F351596

General Info

Members Datasets Scaffolds Average Seq Length
239 140 478 507

Family's Representative Sequence

Representative Sequence 3300005288|Ga0065714_10064457|Ga0065714_1006445738
Length 540
Sequence LKTYFALFSIATVASLITTPFIRRLCQRYKLLDIPLDGRRIHRIAVPRLGGLALYISCLAALSMLPFVDNLLTQTLSGMKPEFLTLFVPATLVLLLGGYDDLKGANATVKFVGLGLIATLFYAMGGRIDALSVPLFGSVQLSPLVSFIITIVWLVGITNAFNLIDGMDGLASGAALFSSLVILGVSISQERTLMIVVSLVLCGALAGFLRYNFNPASIFLGDSGSLFTGFLLAALSVLGTQKATTAVAIAVPILAFGFPMVDTAMTMGRRLLSRKPVFQGDNEHIHHMLLARGWSQKRAALVLYGVCALFGLVALIFPATGSRLTGFMLFVISVAVIIAVGHLRYHEVDELRAGVKRTVGDRRLRVANNIRVRRAAMALSKASDLHEMFEATHHLLDFGEFSFANAQVGQPGCADMNERAFQASLQRHPKQLLEFRNGRVLWSWSGNGDDETNRSCTEWSFRLPLVRDGVEWGWLNLYRGFESEPLLVDTNYLTDLFRREFTEAAARIFTLHELPRFVQSSSFSLLVDNHRQESNLKVEL

Samples

Sample ID Description Type Environment
1 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
117 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
120 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
121 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
124 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
125 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
126 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
129 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
130 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
131 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
132 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
133 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
134 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
135 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
136 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
137 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
138 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
139 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
140 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.84
Rhizosphere 99.16
Stem 0
Stem Tuber 0
Unclassified 10.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065714_10064457 3300005288 Bacteria 69065
2 CNAas_1000268 3300000532 Bacteria 5001
3 JGI24751J29686_10000033 3300002459 Bacteria 87652
4 Ga0065712_10067742 3300005290 Bacteria 73878
5 Ga0065712_10073011 3300005290 Bacteria 4535
6 Ga0065712_10074297 3300005290 Bacteria 4132
7 Ga0065712_10099915 3300005290 Bacteria 2077
8 Ga0065715_10021429 3300005293 Bacteria 2353
9 Ga0065715_10089083 3300005293 Bacteria 14762
10 Ga0065715_10100064 3300005293 Bacteria 3338
11 Ga0065715_10124348 3300005293 Bacteria 2156
12 Ga0065707_10004369 3300005295 Bacteria 3509
13 Ga0065707_10015109 3300005295 Bacteria 2717
14 Ga0070690_100011837 3300005330 Bacteria 5117
15 Ga0068869_100012698 3300005334 Bacteria 5572
16 Ga0068869_100028825 3300005334 Bacteria 3883
17 Ga0068869_100031109 3300005334 Bacteria 3753
18 Ga0070666_10098835 3300005335 Bacteria 2010
19 Ga0070680_100015958 3300005336 Bacteria 5900
20 Ga0070680_100056508 3300005336 Bacteria 3208
21 Ga0070682_100000123 3300005337 Bacteria 68616
22 Ga0068868_100005116 3300005338 Bacteria 9207
23 Ga0070660_100124922 3300005339 Unclassified 2055
24 Ga0070689_100009942 3300005340 Bacteria 6768
25 Ga0070687_100043011 3300005343 Bacteria 2293
26 Ga0070692_10051837 3300005345 Unclassified 2135
27 Ga0070669_100002372 3300005353 Bacteria 13620
28 Ga0070669_100006137 3300005353 Bacteria 8678
29 Ga0070669_100133323 3300005353 Bacteria 1908
30 Ga0070671_100008405 3300005355 Bacteria 8274
31 Ga0070688_100083207 3300005365 Bacteria 2076
32 Ga0070659_100006114 3300005366 Bacteria 8686
33 Ga0070667_100122742 3300005367 Bacteria 2261
34 Ga0070701_10043984 3300005438 Bacteria 2287
35 Ga0070705_100037909 3300005440 Bacteria 2722
36 Ga0070705_100040484 3300005440 Bacteria 2650
37 Ga0070705_100063950 3300005440 Bacteria 2196
38 Ga0070700_100008002 3300005441 Bacteria 5743
39 Ga0070694_100004466 3300005444 Bacteria 8412
40 Ga0070694_100036427 3300005444 Unclassified 3259
41 Ga0070694_100053880 3300005444 Bacteria 2724
42 Ga0070708_100001748 3300005445 Bacteria 16668
43 Ga0070708_100037812 3300005445 Bacteria 4213
44 Ga0070678_100081450 3300005456 Bacteria 2454
45 Ga0070681_10000100 3300005458 Bacteria 63828
46 Ga0070681_10162888 3300005458 Bacteria 2154
47 Ga0068867_100054231 3300005459 Bacteria 2962
48 Ga0070706_100000002 3300005467 Bacteria 326510
49 Ga0070706_100002199 3300005467 Bacteria 19858
50 Ga0070706_100011204 3300005467 Bacteria 8326
51 Ga0070706_100153757 3300005467 Unclassified 2148
52 Ga0070706_100195404 3300005467 Bacteria 1890
53 Ga0070707_100012888 3300005468 Bacteria 7809
54 Ga0070707_100052863 3300005468 Bacteria 3895
55 Ga0070698_100004755 3300005471 Bacteria 14905
56 Ga0070698_100005699 3300005471 Bacteria 13631
57 Ga0070698_100033332 3300005471 Bacteria 5335
58 Ga0070698_100040803 3300005471 Bacteria 4768
59 Ga0070699_100001009 3300005518 Bacteria 26204
60 Ga0070699_100001161 3300005518 Bacteria 24445
61 Ga0070699_100022801 3300005518 Bacteria 5395
62 Ga0070679_100000011 3300005530 Bacteria 162902
63 Ga0070697_100000184 3300005536 Bacteria 51536
64 Ga0070697_100022786 3300005536 Bacteria 4977
65 Ga0070697_100163869 3300005536 Bacteria 1879
66 Ga0070672_100054741 3300005543 Bacteria 3124
67 Ga0070686_100014730 3300005544 Bacteria 4513
68 Ga0070695_100051395 3300005545 Bacteria 2645
69 Ga0070695_100103832 3300005545 Unclassified 1918
70 Ga0070696_100011613 3300005546 Bacteria 5900
71 Ga0070696_100103937 3300005546 Bacteria 2039
72 Ga0070693_100001352 3300005547 Bacteria 11033
73 Ga0070704_100024398 3300005549 Bacteria 3968
74 Ga0070704_100024723 3300005549 Bacteria 3945
75 Ga0070664_100020327 3300005564 Bacteria 5466
76 Ga0070664_100020938 3300005564 Bacteria 5388
77 Ga0070664_100121280 3300005564 Unclassified 2289
78 Ga0068854_100107049 3300005578 Bacteria 2104
79 Ga0068856_100005794 3300005614 Bacteria 12175
80 Ga0070702_100010053 3300005615 Bacteria 4649
81 Ga0070702_100046533 3300005615 Bacteria 2459
82 Ga0068859_100004585 3300005617 Bacteria 14096
83 Ga0068859_100006103 3300005617 Bacteria 12237
84 Ga0068859_100029093 3300005617 Bacteria 5545
85 Ga0068859_100046291 3300005617 Bacteria 4369
86 Ga0068859_100048046 3300005617 Bacteria 4287
87 Ga0068859_100205790 3300005617 Bacteria 2053
88 Ga0068864_100002117 3300005618 Bacteria 16416
89 Ga0068864_100007936 3300005618 Bacteria 8747
90 Ga0068864_100165566 3300005618 Bacteria 2012
91 Ga0068861_100003332 3300005719 Bacteria 10632
92 Ga0068861_100063431 3300005719 Bacteria 2840
93 Ga0068851_10001982 3300005834 Bacteria 9003
94 Ga0068870_10020187 3300005840 Bacteria 3241
95 Ga0068863_100035677 3300005841 Bacteria 4735
96 Ga0068863_100073602 3300005841 Bacteria 3232
97 Ga0068863_100152052 3300005841 Unclassified 2215
98 Ga0068858_100055149 3300005842 Bacteria 3674
99 Ga0068858_100087769 3300005842 Bacteria 2893
100 Ga0068862_100008718 3300005844 Bacteria 8393
101 Ga0068862_100028295 3300005844 Unclassified 4718
102 Ga0081539_10000508 3300005985 Bacteria 80945
103 Ga0081539_10001267 3300005985 Bacteria 44584
104 Ga0097621_100005604 3300006237 Bacteria 8854
105 Ga0068871_100001835 3300006358 Bacteria 14349
106 Ga0075428_100046408 3300006844 Bacteria 4772
107 Ga0075433_10031842 3300006852 Bacteria 4512
108 Ga0075433_10036840 3300006852 Unclassified 4216
109 Ga0075433_10195832 3300006852 Bacteria 1798
110 Ga0075434_100027192 3300006871 Bacteria 5614
111 Ga0075434_100167143 3300006871 Unclassified 2220
112 Ga0075429_100174929 3300006880 Bacteria 1881
113 Ga0068865_100009979 3300006881 Bacteria 5900
114 Ga0075436_100007863 3300006914 Bacteria 7295
115 Ga0097620_100004586 3300006931 Bacteria 14096
116 Ga0097620_100006103 3300006931 Bacteria 12237
117 Ga0097620_100029093 3300006931 Bacteria 5545
118 Ga0097620_100046292 3300006931 Bacteria 4369
119 Ga0097620_100048046 3300006931 Bacteria 4287
120 Ga0097620_100205795 3300006931 Bacteria 2053
121 Ga0075435_100038995 3300007076 Unclassified 3790
122 Ga0111539_10035752 3300009094 Bacteria 6013
123 Ga0111539_10038492 3300009094 Bacteria 5768
124 Ga0105245_10126679 3300009098 Bacteria 2391
125 Ga0105247_10012091 3300009101 Bacteria 5187
126 Ga0114129_10103086 3300009147 Bacteria 3945
127 Ga0114129_10107049 3300009147 Bacteria 3862
128 Ga0114129_10308261 3300009147 Bacteria 2108
129 Ga0114129_10328721 3300009147 Unclassified 2030
130 Ga0114129_10381217 3300009147 Bacteria 1862
131 Ga0105243_10028835 3300009148 Bacteria 4265
132 Ga0105241_10044157 3300009174 Unclassified 3376
133 Ga0105241_10124607 3300009174 Bacteria 2079
134 Ga0105242_10008001 3300009176 Bacteria 8144
135 Ga0105248_10004079 3300009177 Bacteria 16149
136 Ga0105248_10006804 3300009177 Bacteria 12533
137 Ga0105248_10009150 3300009177 Bacteria 10894
138 Ga0105248_10138833 3300009177 Bacteria 2742
139 Ga0105248_10182442 3300009177 Bacteria 2365
140 Ga0105248_10253653 3300009177 Bacteria 1980
141 Ga0105237_10041717 3300009545 Bacteria 4627
142 Ga0105238_10018378 3300009551 Bacteria 7115
143 Ga0105249_10014088 3300009553 Bacteria 7069
144 Ga0105249_10212989 3300009553 Bacteria 1897
145 Ga0157373_10059939 3300013100 Bacteria 2697
146 Ga0157378_10015240 3300013297 Bacteria 6732
147 Ga0157378_10023681 3300013297 Bacteria 5401
148 Ga0163162_10004714 3300013306 Bacteria 13148
149 Ga0163162_10007410 3300013306 Bacteria 10673
150 Ga0163162_10008458 3300013306 Bacteria 10040
151 Ga0163162_10016255 3300013306 Bacteria 7276
152 Ga0157372_10014656 3300013307 Bacteria 8387
153 Ga0157375_10004802 3300013308 Bacteria 11745
154 Ga0157375_10009312 3300013308 Bacteria 8621
155 Ga0163163_10000263 3300014325 Bacteria 53159
156 Ga0163163_10008212 3300014325 Bacteria 9262
157 Ga0163163_10014104 3300014325 Bacteria 7338
158 Ga0163163_10015987 3300014325 Bacteria 6955
159 Ga0163163_10020884 3300014325 Bacteria 6175
160 Ga0163163_10075077 3300014325 Bacteria 3374
161 Ga0157380_10012645 3300014326 Bacteria 6126
162 Ga0157379_10058001 3300014968 Bacteria 3460
163 Ga0207656_10004300 3300025321 Bacteria 4960
164 Ga0207653_10002231 3300025885 Bacteria 6175
165 Ga0207680_10081797 3300025903 Bacteria 2031
166 Ga0207647_10005066 3300025904 Bacteria 9718
167 Ga0207643_10019429 3300025908 Bacteria 3723
168 Ga0207684_10000065 3300025910 Bacteria 194463
169 Ga0207684_10002879 3300025910 Bacteria 17073
170 Ga0207684_10021581 3300025910 Bacteria 5498
171 Ga0207707_10000028 3300025912 Bacteria 167115
172 Ga0207660_10001672 3300025917 Bacteria 14861
173 Ga0207657_10036363 3300025919 Bacteria 4408
174 Ga0207652_10000443 3300025921 Bacteria 42831
175 Ga0207646_10161027 3300025922 Unclassified 2025
176 Ga0207681_10001172 3300025923 Bacteria 16908
177 Ga0207681_10143694 3300025923 Bacteria 1780
178 Ga0207694_10004072 3300025924 Bacteria 11490
179 Ga0207650_10000046 3300025925 Bacteria 178190
180 Ga0207650_10010597 3300025925 Bacteria 6331
181 Ga0207650_10055944 3300025925 Bacteria 2930
182 Ga0207687_10046494 3300025927 Bacteria 3005
183 Ga0207686_10039048 3300025934 Unclassified 2878
184 Ga0207670_10001571 3300025936 Bacteria 11970
185 Ga0207691_10035159 3300025940 Bacteria 4654
186 Ga0207691_10188545 3300025940 Bacteria 1800
187 Ga0207711_10018755 3300025941 Bacteria 5752
188 Ga0207689_10000672 3300025942 Bacteria 32629
189 Ga0207689_10006536 3300025942 Bacteria 10286
190 Ga0207689_10023938 3300025942 Bacteria 5122
191 Ga0207689_10045942 3300025942 Bacteria 3610
192 Ga0207679_10095639 3300025945 Bacteria 2309
193 Ga0207651_10133446 3300025960 Unclassified 1905
194 Ga0207658_10091851 3300025986 Bacteria 2357
195 Ga0207639_10050172 3300026041 Bacteria 3168
196 Ga0207708_10000133 3300026075 Bacteria 58317
197 Ga0207708_10020633 3300026075 Unclassified 4969
198 Ga0207708_10053226 3300026075 Bacteria 3084
199 Ga0207641_10244428 3300026088 Bacteria 1674
200 Ga0207648_10025338 3300026089 Bacteria 5286
201 Ga0207648_10042873 3300026089 Bacteria 3973
202 Ga0207676_10002100 3300026095 Bacteria 14423
203 Ga0207676_10030987 3300026095 Unclassified 4019
204 Ga0207676_10087530 3300026095 Bacteria 2548
205 Ga0207676_10115554 3300026095 Bacteria 2253
206 Ga0207674_10003523 3300026116 Bacteria 19104
207 Ga0207674_10217055 3300026116 Bacteria 1861
208 Ga0207675_100004965 3300026118 Bacteria 12822
209 Ga0207675_100095482 3300026118 Unclassified 2797
210 Ga0268265_10012666 3300028380 Bacteria 5722
211 Ga0268264_10032462 3300028381 Bacteria 4284
212 Ga0307406_10005684 3300031901 Bacteria 6822
213 Ga0307412_10038398 3300031911 Bacteria 3083
214 Ga0307409_100050492 3300031995 Bacteria 3177
215 Ga0307411_10028073 3300032005 Bacteria 3416
216 Ga0373951_0000528 3300035091 Bacteria 10772
217 Ga0373942_0002342 3300035207 Bacteria 4614
218 Ga0395900_0156306 3300037418 Bacteria 2329
219 Ga0495663_0001796 3300046525 Bacteria 6636
220 Ga0495598_0000382 3300046537 Bacteria 7958
221 Ga0495621_0000008 3300046539 Bacteria 41319
222 Ga0496108_0139731 3300048911 Unclassified 2087
223 Ga0496112_0083889 3300048915 Bacteria 3152
224 Ga0501202_000604 3300049652 Bacteria 5270
225 Ga0501216_001592 3300049660 Bacteria 3098
226 Ga0501223_002827 3300049663 Bacteria 3806
227 Ga0501227_003389 3300049665 Bacteria 3454
228 Ga0501235_002129 3300049669 Bacteria 4254
229 nmdc:mga05p37_179887_c1 3300050507 Bacteria 2573
230 nmdc:mga09592_137943_c1 3300050508 Bacteria 2101
231 nmdc:mga06r32_213563_c1 3300050510 Unclassified 1917
232 nmdc:mga08y16_1886_c1 3300050511 Bacteria 21338
233 nmdc:mga08y16_39196_c1 3300050511 Bacteria 4971
234 nmdc:mga0n895_268748_c1 3300050512 Unclassified 1730
235 nmdc:mga0rr50_10155_c1 3300050513 Bacteria 5960
236 nmdc:mga08x19_29583_c1 3300050514 Bacteria 3436
237 nmdc:mga0a205_141217_c1 3300050515 Unclassified 2309
238 nmdc:mga0a205_32870_c1 3300050515 Bacteria 4974
239 nmdc:mga0a205_42258_c1 3300050515 Unclassified 4392
240 Ga0065714_10064457
241 CNAas_1000268
242 JGI24751J29686_10000033
243 Ga0065712_10067742
244 Ga0065712_10073011
245 Ga0065712_10074297
246 Ga0065712_10099915
247 Ga0065715_10021429
248 Ga0065715_10089083
249 Ga0065715_10100064
250 Ga0065715_10124348
251 Ga0065707_10004369
252 Ga0065707_10015109
253 Ga0070690_100011837
254 Ga0068869_100012698
255 Ga0068869_100028825
256 Ga0068869_100031109
257 Ga0070666_10098835
258 Ga0070680_100015958
259 Ga0070680_100056508
260 Ga0070682_100000123
261 Ga0068868_100005116
262 Ga0070660_100124922
263 Ga0070689_100009942
264 Ga0070687_100043011
265 Ga0070692_10051837
266 Ga0070669_100002372
267 Ga0070669_100006137
268 Ga0070669_100133323
269 Ga0070671_100008405
270 Ga0070688_100083207
271 Ga0070659_100006114
272 Ga0070667_100122742
273 Ga0070701_10043984
274 Ga0070705_100037909
275 Ga0070705_100040484
276 Ga0070705_100063950
277 Ga0070700_100008002
278 Ga0070694_100004466
279 Ga0070694_100036427
280 Ga0070694_100053880
281 Ga0070708_100001748
282 Ga0070708_100037812
283 Ga0070678_100081450
284 Ga0070681_10000100
285 Ga0070681_10162888
286 Ga0068867_100054231
287 Ga0070706_100000002
288 Ga0070706_100002199
289 Ga0070706_100011204
290 Ga0070706_100153757
291 Ga0070706_100195404
292 Ga0070707_100012888
293 Ga0070707_100052863
294 Ga0070698_100004755
295 Ga0070698_100005699
296 Ga0070698_100033332
297 Ga0070698_100040803
298 Ga0070699_100001009
299 Ga0070699_100001161
300 Ga0070699_100022801
301 Ga0070679_100000011
302 Ga0070697_100000184
303 Ga0070697_100022786
304 Ga0070697_100163869
305 Ga0070672_100054741
306 Ga0070686_100014730
307 Ga0070695_100051395
308 Ga0070695_100103832
309 Ga0070696_100011613
310 Ga0070696_100103937
311 Ga0070693_100001352
312 Ga0070704_100024398
313 Ga0070704_100024723
314 Ga0070664_100020327
315 Ga0070664_100020938
316 Ga0070664_100121280
317 Ga0068854_100107049
318 Ga0068856_100005794
319 Ga0070702_100010053
320 Ga0070702_100046533
321 Ga0068859_100004585
322 Ga0068859_100006103
323 Ga0068859_100029093
324 Ga0068859_100046291
325 Ga0068859_100048046
326 Ga0068859_100205790
327 Ga0068864_100002117
328 Ga0068864_100007936
329 Ga0068864_100165566
330 Ga0068861_100003332
331 Ga0068861_100063431
332 Ga0068851_10001982
333 Ga0068870_10020187
334 Ga0068863_100035677
335 Ga0068863_100073602
336 Ga0068863_100152052
337 Ga0068858_100055149
338 Ga0068858_100087769
339 Ga0068862_100008718
340 Ga0068862_100028295
341 Ga0081539_10000508
342 Ga0081539_10001267
343 Ga0097621_100005604
344 Ga0068871_100001835
345 Ga0075428_100046408
346 Ga0075433_10031842
347 Ga0075433_10036840
348 Ga0075433_10195832
349 Ga0075434_100027192
350 Ga0075434_100167143
351 Ga0075429_100174929
352 Ga0068865_100009979
353 Ga0075436_100007863
354 Ga0097620_100004586
355 Ga0097620_100006103
356 Ga0097620_100029093
357 Ga0097620_100046292
358 Ga0097620_100048046
359 Ga0097620_100205795
360 Ga0075435_100038995
361 Ga0111539_10035752
362 Ga0111539_10038492
363 Ga0105245_10126679
364 Ga0105247_10012091
365 Ga0114129_10103086
366 Ga0114129_10107049
367 Ga0114129_10308261
368 Ga0114129_10328721
369 Ga0114129_10381217
370 Ga0105243_10028835
371 Ga0105241_10044157
372 Ga0105241_10124607
373 Ga0105242_10008001
374 Ga0105248_10004079
375 Ga0105248_10006804
376 Ga0105248_10009150
377 Ga0105248_10138833
378 Ga0105248_10182442
379 Ga0105248_10253653
380 Ga0105237_10041717
381 Ga0105238_10018378
382 Ga0105249_10014088
383 Ga0105249_10212989
384 Ga0157373_10059939
385 Ga0157378_10015240
386 Ga0157378_10023681
387 Ga0163162_10004714
388 Ga0163162_10007410
389 Ga0163162_10008458
390 Ga0163162_10016255
391 Ga0157372_10014656
392 Ga0157375_10004802
393 Ga0157375_10009312
394 Ga0163163_10000263
395 Ga0163163_10008212
396 Ga0163163_10014104
397 Ga0163163_10015987
398 Ga0163163_10020884
399 Ga0163163_10075077
400 Ga0157380_10012645
401 Ga0157379_10058001
402 Ga0207656_10004300
403 Ga0207653_10002231
404 Ga0207680_10081797
405 Ga0207647_10005066
406 Ga0207643_10019429
407 Ga0207684_10000065
408 Ga0207684_10002879
409 Ga0207684_10021581
410 Ga0207707_10000028
411 Ga0207660_10001672
412 Ga0207657_10036363
413 Ga0207652_10000443
414 Ga0207646_10161027
415 Ga0207681_10001172
416 Ga0207681_10143694
417 Ga0207694_10004072
418 Ga0207650_10000046
419 Ga0207650_10010597
420 Ga0207650_10055944
421 Ga0207687_10046494
422 Ga0207686_10039048
423 Ga0207670_10001571
424 Ga0207691_10035159
425 Ga0207691_10188545
426 Ga0207711_10018755
427 Ga0207689_10000672
428 Ga0207689_10006536
429 Ga0207689_10023938
430 Ga0207689_10045942
431 Ga0207679_10095639
432 Ga0207651_10133446
433 Ga0207658_10091851
434 Ga0207639_10050172
435 Ga0207708_10000133
436 Ga0207708_10020633
437 Ga0207708_10053226
438 Ga0207641_10244428
439 Ga0207648_10025338
440 Ga0207648_10042873
441 Ga0207676_10002100
442 Ga0207676_10030987
443 Ga0207676_10087530
444 Ga0207676_10115554
445 Ga0207674_10003523
446 Ga0207674_10217055
447 Ga0207675_100004965
448 Ga0207675_100095482
449 Ga0268265_10012666
450 Ga0268264_10032462
451 Ga0307406_10005684
452 Ga0307412_10038398
453 Ga0307409_100050492
454 Ga0307411_10028073
455 Ga0373951_0000528
456 Ga0373942_0002342
457 Ga0395900_0156306
458 Ga0495663_0001796
459 Ga0495598_0000382
460 Ga0495621_0000008
461 Ga0496108_0139731
462 Ga0496112_0083889
463 Ga0501202_000604
464 Ga0501216_001592
465 Ga0501223_002827
466 Ga0501227_003389
467 Ga0501235_002129
468 nmdc:mga05p37_179887_c1
469 nmdc:mga09592_137943_c1
470 nmdc:mga06r32_213563_c1
471 nmdc:mga08y16_1886_c1
472 nmdc:mga08y16_39196_c1
473 nmdc:mga0n895_268748_c1
474 nmdc:mga0rr50_10155_c1
475 nmdc:mga08x19_29583_c1
476 nmdc:mga0a205_141217_c1
477 nmdc:mga0a205_32870_c1
478 nmdc:mga0a205_42258_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00953

Glycos_transf_4

Glycosyl transferase family 4

83

240

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5jnq-assembly1.cif.gz_A-2 mray tunicamycin complex 0.7418 2 343
6oyh-assembly2.cif.gz_C crystal structure of mray bound to carbacaprazamycin 0.726 3 337
5o5e-assembly1.cif.gz_A-2 crystal structure of human udp-n-acetylglucosamine-dolichyl-phosphate n-acetylglucosaminephosphotransferase (dpagt1) (v264g mutant) in complex with tunicamycin 0.7192 2 279
6oyh-assembly4.cif.gz_D crystal structure of mray bound to carbacaprazamycin 0.715 1 337
6oyz-assembly1.cif.gz_A crystal structure of mray bound to capuramycin 0.7144 3 337
ID Description Score Start End Superfamily
3trcA00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.563 367 512 3.30.450.40
af_Q800E7_236_438_3.30.450.40 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.5615 368 511 3.30.450.40
4g3kB00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.5601 366 513 3.30.450.40
af_P19323_185_355_3.30.450.40 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.5534 365 512 3.30.450.40
af_P37013_4_170_3.30.450.40 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.553 371 512 3.30.450.40
ID Description Score Start End GO Terms
AF-A0A4Q5ZV77-F1-model_v4 deleted 0.9252 1 248
AF-A0A7X8HHG8-F1-model_v4 Undecaprenyl/decaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase 0.9237 4 224 GO:0005886
GO:0009103
GO:0016780
GO:0044038
GO:0046872
GO:0071555
AF-A0A846NYC4-F1-model_v4 deleted 0.916 1 134
AF-A0A4Q5ZV77-F1-model_v4 deleted 0.9145 1 248
AF-A0A7X8HHG8-F1-model_v4 Undecaprenyl/decaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase 0.9111 4 224 GO:0005886
GO:0009103
GO:0016780
GO:0044038
GO:0046872
GO:0071555

Map