 89 | Ga0105242_10175642 | 3300009176 | Bacteria | 1886 |
| 90 | Ga0105242_10368810 | 3300009176 | Unclassified | 1331 |
| 91 | Ga0105242_10670360 | 3300009176 | Bacteria | 1011 |
| 92 | Ga0105242_11703036 | 3300009176 | Unclassified | 667 |
| 93 | Ga0105248_10010925 | 3300009177 | Bacteria | 10017 |
| 94 | Ga0105248_10310012 | 3300009177 | Unclassified | 1777 |
| 95 | Ga0105248_10456201 | 3300009177 | Unclassified | 1441 |
| 96 | Ga0105248_10533155 | 3300009177 | Bacteria | 1324 |
| 97 | Ga0105248_10592716 | 3300009177 | Bacteria | 1251 |
| 98 | Ga0105248_10701107 | 3300009177 | Unclassified | 1142 |
| 99 | Ga0105248_10891957 | 3300009177 | Bacteria | 1004 |
| 100 | Ga0105248_10894049 | 3300009177 | Unclassified | 1003 |
| 101 | Ga0105237_10001004 | 3300009545 | Bacteria | 37992 |
| 102 | Ga0105238_10207034 | 3300009551 | Unclassified | 1938 |
| 103 | Ga0105238_10611793 | 3300009551 | Unclassified | 1098 |
| 104 | Ga0105238_11027829 | 3300009551 | Bacteria | 845 |
| 105 | Ga0105249_10535139 | 3300009553 | Unclassified | 1221 |
| 106 | Ga0105239_10100498 | 3300010375 | Bacteria | 3199 |
| 107 | Ga0105246_11485386 | 3300011119 | Unclassified | 636 |
| 108 | Ga0157370_10168985 | 3300013104 | Bacteria | 2033 |
| 109 | Ga0157370_10202579 | 3300013104 | Bacteria | 1841 |
| 110 | Ga0157370_10703824 | 3300013104 | Bacteria | 922 |
| 111 | Ga0157369_10204034 | 3300013105 | Bacteria | 2074 |
| 112 | Ga0157369_11293462 | 3300013105 | Unclassified | 743 |
| 113 | Ga0157374_11907245 | 3300013296 | Unclassified | 620 |
| 114 | Ga0157378_11345598 | 3300013297 | Bacteria | 756 |
| 115 | Ga0163162_10242356 | 3300013306 | Unclassified | 1934 |
| 116 | Ga0163162_10536578 | 3300013306 | Unclassified | 1299 |
| 117 | Ga0157372_11396868 | 3300013307 | Bacteria | 807 |
| 118 | Ga0157375_10591433 | 3300013308 | Unclassified | 1269 |
| 119 | Ga0157375_11625530 | 3300013308 | Bacteria | 764 |
| 120 | Ga0163163_10101209 | 3300014325 | Bacteria | 2904 |
| 121 | Ga0163163_10842189 | 3300014325 | Unclassified | 980 |
| 122 | Ga0163163_10856900 | 3300014325 | Bacteria | 972 |
| 123 | Ga0157380_10285834 | 3300014326 | Unclassified | 1512 |
| 124 | Ga0157379_11097354 | 3300014968 | Bacteria | 762 |
| 125 | Ga0163161_10075592 | 3300017792 | Bacteria | 2472 |
| 126 | Ga0197907_11021850 | 3300020069 | Unclassified | 821 |
| 127 | Ga0206350_10061381 | 3300020080 | Bacteria | 1418 |
| 128 | Ga0213874_10259375 | 3300021377 | Unclassified | 643 |
| 129 | Ga0213875_10230295 | 3300021388 | Unclassified | 873 |
| 130 | Ga0213875_10425028 | 3300021388 | Unclassified | 635 |
| 131 | Ga0224712_10033400 | 3300022467 | Bacteria | 1883 |
| 132 | Ga0207710_10239238 | 3300025900 | Bacteria | 905 |
| 133 | Ga0207710_10399236 | 3300025900 | Unclassified | 705 |
| 134 | Ga0207645_10477329 | 3300025907 | Bacteria | 843 |
| 135 | Ga0207705_10188983 | 3300025909 | Unclassified | 1557 |
| 136 | Ga0207684_11626640 | 3300025910 | Unclassified | 522 |
| 137 | Ga0207695_10048314 | 3300025913 | Unclassified | 4495 |
| 138 | Ga0207695_10143293 | 3300025913 | Bacteria | 2336 |
| 139 | Ga0207695_10772932 | 3300025913 | Bacteria | 841 |
| 140 | Ga0207671_10050073 | 3300025914 | Unclassified | 3093 |
| 141 | Ga0207663_10095129 | 3300025916 | Bacteria | 1987 |
| 142 | Ga0207694_10623289 | 3300025924 | Unclassified | 908 |
| 143 | Ga0207650_11878069 | 3300025925 | Unclassified | 506 |
| 144 | Ga0207659_10863313 | 3300025926 | Unclassified | 778 |
| 145 | Ga0207687_10215708 | 3300025927 | Bacteria | 1508 |
| 146 | Ga0207700_10215387 | 3300025928 | Unclassified | 1625 |
| 147 | Ga0207700_11816094 | 3300025928 | Unclassified | 536 |
| 148 | Ga0207664_10329297 | 3300025929 | Unclassified | 1349 |
| 149 | Ga0207644_10213055 | 3300025931 | Unclassified | 1528 |
| 150 | Ga0207686_10196437 | 3300025934 | Bacteria | 1442 |
| 151 | Ga0207686_11345018 | 3300025934 | Unclassified | 587 |
| 152 | Ga0207709_10763838 | 3300025935 | Bacteria | 778 |
| 153 | Ga0207665_10465139 | 3300025939 | Unclassified | 972 |
| 154 | Ga0207711_10378493 | 3300025941 | Bacteria | 1313 |
| 155 | Ga0207711_10855164 | 3300025941 | Unclassified | 846 |
| 156 | Ga0207711_10860097 | 3300025941 | Bacteria | 844 |
| 157 | Ga0207711_11078867 | 3300025941 | Unclassified | 744 |
| 158 | Ga0207689_10221100 | 3300025942 | Unclassified | 1565 |
| 159 | Ga0207661_10191573 | 3300025944 | Bacteria | 1793 |
| 160 | Ga0207668_11197959 | 3300025972 | Unclassified | 682 |
| 161 | Ga0207703_10017250 | 3300026035 | Bacteria | 5634 |
| 162 | Ga0207639_10804188 | 3300026041 | Bacteria | 876 |
| 163 | Ga0207678_11094812 | 3300026067 | Unclassified | 705 |
| 164 | Ga0207702_10474784 | 3300026078 | Bacteria | 1216 |
| 165 | Ga0207641_10009360 | 3300026088 | Bacteria | 8080 |
| 166 | Ga0207641_11005398 | 3300026088 | Unclassified | 831 |
| 167 | Ga0207648_10838702 | 3300026089 | Bacteria | 857 |
| 168 | Ga0207648_11712685 | 3300026089 | Unclassified | 590 |
| 169 | Ga0207674_10579208 | 3300026116 | Unclassified | 1084 |
| 170 | Ga0207428_10035496 | 3300027907 | Bacteria | 4075 |
| 171 | Ga0207428_10146107 | 3300027907 | Bacteria | 1802 |
| 172 | Ga0268266_10130654 | 3300028379 | Bacteria | 2246 |
| 173 | Ga0265342_10642446 | 3300031712 | Unclassified | 533 |
| 174 | Ga0307405_10060515 | 3300031731 | Bacteria | 2390 |
| 175 | Ga0307410_10053340 | 3300031852 | Unclassified | 2736 |
| 176 | Ga0307407_10239771 | 3300031903 | Bacteria | 1236 |
| 177 | Ga0307409_100047235 | 3300031995 | Bacteria | 3266 |
| 178 | Ga0307416_100654967 | 3300032002 | Bacteria | 1135 |
| 179 | Ga0307414_10132229 | 3300032004 | Unclassified | 1939 |
| 180 | Ga0307411_10214317 | 3300032005 | Bacteria | 1489 |
| 181 | Ga0373944_0020514 | 3300035089 | Bacteria | 1905 |
| 182 | Ga0373923_0025927 | 3300035111 | Bacteria | 2328 |
| 183 | Ga0373923_0171237 | 3300035111 | Unclassified | 994 |
| 184 | Ga0373936_0025998 | 3300035113 | Bacteria | 2292 |
| 185 | Ga0373953_0476063 | 3300035117 | Unclassified | 553 |
| 186 | Ga0373954_0074971 | 3300035118 | Bacteria | 1611 |
| 187 | Ga0373954_0141591 | 3300035118 | Bacteria | 1173 |
| 188 | Ga0373954_0469919 | 3300035118 | Unclassified | 623 |
| 189 | Ga0373943_0070630 | 3300035170 | Bacteria | 1767 |
| 190 | Ga0373946_0022265 | 3300035171 | Bacteria | 2465 |
| 191 | Ga0373955_0347106 | 3300035172 | Bacteria | 899 |
| 192 | Ga0373955_0405646 | 3300035172 | Unclassified | 828 |
| 193 | Ga0373924_0327008 | 3300035410 | Unclassified | 682 |
| 194 | Ga0373935_0667326 | 3300035692 | Unclassified | 763 |
| 195 | Ga0373927_0449317 | 3300035695 | Unclassified | 851 |
| 196 | Ga0373947_0102135 | 3300035725 | Bacteria | 1803 |
| 197 | Ga0373937_0689278 | 3300036401 | Bacteria | 968 |
| 198 | Ga0373937_0990458 | 3300036401 | Unclassified | 789 |
| 199 | Ga0373937_1197543 | 3300036401 | Unclassified | 708 |
| 200 | Ga0373937_1240117 | 3300036401 | Unclassified | 694 |
| 201 | Ga0373925_0033964 | 3300037068 | Bacteria | 3759 |
| 202 | Ga0436364_0479586 | 3300037853 | Unclassified | 1159 |
| 203 | Ga0436364_0705464 | 3300037853 | Unclassified | 628 |
| 204 | Ga0436364_1403847 | 3300037853 | Unclassified | 914 |
| 205 | Ga0436363_1139167 | 3300039450 | Unclassified | 1186 |
| 206 | Ga0436362_0247417 | 3300039453 | Bacteria | 713 |
| 207 | Ga0451835_0016953 | 3300041492 | Unclassified | 524 |
| 208 | Ga0495629_0033372 | 3300046459 | Unclassified | 3641 |
| 209 | Ga0495594_0191097 | 3300046499 | Bacteria | 1166 |
| 210 | Ga0495608_0276631 | 3300046511 | Unclassified | 1043 |
| 211 | Ga0495618_0179181 | 3300046514 | Bacteria | 1347 |
| 212 | Ga0495628_0429460 | 3300046516 | Bacteria | 962 |
| 213 | Ga0495630_0523755 | 3300046517 | Unclassified | 909 |
| 214 | Ga0495586_0129642 | 3300046535 | Unclassified | 1412 |
| 215 | Ga0495667_0055063 | 3300046559 | Bacteria | 2616 |
| 216 | Ga0495634_0181367 | 3300046642 | Unclassified | 1318 |
| 217 | Ga0495657_0009126 | 3300046675 | Bacteria | 7537 |
| 218 | Ga0495657_0075921 | 3300046675 | Bacteria | 2184 |
| 219 | Ga0495599_0736336 | 3300046678 | Unclassified | 566 |
| 220 | Ga0495613_0148442 | 3300046689 | Bacteria | 1673 |
| 221 | Ga0495613_0348769 | 3300046689 | Bacteria | 1017 |
| 222 | Ga0495636_0493920 | 3300047318 | Unclassified | 591 |
| 223 | Ga0495674_0046759 | 3300047319 | Bacteria | 3841 |
| 224 | Ga0495674_0098047 | 3300047319 | Bacteria | 2496 |
| 225 | Ga0495680_0754781 | 3300047322 | Unclassified | 639 |
| 226 | Ga0495684_0219768 | 3300047471 | Bacteria | 1393 |
| 227 | Ga0495684_0828461 | 3300047471 | Unclassified | 602 |
| 228 | nmdc:mga05p37_130358_c1 | 3300050507 | Unclassified | 3085 |
| 229 | nmdc:mga05p37_15_c1 | 3300050507 | Bacteria | 134650 |
| 230 | nmdc:mga05p37_383826_c1 | 3300050507 | Bacteria | 1645 |
| 231 | nmdc:mga05p37_57801_c1 | 3300050507 | Unclassified | 4777 |
| 232 | nmdc:mga09592_106299_c1 | 3300050508 | Unclassified | 2407 |
| 233 | nmdc:mga0qj67_44537_c1 | 3300050509 | Unclassified | 3498 |
| 234 | nmdc:mga06r32_174989_c1 | 3300050510 | Unclassified | 2131 |
| 235 | nmdc:mga08y16_10196_c1 | 3300050511 | Bacteria | 9868 |
| 236 | nmdc:mga08y16_70869_c1 | 3300050511 | Unclassified | 3633 |
| 237 | nmdc:mga0n895_106265_c1 | 3300050512 | Bacteria | 2820 |
| 238 | nmdc:mga0rr50_844741_c1 | 3300050513 | Unclassified | 781 |
| 239 | nmdc:mga0a205_1842_c1 | 3300050515 | Bacteria | 18355 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006844 | Ga0075428_100060422 | Ga0075428_1000604223 | 131 |
| 2 | 3300006844 | Ga0075428_100431424 | Ga0075428_1004314241 | 131 |
| 3 | 3300006844 | Ga0075428_101906845 | Ga0075428_1019068451 | 131 |
| 4 | 3300006846 | Ga0075430_100015888 | Ga0075430_1000158885 | 131 |
| 5 | 3300006846 | Ga0075430_100048830 | Ga0075430_1000488303 | 131 |
| 6 | 3300006847 | Ga0075431_100079721 | Ga0075431_1000797213 | 131 |
| 7 | 3300006847 | Ga0075431_100428990 | Ga0075431_1004289901 | 131 |
| 8 | 3300006847 | Ga0075431_100793962 | Ga0075431_1007939622 | 131 |
| 9 | 3300006880 | Ga0075429_100140683 | Ga0075429_1001406832 | 131 |
| 10 | 3300006880 | Ga0075429_100279510 | Ga0075429_1002795103 | 131 |
| 11 | 3300009094 | Ga0111539_10002635 | Ga0111539_1000263524 | 131 |
| 12 | 3300009094 | Ga0111539_10051518 | Ga0111539_100515184 | 131 |
| 13 | 3300009094 | Ga0111539_10427660 | Ga0111539_104276602 | 131 |
| 14 | 3300009094 | Ga0111539_12370629 | Ga0111539_123706291 | 131 |
| 15 | 3300013306 | Ga0163162_10536578 | Ga0163162_105365782 | 131 |
| 16 | 3300026089 | Ga0207648_11712685 | Ga0207648_117126851 | 131 |
| 17 | 3300046499 | Ga0495594_0191097 | Ga0495594_0191097_345_743 | 131 |
| 18 | 3300005295 | Ga0065707_10009138 | Ga0065707_100091382 | 132 |
| 19 | 3300005295 | Ga0065707_10172359 | Ga0065707_101723592 | 132 |
| 20 | 3300005435 | Ga0070714_100005312 | Ga0070714_10000531211 | 132 |
| 21 | 3300005471 | Ga0070698_100193481 | Ga0070698_1001934811 | 132 |
| 22 | 3300006844 | Ga0075428_100112921 | Ga0075428_1001129215 | 132 |
| 23 | 3300006852 | Ga0075433_10580502 | Ga0075433_105805022 | 132 |
| 24 | 3300009094 | Ga0111539_10028524 | Ga0111539_100285245 | 132 |
| 25 | 3300009147 | Ga0114129_10042227 | Ga0114129_100422278 | 132 |
| 26 | 3300009177 | Ga0105248_10701107 | Ga0105248_107011072 | 132 |
| 27 | 3300013296 | Ga0157374_11907245 | Ga0157374_119072451 | 132 |
| 28 | 3300021377 | Ga0213874_10259375 | Ga0213874_102593752 | 132 |
| 29 | 3300021388 | Ga0213875_10425028 | Ga0213875_104250282 | 132 |
| 30 | 3300025929 | Ga0207664_10329297 | Ga0207664_103292972 | 132 |
| 31 | 3300026078 | Ga0207702_10474784 | Ga0207702_104747842 | 132 |
| 32 | 3300027907 | Ga0207428_10146107 | Ga0207428_101461072 | 132 |
| 33 | 3300031731 | Ga0307405_10060515 | Ga0307405_100605152 | 132 |
| 34 | 3300031852 | Ga0307410_10053340 | Ga0307410_100533403 | 132 |
| 35 | 3300031903 | Ga0307407_10239771 | Ga0307407_102397712 | 132 |
| 36 | 3300031995 | Ga0307409_100047235 | Ga0307409_1000472352 | 132 |
| 37 | 3300032002 | Ga0307416_100654967 | Ga0307416_1006549672 | 132 |
| 38 | 3300032004 | Ga0307414_10132229 | Ga0307414_101322292 | 132 |
| 39 | 3300032005 | Ga0307411_10214317 | Ga0307411_102143171 | 132 |
| 40 | 3300035118 | Ga0373954_0469919 | Ga0373954_0469919_157_564 | 132 |
| 41 | 3300037853 | Ga0436364_0479586 | Ga0436364_0479586_186_584 | 132 |
| 42 | 3300039450 | Ga0436363_1139167 | Ga0436363_1139167_659_1057 | 132 |
| 43 | 3300050507 | nmdc:mga05p37_15_c1 | nmdc:mga05p37_15_c1_42333_42734 | 132 |
| 44 | 3300050511 | nmdc:mga08y16_10196_c1 | nmdc:mga08y16_10196_c1_801_1202 | 132 |
| 45 | 3300005330 | Ga0070690_101532933 | Ga0070690_1015329331 | 133 |
| 46 | 3300005343 | Ga0070687_101523582 | Ga0070687_1015235821 | 133 |
| 47 | 3300005347 | Ga0070668_101344223 | Ga0070668_1013442231 | 133 |
| 48 | 3300005354 | Ga0070675_100824947 | Ga0070675_1008249471 | 133 |
| 49 | 3300005355 | Ga0070671_100254241 | Ga0070671_1002542412 | 133 |
| 50 | 3300005439 | Ga0070711_100075592 | Ga0070711_1000755922 | 133 |
| 51 | 3300005439 | Ga0070711_101763621 | Ga0070711_1017636211 | 133 |
| 52 | 3300005445 | Ga0070708_100487188 | Ga0070708_1004871882 | 133 |
| 53 | 3300005459 | Ga0068867_100096026 | Ga0068867_1000960262 | 133 |
| 54 | 3300005467 | Ga0070706_100320345 | Ga0070706_1003203451 | 133 |
| 55 | 3300005467 | Ga0070706_102014392 | Ga0070706_1020143921 | 133 |
| 56 | 3300005471 | Ga0070698_100428287 | Ga0070698_1004282872 | 133 |
| 57 | 3300005518 | Ga0070699_100635708 | Ga0070699_1006357082 | 133 |
| 58 | 3300005535 | Ga0070684_100697700 | Ga0070684_1006977001 | 133 |
| 59 | 3300005545 | Ga0070695_100095146 | Ga0070695_1000951464 | 133 |
| 60 | 3300005546 | Ga0070696_101301281 | Ga0070696_1013012811 | 133 |
| 61 | 3300005548 | Ga0070665_100164121 | Ga0070665_1001641212 | 133 |
| 62 | 3300005549 | Ga0070704_101280414 | Ga0070704_1012804141 | 133 |
| 63 | 3300005564 | Ga0070664_101285126 | Ga0070664_1012851262 | 133 |
| 64 | 3300005577 | Ga0068857_102431101 | Ga0068857_1024311011 | 133 |
| 65 | 3300005618 | Ga0068864_100127241 | Ga0068864_1001272412 | 133 |
| 66 | 3300005618 | Ga0068864_100849799 | Ga0068864_1008497992 | 133 |
| 67 | 3300005841 | Ga0068863_100055448 | Ga0068863_1000554483 | 133 |
| 68 | 3300005841 | Ga0068863_100339255 | Ga0068863_1003392552 | 133 |
| 69 | 3300005843 | Ga0068860_100643384 | Ga0068860_1006433842 | 133 |
| 70 | 3300006028 | Ga0070717_10535385 | Ga0070717_105353852 | 133 |
| 71 | 3300006028 | Ga0070717_11920622 | Ga0070717_119206221 | 133 |
| 72 | 3300006051 | Ga0075364_10831369 | Ga0075364_108313692 | 133 |
| 73 | 3300006173 | Ga0070716_100515435 | Ga0070716_1005154352 | 133 |
| 74 | 3300006237 | Ga0097621_100680368 | Ga0097621_1006803681 | 133 |
| 75 | 3300006237 | Ga0097621_100691984 | Ga0097621_1006919842 | 133 |
| 76 | 3300006237 | Ga0097621_100822249 | Ga0097621_1008222492 | 133 |
| 77 | 3300006237 | Ga0097621_101218832 | Ga0097621_1012188322 | 133 |
| 78 | 3300006358 | Ga0068871_100191041 | Ga0068871_1001910412 | 133 |
| 79 | 3300006358 | Ga0068871_100626075 | Ga0068871_1006260751 | 133 |
| 80 | 3300006358 | Ga0068871_101300503 | Ga0068871_1013005032 | 133 |
| 81 | 3300006847 | Ga0075431_100033986 | Ga0075431_1000339863 | 133 |
| 82 | 3300006847 | Ga0075431_100087427 | Ga0075431_1000874274 | 133 |
| 83 | 3300006852 | Ga0075433_10003457 | Ga0075433_100034576 | 133 |
| 84 | 3300006852 | Ga0075433_10380132 | Ga0075433_103801322 | 133 |
| 85 | 3300006871 | Ga0075434_100066304 | Ga0075434_1000663044 | 133 |
| 86 | 3300006880 | Ga0075429_100105611 | Ga0075429_1001056112 | 133 |
| 87 | 3300006880 | Ga0075429_100174200 | Ga0075429_1001742002 | 133 |
| 88 | 3300006881 | Ga0068865_101063651 | Ga0068865_1010636512 | 133 |
| 89 | 3300007076 | Ga0075435_100106861 | Ga0075435_1001068612 | 133 |
| 90 | 3300009093 | Ga0105240_10006679 | Ga0105240_100066791 | 133 |
| 91 | 3300009093 | Ga0105240_10140973 | Ga0105240_101409734 | 133 |
| 92 | 3300009093 | Ga0105240_10308523 | Ga0105240_103085232 | 133 |
| 93 | 3300009093 | Ga0105240_11272997 | Ga0105240_112729972 | 133 |
| 94 | 3300009094 | Ga0111539_12717130 | Ga0111539_127171301 | 133 |
| 95 | 3300009098 | Ga0105245_10879689 | Ga0105245_108796892 | 133 |
| 96 | 3300009101 | Ga0105247_10348655 | Ga0105247_103486552 | 133 |
| 97 | 3300009147 | Ga0114129_10163257 | Ga0114129_101632572 | 133 |
| 98 | 3300009147 | Ga0114129_10164059 | Ga0114129_101640592 | 133 |
| 99 | 3300009147 | Ga0114129_12486937 | Ga0114129_124869372 | 133 |
| 100 | 3300009176 | Ga0105242_10368810 | Ga0105242_103688102 | 133 |
| 101 | 3300009176 | Ga0105242_11703036 | Ga0105242_117030361 | 133 |
| 102 | 3300009177 | Ga0105248_10010925 | Ga0105248_100109254 | 133 |
| 103 | 3300009177 | Ga0105248_10310012 | Ga0105248_103100122 | 133 |
| 104 | 3300009177 | Ga0105248_10456201 | Ga0105248_104562011 | 133 |
| 105 | 3300009177 | Ga0105248_10592716 | Ga0105248_105927162 | 133 |
| 106 | 3300009177 | Ga0105248_10891957 | Ga0105248_108919572 | 133 |
| 107 | 3300009177 | Ga0105248_10894049 | Ga0105248_108940491 | 133 |
| 108 | 3300009545 | Ga0105237_10001004 | Ga0105237_100010041 | 133 |
| 109 | 3300009551 | Ga0105238_10207034 | Ga0105238_102070341 | 133 |
| 110 | 3300009551 | Ga0105238_10611793 | Ga0105238_106117932 | 133 |
| 111 | 3300009553 | Ga0105249_10535139 | Ga0105249_105351392 | 133 |
| 112 | 3300010375 | Ga0105239_10100498 | Ga0105239_101004982 | 133 |
| 113 | 3300011119 | Ga0105246_11485386 | Ga0105246_114853862 | 133 |
| 114 | 3300013104 | Ga0157370_10703824 | Ga0157370_107038241 | 133 |
| 115 | 3300013306 | Ga0163162_10242356 | Ga0163162_102423562 | 133 |
| 116 | 3300013307 | Ga0157372_11396868 | Ga0157372_113968681 | 133 |
| 117 | 3300013308 | Ga0157375_10591433 | Ga0157375_105914332 | 133 |
| 118 | 3300014325 | Ga0163163_10101209 | Ga0163163_101012093 | 133 |
| 119 | 3300014325 | Ga0163163_10842189 | Ga0163163_108421892 | 133 |
| 120 | 3300014325 | Ga0163163_10856900 | Ga0163163_108569002 | 133 |
| 121 | 3300014326 | Ga0157380_10285834 | Ga0157380_102858342 | 133 |
| 122 | 3300014968 | Ga0157379_11097354 | Ga0157379_110973541 | 133 |
| 123 | 3300017792 | Ga0163161_10075592 | Ga0163161_100755923 | 133 |
| 124 | 3300025900 | Ga0207710_10239238 | Ga0207710_102392382 | 133 |
| 125 | 3300025900 | Ga0207710_10399236 | Ga0207710_103992362 | 133 |
| 126 | 3300025909 | Ga0207705_10188983 | Ga0207705_101889833 | 133 |
| 127 | 3300025910 | Ga0207684_11626640 | Ga0207684_116266401 | 133 |
| 128 | 3300025913 | Ga0207695_10048314 | Ga0207695_100483142 | 133 |
| 129 | 3300025913 | Ga0207695_10143293 | Ga0207695_101432932 | 133 |
| 130 | 3300025913 | Ga0207695_10772932 | Ga0207695_107729322 | 133 |
| 131 | 3300025914 | Ga0207671_10050073 | Ga0207671_100500733 | 133 |
| 132 | 3300025916 | Ga0207663_10095129 | Ga0207663_100951291 | 133 |
| 133 | 3300025924 | Ga0207694_10623289 | Ga0207694_106232892 | 133 |
| 134 | 3300025925 | Ga0207650_11878069 | Ga0207650_118780691 | 133 |
| 135 | 3300025926 | Ga0207659_10863313 | Ga0207659_108633131 | 133 |
| 136 | 3300025928 | Ga0207700_10215387 | Ga0207700_102153872 | 133 |
| 137 | 3300025928 | Ga0207700_11816094 | Ga0207700_118160941 | 133 |
| 138 | 3300025931 | Ga0207644_10213055 | Ga0207644_102130552 | 133 |
| 139 | 3300025934 | Ga0207686_11345018 | Ga0207686_113450181 | 133 |
| 140 | 3300025939 | Ga0207665_10465139 | Ga0207665_104651392 | 133 |
| 141 | 3300025941 | Ga0207711_10855164 | Ga0207711_108551641 | 133 |
| 142 | 3300025941 | Ga0207711_10860097 | Ga0207711_108600972 | 133 |
| 143 | 3300025941 | Ga0207711_11078867 | Ga0207711_110788672 | 133 |
| 144 | 3300025972 | Ga0207668_11197959 | Ga0207668_111979591 | 133 |
| 145 | 3300026035 | Ga0207703_10017250 | Ga0207703_100172503 | 133 |
| 146 | 3300026041 | Ga0207639_10804188 | Ga0207639_108041882 | 133 |
| 147 | 3300026088 | Ga0207641_10009360 | Ga0207641_100093602 | 133 |
| 148 | 3300026088 | Ga0207641_11005398 | Ga0207641_110053982 | 133 |
| 149 | 3300026089 | Ga0207648_10838702 | Ga0207648_108387022 | 133 |
| 150 | 3300026116 | Ga0207674_10579208 | Ga0207674_105792082 | 133 |
| 151 | 3300027907 | Ga0207428_10035496 | Ga0207428_100354962 | 133 |
| 152 | 3300028379 | Ga0268266_10130654 | Ga0268266_101306544 | 133 |
| 153 | 3300035089 | Ga0373944_0020514 | Ga0373944_0020514_923_1324 | 133 |
| 154 | 3300035111 | Ga0373923_0025927 | Ga0373923_0025927_282_683 | 133 |
| 155 | 3300035111 | Ga0373923_0171237 | Ga0373923_0171237_567_968 | 133 |
| 156 | 3300035113 | Ga0373936_0025998 | Ga0373936_0025998_1851_2252 | 133 |
| 157 | 3300035117 | Ga0373953_0476063 | Ga0373953_0476063_15_416 | 133 |
| 158 | 3300035118 | Ga0373954_0074971 | Ga0373954_0074971_963_1364 | 133 |
| 159 | 3300035118 | Ga0373954_0141591 | Ga0373954_0141591_272_673 | 133 |
| 160 | 3300035170 | Ga0373943_0070630 | Ga0373943_0070630_543_944 | 133 |
| 161 | 3300035171 | Ga0373946_0022265 | Ga0373946_0022265_1583_1984 | 133 |
| 162 | 3300035172 | Ga0373955_0347106 | Ga0373955_0347106_441_851 | 133 |
| 163 | 3300035172 | Ga0373955_0405646 | Ga0373955_0405646_361_762 | 133 |
| 164 | 3300035410 | Ga0373924_0327008 | Ga0373924_0327008_159_560 | 133 |
| 165 | 3300035692 | Ga0373935_0667326 | Ga0373935_0667326_145_546 | 133 |
| 166 | 3300035695 | Ga0373927_0449317 | Ga0373927_0449317_28_429 | 133 |
| 167 | 3300035725 | Ga0373947_0102135 | Ga0373947_0102135_142_543 | 133 |
| 168 | 3300036401 | Ga0373937_0990458 | Ga0373937_0990458_286_687 | 133 |
| 169 | 3300036401 | Ga0373937_1197543 | Ga0373937_1197543_285_686 | 133 |
| 170 | 3300036401 | Ga0373937_1240117 | Ga0373937_1240117_235_636 | 133 |
| 171 | 3300037068 | Ga0373925_0033964 | Ga0373925_0033964_2561_2962 | 133 |
| 172 | 3300037853 | Ga0436364_0705464 | Ga0436364_0705464_180_581 | 133 |
| 173 | 3300039453 | Ga0436362_0247417 | Ga0436362_0247417_123_524 | 133 |
| 174 | 3300041492 | Ga0451835_0016953 | Ga0451835_0016953_11_412 | 133 |
| 175 | 3300046459 | Ga0495629_0033372 | Ga0495629_0033372_1116_1517 | 133 |
| 176 | 3300046511 | Ga0495608_0276631 | Ga0495608_0276631_256_657 | 133 |
| 177 | 3300046514 | Ga0495618_0179181 | Ga0495618_0179181_810_1211 | 133 |
| 178 | 3300046516 | Ga0495628_0429460 | Ga0495628_0429460_468_869 | 133 |
| 179 | 3300046517 | Ga0495630_0523755 | Ga0495630_0523755_445_846 | 133 |
| 180 | 3300046535 | Ga0495586_0129642 | Ga0495586_0129642_904_1305 | 133 |
| 181 | 3300046559 | Ga0495667_0055063 | Ga0495667_0055063_63_464 | 133 |
| 182 | 3300046642 | Ga0495634_0181367 | Ga0495634_0181367_830_1231 | 133 |
| 183 | 3300046675 | Ga0495657_0009126 | Ga0495657_0009126_847_1248 | 133 |
| 184 | 3300046675 | Ga0495657_0075921 | Ga0495657_0075921_15_416 | 133 |
| 185 | 3300046678 | Ga0495599_0736336 | Ga0495599_0736336_97_498 | 133 |
| 186 | 3300046689 | Ga0495613_0148442 | Ga0495613_0148442_1152_1553 | 133 |
| 187 | 3300046689 | Ga0495613_0348769 | Ga0495613_0348769_134_535 | 133 |
| 188 | 3300047319 | Ga0495674_0046759 | Ga0495674_0046759_1348_1749 | 133 |
| 189 | 3300047319 | Ga0495674_0098047 | Ga0495674_0098047_2013_2414 | 133 |
| 190 | 3300047322 | Ga0495680_0754781 | Ga0495680_0754781_122_523 | 133 |
| 191 | 3300047471 | Ga0495684_0219768 | Ga0495684_0219768_690_1091 | 133 |
| 192 | 3300047471 | Ga0495684_0828461 | Ga0495684_0828461_38_439 | 133 |
| 193 | 3300050507 | nmdc:mga05p37_130358_c1 | nmdc:mga05p37_130358_c1_952_1353 | 133 |
| 194 | 3300050507 | nmdc:mga05p37_383826_c1 | nmdc:mga05p37_383826_c1_1044_1445 | 133 |
| 195 | 3300050507 | nmdc:mga05p37_57801_c1 | nmdc:mga05p37_57801_c1_3506_3910 | 133 |
| 196 | 3300050508 | nmdc:mga09592_106299_c1 | nmdc:mga09592_106299_c1_1588_1992 | 133 |
| 197 | 3300050509 | nmdc:mga0qj67_44537_c1 | nmdc:mga0qj67_44537_c1_2400_2804 | 133 |
| 198 | 3300050510 | nmdc:mga06r32_174989_c1 | nmdc:mga06r32_174989_c1_588_992 | 133 |
| 199 | 3300050511 | nmdc:mga08y16_70869_c1 | nmdc:mga08y16_70869_c1_132_560 | 133 |
| 200 | 3300050512 | nmdc:mga0n895_106265_c1 | nmdc:mga0n895_106265_c1_1967_2371 | 133 |
| 201 | 3300050513 | nmdc:mga0rr50_844741_c1 | nmdc:mga0rr50_844741_c1_281_682 | 133 |
| 202 | 3300050515 | nmdc:mga0a205_1842_c1 | nmdc:mga0a205_1842_c1_6227_6631 | 133 |
| 203 | 3300005328 | Ga0070676_10760792 | Ga0070676_107607921 | 134 |
| 204 | 3300005334 | Ga0068869_100224855 | Ga0068869_1002248551 | 134 |
| 205 | 3300009098 | Ga0105245_11254403 | Ga0105245_112544032 | 134 |
| 206 | 3300009148 | Ga0105243_10074734 | Ga0105243_100747341 | 134 |
| 207 | 3300009176 | Ga0105242_10175642 | Ga0105242_101756423 | 134 |
| 208 | 3300009176 | Ga0105242_10670360 | Ga0105242_106703602 | 134 |
| 209 | 3300009177 | Ga0105248_10533155 | Ga0105248_105331552 | 134 |
| 210 | 3300013297 | Ga0157378_11345598 | Ga0157378_113455982 | 134 |
| 211 | 3300013308 | Ga0157375_11625530 | Ga0157375_116255302 | 134 |
| 212 | 3300025907 | Ga0207645_10477329 | Ga0207645_104773293 | 134 |
| 213 | 3300025927 | Ga0207687_10215708 | Ga0207687_102157082 | 134 |
| 214 | 3300025934 | Ga0207686_10196437 | Ga0207686_101964373 | 134 |
| 215 | 3300025935 | Ga0207709_10763838 | Ga0207709_107638382 | 134 |
| 216 | 3300025941 | Ga0207711_10378493 | Ga0207711_103784932 | 134 |
| 217 | 3300025942 | Ga0207689_10221100 | Ga0207689_102211002 | 134 |
| 218 | 3300031712 | Ga0265342_10642446 | Ga0265342_106424461 | 134 |
| 219 | 3300036401 | Ga0373937_0689278 | Ga0373937_0689278_407_826 | 134 |
| 220 | 3300047318 | Ga0495636_0493920 | Ga0495636_0493920_97_516 | 134 |
| 221 | 3300004800 | Ga0058861_11970607 | Ga0058861_119706071 | 135 |
| 222 | 3300005329 | Ga0070683_100031104 | Ga0070683_1000311045 | 135 |
| 223 | 3300005336 | Ga0070680_100789521 | Ga0070680_1007895212 | 135 |
| 224 | 3300005455 | Ga0070663_100958458 | Ga0070663_1009584582 | 135 |
| 225 | 3300005458 | Ga0070681_10971764 | Ga0070681_109717642 | 135 |
| 226 | 3300005530 | Ga0070679_100357192 | Ga0070679_1003571922 | 135 |
| 227 | 3300005843 | Ga0068860_101565299 | Ga0068860_1015652991 | 135 |
| 228 | 3300009551 | Ga0105238_11027829 | Ga0105238_110278291 | 135 |
| 229 | 3300013104 | Ga0157370_10168985 | Ga0157370_101689852 | 135 |
| 230 | 3300013104 | Ga0157370_10202579 | Ga0157370_102025792 | 135 |
| 231 | 3300013105 | Ga0157369_10204034 | Ga0157369_102040342 | 135 |
| 232 | 3300013105 | Ga0157369_11293462 | Ga0157369_112934622 | 135 |
| 233 | 3300020069 | Ga0197907_11021850 | Ga0197907_110218501 | 135 |
| 234 | 3300020080 | Ga0206350_10061381 | Ga0206350_100613812 | 135 |
| 235 | 3300021388 | Ga0213875_10230295 | Ga0213875_102302952 | 135 |
| 236 | 3300022467 | Ga0224712_10033400 | Ga0224712_100334001 | 135 |
| 237 | 3300025944 | Ga0207661_10191573 | Ga0207661_101915731 | 135 |
| 238 | 3300026067 | Ga0207678_11094812 | Ga0207678_110948122 | 135 |
| 239 | 3300037853 | Ga0436364_1403847 | Ga0436364_1403847_332_739 | 135 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4lb5-assembly1.cif.gz_B | crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) | 0.8916 | 8 | 71 |
| 5j6x-assembly2.cif.gz_B | crystal structure of the apo-zalpha of zebrafish pkz | 0.88 | 8 | 71 |
| 4ija-assembly1.cif.gz_A | structure of s. aureus methicillin resistance factor mecr2 | 0.8798 | 9 | 69 |
| 7ne9-assembly1.cif.gz_DDD | a single sensor controls large variations in zinc quotas in a marine cyanobacterium | 0.8734 | 4 | 72 |
| 6j0e-assembly1.cif.gz_B | structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression | 0.8717 | 7 | 69 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58651_380_469_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9261 | 6 | 69 | 1.10.10.10 |
| af_Q57824_147_206_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8965 | 6 | 68 | 1.10.10.10 |
| 4lb5B00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8916 | 8 | 71 | 1.10.10.10 |
| af_Q58793_322_389_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8862 | 7 | 69 | 1.10.10.10 |
| 5j6xB00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.88 | 8 | 71 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N9MV04-F1-model_v4 | Transcriptional repressor, CopY family | 0.9516 | 1 | 76 |
GO:0003677
GO:0045892 |
| AF-A0A7J7AZU7-F1-model_v4 | deleted | 0.9279 | 4 | 82 |
|
| AF-A0A2N2VVW2-F1-model_v4 | Transcriptional regulator | 0.9245 | 4 | 76 |
GO:0003677
GO:0005737 GO:0045892 |
| AF-H1DIA1-F1-model_v4 | Penicillinase repressor | 0.9201 | 1 | 77 |
GO:0003677
GO:0005737 GO:0045892 |
| AF-A0A3A6BQ02-F1-model_v4 | deleted | 0.9152 | 4 | 82 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar