F351463

General Info

Members Datasets Scaffolds Average Seq Length
238 166 155 209

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2713897090|2715501787
Length 233
Sequence SCPNIPGSGAEPRPALPRFYPIFDSADWVARALACGARLIQLRIKDAPEDILRAEITRARDLARAHGAALVVNDHWRLAIELGCDWLHLGQGDLDDADLAAIRVAGLRLGVSTHDEAELDRALAVGPDYVALGPVWPTILKQMKWAPQGLDRVADWKRRVGTVPLVAIGGLTPERGRAALEAGADVVSAVTDITLNPDPERRMREWLAATAAAGASRPRTPAGYLDKEEGAER

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
3 2561511199 Enterobacter sp. R4-368 Isolate Nodule
4 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
5 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
6 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
7 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
8 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
9 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
10 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
11 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
12 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
13 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
14 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
15 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
16 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
17 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
18 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
19 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
20 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
21 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
22 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
23 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
24 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
25 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
26 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
27 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
28 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
29 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
30 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
31 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
32 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
33 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
34 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
35 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
36 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
37 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
38 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
39 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
40 2636415599 Klebsiella variicola DX120E Isolate Unclassified
41 2643221626 Ensifer sp. Root31 Isolate Unclassified
42 2643221698 Ensifer sp. Root142 Isolate Unclassified
43 2643221733 Bosea sp. Root381 Isolate Unclassified
44 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
45 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
46 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
47 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
48 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
49 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
50 2775507074 Klebsiella sp. D5A Isolate Unclassified
51 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
52 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
53 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
54 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
55 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
56 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
57 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
58 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
59 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
60 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
61 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
62 2909042592 Labrys sp. LIt4 Isolate Nodule
63 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
64 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
65 2932406140 Serratia sp. 2723 Isolate Rhizosphere
66 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
67 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
68 2937967321 Serratia sp. YC16 Isolate Unclassified
69 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
70 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
71 2939577877 Serratia sp. 509 Isolate Rhizosphere
72 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
73 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
74 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
75 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
76 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
77 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
78 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
79 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
80 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
81 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
82 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
83 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
84 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
85 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
86 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
87 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
93 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
94 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
95 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
103 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
107 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
114 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
117 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
118 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
119 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
120 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
126 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
127 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
128 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
129 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
130 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
131 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
132 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
133 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
134 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
135 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
136 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
137 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
138 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
141 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
142 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
143 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
144 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
145 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
146 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
147 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
148 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
149 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
152 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
153 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
154 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
155 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
156 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
157 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
158 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
161 640753048 Serratia proteamaculans 568 Isolate Endosphere
162 8004592986 Serratia sp. S119 Isolate Unclassified
163 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
164 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
165 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
166 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 65.13
Metatranscriptomes 0
Isolates 34.87

Biome Distribution

Category Percentage (%)
Aerial Root 0.84
Bulb 0
Endosphere 4.62
Nodule 7.56
Rhizoplane 16.39
Rhizosphere 48.74
Stem 0
Stem Tuber 0.84
Unclassified 21.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2896710 2162886007 Bacteria 1720
2 JGI25152J39213_1000334 3300002773 Bacteria 29873
3 JGI25151J46595_10000056 3300003187 Bacteria 151555
4 rootH2_10023790 3300003320 Bacteria 13062
5 Ga0058692_1002726 3300003856 Bacteria 5809
6 Ga0058692_1003410 3300003856 Bacteria 4905
7 Ga0058692_1013162 3300003856 Bacteria 1936
8 Ga0058692_1013948 3300003856 Bacteria 1856
9 Ga0058692_1025162 3300003856 Bacteria 1186
10 Ga0058692_1028925 3300003856 Bacteria 1065
11 Ga0065704_10002626 3300005289 Bacteria 9035
12 Ga0070659_100021454 3300005366 Bacteria 4920
13 Ga0070665_100013079 3300005548 Bacteria 8356
14 Ga0075364_10001322 3300006051 Bacteria 13325
15 Ga0075364_10167407 3300006051 Bacteria 1485
16 Ga0075369_10010367 3300006186 Bacteria 3644
17 Ga0075428_100068100 3300006844 Bacteria 3895
18 Ga0075430_100035318 3300006846 Bacteria 4241
19 Ga0075430_100698494 3300006846 Bacteria 836
20 Ga0075431_100009846 3300006847 Bacteria 9596
21 Ga0075429_100058096 3300006880 Bacteria 3369
22 Ga0079104_1001129 3300006946 Bacteria 19449
23 Ga0079104_1001169 3300006946 Bacteria 18954
24 Ga0079104_1002465 3300006946 Bacteria 9951
25 Ga0079104_1004692 3300006946 Bacteria 5725
26 Ga0079104_1005530 3300006946 Bacteria 5029
27 Ga0079104_1007341 3300006946 Bacteria 4018
28 Ga0105251_10002367 3300009011 Bacteria 14915
29 Ga0105251_10003542 3300009011 Bacteria 11275
30 Ga0105251_10003854 3300009011 Bacteria 10685
31 Ga0105251_10005761 3300009011 Bacteria 8038
32 Ga0105251_10016393 3300009011 Bacteria 4005
33 Ga0105251_10024728 3300009011 Bacteria 3081
34 Ga0105251_10245225 3300009011 Bacteria 807
35 Ga0105244_10001577 3300009036 Bacteria 18112
36 Ga0105244_10001902 3300009036 Bacteria 16216
37 Ga0105244_10007242 3300009036 Bacteria 7069
38 Ga0105244_10009475 3300009036 Bacteria 5986
39 Ga0105244_10143694 3300009036 Bacteria 1146
40 Ga0105250_10000725 3300009092 Bacteria 20132
41 Ga0105250_10001716 3300009092 Bacteria 11569
42 Ga0105250_10002178 3300009092 Bacteria 10027
43 Ga0105240_10104637 3300009093 Bacteria 3437
44 Ga0105240_10124161 3300009093 Bacteria 3105
45 Ga0111539_10005300 3300009094 Bacteria 16692
46 Ga0114129_10067295 3300009147 Bacteria 4996
47 Ga0105241_10000449 3300009174 Bacteria 30964
48 Ga0105246_10035219 3300011119 Bacteria 3344
49 Ga0157373_10063925 3300013100 Bacteria 2605
50 Ga0171462_1010 3300013250 Bacteria 310590
51 Ga0182008_10001740 3300014497 Bacteria 14301
52 Ga0213876_10000387 3300021384 Bacteria 36975
53 Ga0209025_1000016 3300025294 Bacteria 770739
54 Ga0209758_1031451 3300025297 Bacteria 2176
55 Ga0207696_1000512 3300025711 Bacteria 32191
56 Ga0207696_1000531 3300025711 Bacteria 31313
57 Ga0207696_1002908 3300025711 Bacteria 8060
58 Ga0207655_1000805 3300025728 Bacteria 34156
59 Ga0207655_1001298 3300025728 Bacteria 23639
60 Ga0207655_1001654 3300025728 Bacteria 19738
61 Ga0207713_1000712 3300025735 Bacteria 31062
62 Ga0207713_1003644 3300025735 Bacteria 10368
63 Ga0207713_1005869 3300025735 Bacteria 7588
64 Ga0207713_1038488 3300025735 Bacteria 2028
65 Ga0207654_10000282 3300025911 Bacteria 30973
66 Ga0207695_10315201 3300025913 Bacteria 1454
67 Ga0207668_10152262 3300025972 Bacteria 1792
68 Ga0209281_1000756 3300027111 Bacteria 31155
69 Ga0209281_1000803 3300027111 Bacteria 28991
70 Ga0209281_1001108 3300027111 Bacteria 19578
71 Ga0209281_1001133 3300027111 Bacteria 18956
72 Ga0209281_1002463 3300027111 Bacteria 7387
73 Ga0209281_1005662 3300027111 Bacteria 3415
74 Ga0209371_1000879 3300027312 Bacteria 24061
75 Ga0209371_1001128 3300027312 Bacteria 19631
76 Ga0209371_1003483 3300027312 Bacteria 7606
77 Ga0209371_1006809 3300027312 Bacteria 4138
78 Ga0268266_10005403 3300028379 Bacteria 11924
79 Ga0268256_1000623 3300030500 Bacteria 27502
80 Ga0268256_1000715 3300030500 Bacteria 24647
81 Ga0268256_1002733 3300030500 Bacteria 8625
82 Ga0268256_1007136 3300030500 Bacteria 4039
83 Ga0265330_10106785 3300031235 Bacteria 1197
84 Ga0265339_10009884 3300031249 Bacteria 5958
85 Ga0265316_10191351 3300031344 Bacteria 1520
86 Ga0265342_10086298 3300031712 Bacteria 1805
87 Ga0265342_10238545 3300031712 Bacteria 974
88 Ga0307405_10937824 3300031731 Bacteria 735
89 Ga0307407_10406438 3300031903 Bacteria 978
90 Ga0373925_0284287 3300037068 Bacteria 1333
91 Ga0436365_0381251 3300039437 Bacteria 1443
92 Ga0436365_0628801 3300039437 Bacteria 37043
93 Ga0436360_0363881 3300039438 Bacteria 7180
94 Ga0436361_0203067 3300039447 Bacteria 898
95 Ga0436362_0995710 3300039453 Bacteria 858
96 Ga0439432_002998 3300042006 Bacteria 6285
97 Ga0439432_050191 3300042006 Bacteria 1302
98 Ga0439452_002142 3300042010 Bacteria 7459
99 Ga0495627_071142 3300046453 Bacteria 1016
100 Ga0495591_000543 3300046458 Bacteria 28965
101 Ga0495591_004284 3300046458 Bacteria 7049
102 Ga0495591_005641 3300046458 Bacteria 5737
103 Ga0495638_0008924 3300046460 Bacteria 7069
104 Ga0495650_0000892 3300046471 Bacteria 35189
105 Ga0495643_0095088 3300046522 Bacteria 1533
106 Ga0495654_0011489 3300046530 Bacteria 4789
107 Ga0495649_0003523 3300046694 Bacteria 10536
108 Ga0495649_0005698 3300046694 Bacteria 7861
109 Ga0495589_0000511 3300046794 Bacteria 27340
110 Ga0495679_003286 3300047446 Bacteria 7835
111 Ga0495679_003535 3300047446 Bacteria 7470
112 Ga0496104_0289139 3300048907 Bacteria 1551
113 Ga0496116_0063614 3300048919 Bacteria 2376
114 Ga0496116_0135229 3300048919 Bacteria 1397
115 Ga0496117_0037283 3300048920 Bacteria 3623
116 Ga0496117_0064379 3300048920 Bacteria 2500
117 Ga0496118_0082525 3300048921 Bacteria 2251
118 Ga0496119_0005415 3300048922 Bacteria 12253
119 Ga0496119_0007680 3300048922 Bacteria 9653
120 Ga0496119_0185592 3300048922 Bacteria 1087
121 Ga0496120_0005516 3300048923 Bacteria 10068
122 Ga0496120_0005829 3300048923 Bacteria 9653
123 Ga0496120_0078781 3300048923 Bacteria 1790
124 Ga0496122_0003283 3300048925 Bacteria 21433
125 Ga0496122_0004188 3300048925 Bacteria 18138
126 Ga0496122_0089950 3300048925 Bacteria 2097
127 Ga0496122_0099285 3300048925 Bacteria 1952
128 Ga0496123_0002946 3300048926 Bacteria 19879
129 Ga0496123_0003964 3300048926 Bacteria 16038
130 Ga0496123_0006036 3300048926 Bacteria 11904
131 Ga0496123_0052494 3300048926 Bacteria 2705
132 Ga0496124_0001727 3300048927 Bacteria 30748
133 Ga0496124_0004264 3300048927 Bacteria 16823
134 Ga0496124_0019783 3300048927 Bacteria 6249
135 Ga0496124_0167030 3300048927 Bacteria 1709
136 Ga0496124_0447755 3300048927 Bacteria 881
137 Ga0496125_0003254 3300048928 Bacteria 20006
138 Ga0496125_0011398 3300048928 Bacteria 8895
139 Ga0496125_0024107 3300048928 Bacteria 5602
140 Ga0496125_0303423 3300048928 Bacteria 977
141 Ga0496126_0009584 3300048929 Bacteria 10270
142 Ga0496126_0054569 3300048929 Bacteria 3618
143 Ga0496126_0537477 3300048929 Bacteria 929
144 Ga0501034_0369895 3300049571 Bacteria 1360
145 Ga0501068_0019566 3300049584 Bacteria 3934
146 Ga0501072_0057424 3300049588 Bacteria 3067
147 Ga0501077_0417839 3300049593 Bacteria 858
148 nmdc:mga00v17_7476_c1 3300050491 Bacteria 5832
149 nmdc:mga05p37_57180_c1 3300050507 Bacteria 4803
150 nmdc:mga09592_227924_c1 3300050508 Bacteria 1614
151 nmdc:mga0qj67_17905_c1 3300050509 Bacteria 5393
152 nmdc:mga06r32_6503_c1 3300050510 Bacteria 10498
153 nmdc:mga08y16_18828_c1 3300050511 Bacteria 7273
154 nmdc:mga0sz30_187124_c1 3300050516 Bacteria 919
155 nmdc:mga0sz30_26801_c2 3300050516 Bacteria 2045

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031712 Ga0265342_10238545 Ga0265342_102385452 173
2 3300039453 Ga0436362_0995710 Ga0436362_0995710_43_717 176
3 3300039437 Ga0436365_0381251 Ga0436365_0381251_138_701 180
4 iso_pu_bacteria 2936367885 2936373818 180
5 3300050507 nmdc:mga05p37_57180_c1 nmdc:mga05p37_57180_c1_3594_4226 184
6 iso_pu_bacteria 2834578030 2834580960 187
7 iso_pu_bacteria 2855020534 2855021717 187
8 iso_pu_bacteria 3000405567 3000408629 187
9 iso_pu_bacteria 2919679072 2919680865 188
10 3300042010 Ga0439452_002142 Ga0439452_002142_331_966 190
11 3300048928 Ga0496125_0303423 Ga0496125_0303423_17_589 190
12 iso_pu_bacteria 2757320392 2757571438 190
13 iso_pu_bacteria 2936996657 2936996841 190
14 iso_pu_bacteria 8045864390 8045868700 190
15 iso_pu_bacteria 2917699015 2917700865 191
16 3300031235 Ga0265330_10106785 Ga0265330_101067852 192
17 3300031249 Ga0265339_10009884 Ga0265339_100098846 192
18 3300031344 Ga0265316_10191351 Ga0265316_101913512 192
19 3300031731 Ga0307405_10937824 Ga0307405_109378241 192
20 3300031903 Ga0307407_10406438 Ga0307407_104064382 192
21 3300049584 Ga0501068_0019566 Ga0501068_0019566_1272_1874 192
22 iso_pu_bacteria 2643221733 2644728379 192
23 3300003320 rootH2_10023790 rootH2_100237905 193
24 3300039438 Ga0436360_0363881 Ga0436360_0363881_504_1109 193
25 iso_pu_bacteria 2899259804 2899260451 193
26 3300003187 JGI25151J46595_10000056 JGI25151J46595_1000005631 194
27 3300025294 Ga0209025_1000016 Ga0209025_1000016250 194
28 3300025297 Ga0209758_1031451 Ga0209758_10314513 194
29 3300039447 Ga0436361_0203067 Ga0436361_0203067_220_828 194
30 3300048927 Ga0496124_0167030 Ga0496124_0167030_71_766 194
31 3300049571 Ga0501034_0369895 Ga0501034_0369895_255_863 194
32 iso_pu_bacteria 2643221626 2644150125 194
33 iso_pu_bacteria 2643221698 2644544622 194
34 3300009093 Ga0105240_10124161 Ga0105240_101241612 195
35 3300013250 Ga0171462_1010 Ga0171462_1010245 195
36 3300025913 Ga0207695_10315201 Ga0207695_103152012 195
37 3300031712 Ga0265342_10086298 Ga0265342_100862982 195
38 3300006846 Ga0075430_100035318 Ga0075430_1000353184 196
39 3300006847 Ga0075431_100009846 Ga0075431_1000098464 196
40 3300006880 Ga0075429_100058096 Ga0075429_1000580962 196
41 3300009147 Ga0114129_10067295 Ga0114129_100672956 196
42 3300050508 nmdc:mga09592_227924_c1 nmdc:mga09592_227924_c1_438_1070 196
43 3300050509 nmdc:mga0qj67_17905_c1 nmdc:mga0qj67_17905_c1_140_772 196
44 3300050510 nmdc:mga06r32_6503_c1 nmdc:mga06r32_6503_c1_1210_1842 196
45 3300006051 Ga0075364_10167407 Ga0075364_101674072 197
46 3300006844 Ga0075428_100068100 Ga0075428_1000681002 197
47 3300006846 Ga0075430_100698494 Ga0075430_1006984941 197
48 3300009094 Ga0111539_10005300 Ga0111539_100053007 197
49 3300050511 nmdc:mga08y16_18828_c1 nmdc:mga08y16_18828_c1_5085_5720 197
50 3300050516 nmdc:mga0sz30_187124_c1 nmdc:mga0sz30_187124_c1_246_863 197
51 3300037068 Ga0373925_0284287 Ga0373925_0284287_564_1190 198
52 iso_pu_bacteria 2909042592 2909047411 199
53 3300049593 Ga0501077_0417839 Ga0501077_0417839_96_740 200
54 3300006186 Ga0075369_10010367 Ga0075369_100103673 201
55 3300050516 nmdc:mga0sz30_26801_c2 nmdc:mga0sz30_26801_c2_1105_1740 201
56 3300025972 Ga0207668_10152262 Ga0207668_101522623 204
57 3300049588 Ga0501072_0057424 Ga0501072_0057424_1023_1694 204
58 iso_pu_bacteria 2881609920 2881613524 204
59 iso_pu_bacteria 2854601825 2854603919 205
60 3300003856 Ga0058692_1013162 Ga0058692_10131622 206
61 3300003856 Ga0058692_1013948 Ga0058692_10139482 206
62 3300027312 Ga0209371_1001128 Ga0209371_10011283 206
63 3300027312 Ga0209371_1006809 Ga0209371_10068093 206
64 3300030500 Ga0268256_1000623 Ga0268256_100062314 206
65 3300030500 Ga0268256_1007136 Ga0268256_10071362 206
66 iso_pu_bacteria 2561511199 2562465437 207
67 iso_pu_bacteria 2599185169 2599413674 207
68 iso_pu_bacteria 2600255254 2601526339 207
69 iso_pu_bacteria 2600255255 2601531363 207
70 iso_pu_bacteria 2600255280 2601618193 207
71 iso_pu_bacteria 2600255281 2601623230 207
72 iso_pu_bacteria 2600255287 2601646595 207
73 iso_pu_bacteria 2600255288 2601651608 207
74 iso_pu_bacteria 2600255289 2601656644 207
75 iso_pu_bacteria 2600255290 2601661650 207
76 iso_pu_bacteria 2600255291 2601666554 207
77 iso_pu_bacteria 2600255298 2601699518 207
78 iso_pu_bacteria 2600255299 2601704425 207
79 iso_pu_bacteria 2600255300 2601709452 207
80 iso_pu_bacteria 2600255301 2601714468 207
81 iso_pu_bacteria 2600255302 2601719500 207
82 iso_pu_bacteria 2600255303 2601724401 207
83 iso_pu_bacteria 2600255304 2601729422 207
84 iso_pu_bacteria 2600255305 2601734445 207
85 iso_pu_bacteria 2600255306 2601739431 207
86 iso_pu_bacteria 2600255307 2601744556 207
87 iso_pu_bacteria 2600255309 2601755087 207
88 iso_pu_bacteria 2600255392 2602022350 207
89 iso_pu_bacteria 2602042052 2603659246 207
90 iso_pu_bacteria 2602042053 2603664139 207
91 iso_pu_bacteria 2602042103 2603836795 207
92 iso_pu_bacteria 2602042104 2603841870 207
93 iso_pu_bacteria 2602042105 2603846943 207
94 iso_pu_bacteria 2602042106 2603852018 207
95 iso_pu_bacteria 2602042109 2603864959 207
96 iso_pu_bacteria 2602042110 2603869585 207
97 iso_pu_bacteria 2602042111 2603874765 207
98 iso_pu_bacteria 2603880178 2606046771 207
99 iso_pu_bacteria 2603880184 2606068569 207
100 iso_pu_bacteria 2603880202 2606144443 207
101 iso_pu_bacteria 2603880211 2606174660 207
102 iso_pu_bacteria 2609459761 2609914436 207
103 iso_pu_bacteria 2636415599 2637227655 207
104 iso_pu_bacteria 2671180115 2671588993 207
105 iso_pu_bacteria 2675903046 2676410346 207
106 iso_pu_bacteria 2711768156 2712471530 207
107 iso_pu_bacteria 2775507074 2777024512 207
108 iso_pu_bacteria 2791355275 2793407291 207
109 iso_pu_bacteria 2904513164 2904518471 207
110 iso_pu_bacteria 2939568625 2939572983 207
111 iso_pu_bacteria 2939573065 2939577820 207
112 iso_pu_bacteria 2939642701 2939646967 207
113 iso_pu_bacteria 2945874760 2945874925 207
114 iso_pu_bacteria 2969079654 2969084695 207
115 iso_pu_bacteria 2984559226 2984561816 207
116 iso_pu_bacteria 2984595703 2984599882 207
117 iso_pu_bacteria 8055087960 8055091766 207
118 iso_pu_bacteria 8057304971 8057305537 207
119 iso_pu_bacteria 2508501071 2508850235 208
120 iso_pu_bacteria 2772190666 2772436837 208
121 iso_pu_bacteria 2791354903 2791923292 208
122 iso_pu_bacteria 2846540461 2846543236 208
123 iso_pu_bacteria 2888366609 2888366890 208
124 iso_pu_bacteria 2888373701 2888375462 208
125 iso_pu_bacteria 2932406140 2932410867 208
126 iso_pu_bacteria 2937967321 2937969527 208
127 iso_pu_bacteria 2939577877 2939582479 208
128 iso_pu_bacteria 640753048 640935782 208
129 iso_pu_bacteria 8004592986 8004595867 208
130 iso_pu_bacteria 8015394850 8015398606 208
131 iso_pu_bacteria 3000376612 3000380959 209
132 3300006946 Ga0079104_1005530 Ga0079104_10055305 210
133 3300006946 Ga0079104_1007341 Ga0079104_10073412 210
134 3300009011 Ga0105251_10002367 Ga0105251_1000236711 210
135 3300009011 Ga0105251_10003854 Ga0105251_1000385411 210
136 3300009011 Ga0105251_10005761 Ga0105251_100057613 210
137 3300009036 Ga0105244_10007242 Ga0105244_100072422 210
138 3300009036 Ga0105244_10009475 Ga0105244_100094756 210
139 3300009092 Ga0105250_10002178 Ga0105250_100021784 210
140 3300009174 Ga0105241_10000449 Ga0105241_1000044919 210
141 3300013100 Ga0157373_10063925 Ga0157373_100639253 210
142 3300014497 Ga0182008_10001740 Ga0182008_1000174010 210
143 3300025728 Ga0207655_1000805 Ga0207655_100080524 210
144 3300025735 Ga0207713_1000712 Ga0207713_100071211 210
145 3300025735 Ga0207713_1003644 Ga0207713_100364411 210
146 3300025911 Ga0207654_10000282 Ga0207654_1000028219 210
147 3300027111 Ga0209281_1000756 Ga0209281_100075611 210
148 3300027111 Ga0209281_1005662 Ga0209281_10056625 210
149 3300042006 Ga0439432_002998 Ga0439432_002998_171_809 210
150 3300046530 Ga0495654_0011489 Ga0495654_0011489_3342_3980 210
151 3300046794 Ga0495589_0000511 Ga0495589_0000511_10603_11241 210
152 3300048920 Ga0496117_0064379 Ga0496117_0064379_1239_1877 210
153 3300048922 Ga0496119_0005415 Ga0496119_0005415_330_980 210
154 3300048922 Ga0496119_0007680 Ga0496119_0007680_330_980 210
155 3300048923 Ga0496120_0005516 Ga0496120_0005516_330_980 210
156 3300048923 Ga0496120_0005829 Ga0496120_0005829_330_980 210
157 3300048927 Ga0496124_0001727 Ga0496124_0001727_19338_19988 210
158 iso_pu_bacteria 2713897090 2715501787 210
159 2162886007 SwRhRL2b_contig_2896710 SwRhRL2b_0750.00006430 211
160 3300002773 JGI25152J39213_1000334 JGI25152J39213_100033418 211
161 3300003856 Ga0058692_1002726 Ga0058692_10027262 211
162 3300003856 Ga0058692_1003410 Ga0058692_10034102 211
163 3300003856 Ga0058692_1025162 Ga0058692_10251622 211
164 3300003856 Ga0058692_1028925 Ga0058692_10289251 211
165 3300005289 Ga0065704_10002626 Ga0065704_100026261 211
166 3300005366 Ga0070659_100021454 Ga0070659_1000214546 211
167 3300005548 Ga0070665_100013079 Ga0070665_1000130792 211
168 3300006051 Ga0075364_10001322 Ga0075364_100013229 211
169 3300006946 Ga0079104_1001129 Ga0079104_100112910 211
170 3300006946 Ga0079104_1001169 Ga0079104_100116912 211
171 3300006946 Ga0079104_1002465 Ga0079104_10024656 211
172 3300006946 Ga0079104_1004692 Ga0079104_10046922 211
173 3300009011 Ga0105251_10003542 Ga0105251_100035423 211
174 3300009011 Ga0105251_10016393 Ga0105251_100163932 211
175 3300009011 Ga0105251_10024728 Ga0105251_100247282 211
176 3300009011 Ga0105251_10245225 Ga0105251_102452251 211
177 3300009036 Ga0105244_10001577 Ga0105244_1000157710 211
178 3300009036 Ga0105244_10001902 Ga0105244_1000190213 211
179 3300009036 Ga0105244_10143694 Ga0105244_101436942 211
180 3300009092 Ga0105250_10000725 Ga0105250_1000072512 211
181 3300009092 Ga0105250_10001716 Ga0105250_100017164 211
182 3300009093 Ga0105240_10104637 Ga0105240_101046372 211
183 3300011119 Ga0105246_10035219 Ga0105246_100352192 211
184 3300021384 Ga0213876_10000387 Ga0213876_1000038721 211
185 3300025711 Ga0207696_1000512 Ga0207696_100051217 211
186 3300025711 Ga0207696_1000531 Ga0207696_100053118 211
187 3300025711 Ga0207696_1002908 Ga0207696_10029087 211
188 3300025728 Ga0207655_1001298 Ga0207655_100129810 211
189 3300025728 Ga0207655_1001654 Ga0207655_100165410 211
190 3300025735 Ga0207713_1005869 Ga0207713_10058693 211
191 3300025735 Ga0207713_1038488 Ga0207713_10384882 211
192 3300027111 Ga0209281_1000803 Ga0209281_100080311 211
193 3300027111 Ga0209281_1001108 Ga0209281_100110811 211
194 3300027111 Ga0209281_1001133 Ga0209281_100113310 211
195 3300027111 Ga0209281_1002463 Ga0209281_10024638 211
196 3300027312 Ga0209371_1000879 Ga0209371_100087915 211
197 3300027312 Ga0209371_1003483 Ga0209371_10034837 211
198 3300028379 Ga0268266_10005403 Ga0268266_100054032 211
199 3300030500 Ga0268256_1000715 Ga0268256_100071515 211
200 3300030500 Ga0268256_1002733 Ga0268256_10027333 211
201 3300039437 Ga0436365_0628801 Ga0436365_0628801_13915_14550 211
202 3300042006 Ga0439432_050191 Ga0439432_050191_61_702 211
203 3300046453 Ga0495627_071142 Ga0495627_071142_256_897 211
204 3300046458 Ga0495591_000543 Ga0495591_000543_18020_18655 211
205 3300046458 Ga0495591_004284 Ga0495591_004284_592_1227 211
206 3300046458 Ga0495591_005641 Ga0495591_005641_1677_2324 211
207 3300046460 Ga0495638_0008924 Ga0495638_0008924_517_1152 211
208 3300046471 Ga0495650_0000892 Ga0495650_0000892_22761_23408 211
209 3300046522 Ga0495643_0095088 Ga0495643_0095088_820_1455 211
210 3300046694 Ga0495649_0003523 Ga0495649_0003523_2516_3151 211
211 3300046694 Ga0495649_0005698 Ga0495649_0005698_2415_3050 211
212 3300047446 Ga0495679_003286 Ga0495679_003286_2415_3050 211
213 3300047446 Ga0495679_003535 Ga0495679_003535_238_873 211
214 3300048907 Ga0496104_0289139 Ga0496104_0289139_82_717 211
215 3300048919 Ga0496116_0063614 Ga0496116_0063614_345_986 211
216 3300048919 Ga0496116_0135229 Ga0496116_0135229_361_996 211
217 3300048920 Ga0496117_0037283 Ga0496117_0037283_1388_2023 211
218 3300048921 Ga0496118_0082525 Ga0496118_0082525_418_1053 211
219 3300048922 Ga0496119_0185592 Ga0496119_0185592_229_864 211
220 3300048923 Ga0496120_0078781 Ga0496120_0078781_660_1295 211
221 3300048925 Ga0496122_0003283 Ga0496122_0003283_11355_11990 211
222 3300048925 Ga0496122_0004188 Ga0496122_0004188_7053_7688 211
223 3300048925 Ga0496122_0089950 Ga0496122_0089950_346_981 211
224 3300048925 Ga0496122_0099285 Ga0496122_0099285_77_718 211
225 3300048926 Ga0496123_0002946 Ga0496123_0002946_8794_9429 211
226 3300048926 Ga0496123_0003964 Ga0496123_0003964_12602_13237 211
227 3300048926 Ga0496123_0006036 Ga0496123_0006036_11137_11778 211
228 3300048926 Ga0496123_0052494 Ga0496123_0052494_326_961 211
229 3300048927 Ga0496124_0004264 Ga0496124_0004264_10527_11168 211
230 3300048927 Ga0496124_0019783 Ga0496124_0019783_5319_5954 211
231 3300048927 Ga0496124_0447755 Ga0496124_0447755_27_662 211
232 3300048928 Ga0496125_0003254 Ga0496125_0003254_13917_14552 211
233 3300048928 Ga0496125_0011398 Ga0496125_0011398_3376_4017 211
234 3300048928 Ga0496125_0024107 Ga0496125_0024107_388_1023 211
235 3300048929 Ga0496126_0009584 Ga0496126_0009584_6061_6696 211
236 3300048929 Ga0496126_0054569 Ga0496126_0054569_568_1203 211
237 3300048929 Ga0496126_0537477 Ga0496126_0537477_104_739 211
238 3300050491 nmdc:mga00v17_7476_c1 nmdc:mga00v17_7476_c1_1191_1826 211

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02581

TMP-TENI

Thiamine monophosphate synthase

20

193

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xi3-assembly1.cif.gz_B thiamine phosphate pyrophosphorylase from pyrococcus furiosus pfu-1255191-001 0.8868 13 205
1g4t-assembly1.cif.gz_A thiamin phosphate synthase 0.8858 13 204
1g67-assembly1.cif.gz_A thiamin phosphate synthase 0.8661 13 204
3nm1-assembly1.cif.gz_F the crystal structure of candida glabrata thi6, a bifunctional enzyme involved in thiamin biosyhthesis of eukaryotes 0.8618 11 205
3nl3-assembly1.cif.gz_A the crystal structure of candida glabrata thi6, a bifunctional enzyme involved in thiamin biosyhthesis of eukaryotes 0.8595 11 205
ID Description Score Start End Superfamily
af_P30137_10_206_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9974 10 206 3.20.20.70
af_P30137_10_206_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9923 10 206 3.20.20.70
1xi3B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8868 13 205 3.20.20.70
af_A0A1D6MYJ2_339_548_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8815 10 205 3.20.20.70
af_Q2FWG3_1_212_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8806 13 205 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A0H3L2G3-F1-model_v4 Thiamine-phosphate pyrophosphorylase ThiE 1.001 6 107 GO:0004789
GO:0005737
GO:0009228
GO:0046872
AF-A0A379W0F0-F1-model_v4 Multifunctional fusion protein [Includes: Phosphomethylpyrimidine synthase (EC 4.1.99.17) (Hydroxymethylpyrimidine phosphate synthase) (Thiamine biosynthesis protein ThiC) (HMP-P synthase) (HMP-phosphate synthase) (HMPP synthase); Thiamine-phosphate synthase (TP synthase) (TPS) (EC 2.5.1.3) (Thiamine-phosphate pyrophosphorylase) (TMP pyrophosphorylase) (TMP-PPase)] 0.9983 1 211 GO:0000287
GO:0004789
GO:0005829
GO:0008270
GO:0009228
GO:0009229
GO:0016830
GO:0051539
AF-A0A377LPP0-F1-model_v4 Thiamine-phosphate synthase (EC 2.5.1.3) (Thiamine-phosphate pyrophosphorylase) 0.9982 1 186 GO:0004789
GO:0005737
GO:0009228
GO:0009229
GO:0046872
AF-A0A484YAB6-F1-model_v4 Thiamine-phosphate pyrophosphorylase (EC 2.5.1.3) 0.9965 1 161 GO:0004789
GO:0005737
GO:0009228
GO:0046872
AF-A8AKT0-F1-model_v4 Thiamine-phosphate synthase (TP synthase) (TPS) (EC 2.5.1.3) (Thiamine-phosphate pyrophosphorylase) (TMP pyrophosphorylase) (TMP-PPase) 0.9963 1 211 GO:0000287
GO:0004789
GO:0005737
GO:0009228
GO:0009229

Feature Viewer

pLDDT pTM Quality
94.59 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map