F351407

General Info

Members Datasets Scaffolds Average Seq Length
238 143 476 288

Family's Representative Sequence

Representative Sequence 3300050511|nmdc:mga08y16_20270_c1|nmdc:mga08y16_20270_c1_1083_1967
Length 279
Sequence MKNICNRRSGNEKRYDLKGKVVAVEPDKHRVTIAHEDVAGYMPGMTMPFTVRNESDMQMLVPNAEVTATLVVDGKHSWLENLFVVVKQEASTPVASVAVMAKEGDAVPNYTLVNQDAKPIRINNYRGKALLLTFIYTRCPDPEFCNLMSDNFAQIERQLGQDPELYSKTHLLSITIDPAHDEPKVLRSYGAAHTERYENETFAHWEFATGTNEQVKDIAGYFGLTYFPENNRIQHSLRTVIVGPDGKVAKIYTGNEWKTDEIVRELKKSVAFENASPTP

Samples

Sample ID Description Type Environment
1 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
101 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
107 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
111 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
112 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
113 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
114 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
115 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
116 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
117 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
118 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
119 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
120 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
121 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
122 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
123 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
124 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
125 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
126 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
127 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
128 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
129 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
130 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
131 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
132 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
133 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
134 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
135 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
136 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
137 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
138 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
139 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
140 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
141 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
142 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
143 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.68
Rhizosphere 98.32
Stem 0
Stem Tuber 0
Unclassified 17.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga08y16_20270_c1 3300050511 Bacteria 7018
2 CNAas_1000283 3300000532 Bacteria 4870
3 JGI24751J29686_10000125 3300002459 Bacteria 38661
4 JGI24751J29686_10000249 3300002459 Bacteria 21224
5 Ga0065714_10068342 3300005288 Unclassified 4793
6 Ga0065704_10006077 3300005289 Bacteria 2664
7 Ga0065712_10067742 3300005290 Bacteria 73878
8 Ga0065715_10001142 3300005293 Bacteria 8503
9 Ga0065715_10095448 3300005293 Unclassified 4079
10 Ga0065715_10123557 3300005293 Unclassified 2138
11 Ga0065715_10245357 3300005293 Bacteria 1185
12 Ga0065707_10012714 3300005295 Bacteria 1677
13 Ga0070670_100000118 3300005331 Bacteria 73231
14 Ga0070670_100041102 3300005331 Bacteria 3974
15 Ga0070670_100055672 3300005331 Bacteria 3394
16 Ga0070670_100122804 3300005331 Bacteria 2240
17 Ga0070682_100006412 3300005337 Bacteria 6609
18 Ga0070682_100020775 3300005337 Bacteria 3867
19 Ga0070689_100005660 3300005340 Bacteria 8560
20 Ga0070687_100166176 3300005343 Bacteria 1309
21 Ga0070692_10271096 3300005345 Bacteria 1025
22 Ga0070675_100471377 3300005354 Archaea 1128
23 Ga0070673_100122981 3300005364 Bacteria 2168
24 Ga0070659_100178482 3300005366 Bacteria 1742
25 Ga0070705_100015666 3300005440 Bacteria 3923
26 Ga0070700_100000115 3300005441 Bacteria 51077
27 Ga0070700_100303726 3300005441 Bacteria 1166
28 Ga0070694_100016972 3300005444 Bacteria 4593
29 Ga0070694_100030921 3300005444 Bacteria 3507
30 Ga0070694_100218438 3300005444 Bacteria 1429
31 Ga0070706_100000032 3300005467 Bacteria 152892
32 Ga0070707_100095406 3300005468 Bacteria 2881
33 Ga0070699_100010733 3300005518 Bacteria 7925
34 Ga0070699_100012930 3300005518 Bacteria 7196
35 Ga0070679_100122042 3300005530 Unclassified 2590
36 Ga0070697_100129698 3300005536 Bacteria 2114
37 Ga0070695_100048884 3300005545 Bacteria 2707
38 Ga0070693_100052811 3300005547 Bacteria 2331
39 Ga0070693_100053257 3300005547 Bacteria 2323
40 Ga0070693_100207072 3300005547 Unclassified 1277
41 Ga0070704_100043807 3300005549 Bacteria 3105
42 Ga0068857_100050689 3300005577 Unclassified 3681
43 Ga0068857_100274177 3300005577 Unclassified 1551
44 Ga0070702_100102231 3300005615 Bacteria 1760
45 Ga0070702_100121022 3300005615 Bacteria 1639
46 Ga0068859_100016327 3300005617 Bacteria 7459
47 Ga0068859_100044911 3300005617 Bacteria 4439
48 Ga0068859_100046038 3300005617 Bacteria 4382
49 Ga0068859_100069234 3300005617 Bacteria 3563
50 Ga0068859_100073501 3300005617 Unclassified 3457
51 Ga0068859_100291292 3300005617 Bacteria 1725
52 Ga0068859_100306012 3300005617 Bacteria 1683
53 Ga0068859_100668001 3300005617 Bacteria 1131
54 Ga0068864_100194704 3300005618 Bacteria 1859
55 Ga0068861_100057992 3300005719 Bacteria 2959
56 Ga0068851_10020757 3300005834 Bacteria 3184
57 Ga0068870_10017596 3300005840 Bacteria 3436
58 Ga0068863_100030113 3300005841 Bacteria 5184
59 Ga0068863_100200882 3300005841 Unclassified 1918
60 Ga0068863_100504265 3300005841 Bacteria 1192
61 Ga0068858_100420809 3300005842 Bacteria 1285
62 Ga0068860_100068525 3300005843 Bacteria 3371
63 Ga0068860_100114099 3300005843 Bacteria 2584
64 Ga0068860_100429579 3300005843 Unclassified 1310
65 Ga0068862_100308422 3300005844 Unclassified 1458
66 Ga0081539_10001451 3300005985 Bacteria 40546
67 Ga0081539_10077596 3300005985 Bacteria 1756
68 Ga0097621_100015988 3300006237 Bacteria 5658
69 Ga0068871_100007050 3300006358 Bacteria 8008
70 Ga0075431_100220974 3300006847 Unclassified 1932
71 Ga0075431_100224217 3300006847 Bacteria 1917
72 Ga0075433_10102064 3300006852 Bacteria 2540
73 Ga0075433_10233911 3300006852 Bacteria 1631
74 Ga0075433_10464935 3300006852 Bacteria 1115
75 Ga0097620_100016326 3300006931 Bacteria 7459
76 Ga0097620_100044911 3300006931 Bacteria 4439
77 Ga0097620_100046041 3300006931 Bacteria 4382
78 Ga0097620_100069242 3300006931 Bacteria 3563
79 Ga0097620_100073499 3300006931 Unclassified 3457
80 Ga0097620_100291296 3300006931 Bacteria 1725
81 Ga0097620_100306027 3300006931 Bacteria 1683
82 Ga0097620_100667984 3300006931 Bacteria 1131
83 Ga0105240_10688187 3300009093 Bacteria 1117
84 Ga0111539_10023286 3300009094 Bacteria 7609
85 Ga0105245_10381347 3300009098 Unclassified 1404
86 Ga0105247_10004069 3300009101 Bacteria 9397
87 Ga0114129_10100702 3300009147 Bacteria 3998
88 Ga0105243_10006761 3300009148 Bacteria 8847
89 Ga0105243_10100892 3300009148 Bacteria 2396
90 Ga0105243_10131110 3300009148 Bacteria 2126
91 Ga0105243_10465981 3300009148 Bacteria 1189
92 Ga0105241_10195378 3300009174 Bacteria 1687
93 Ga0105241_10221326 3300009174 Unclassified 1591
94 Ga0105241_10235788 3300009174 Bacteria 1544
95 Ga0105241_10236923 3300009174 Bacteria 1541
96 Ga0105241_10417549 3300009174 Bacteria 1180
97 Ga0105242_10046413 3300009176 Bacteria 3524
98 Ga0105248_10003642 3300009177 Bacteria 17107
99 Ga0105248_10099110 3300009177 Bacteria 3283
100 Ga0105248_10373630 3300009177 Bacteria 1605
101 Ga0105237_10004036 3300009545 Bacteria 17147
102 Ga0105238_10026121 3300009551 Bacteria 5950
103 Ga0105238_10070257 3300009551 Bacteria 3501
104 Ga0105249_10009091 3300009553 Bacteria 8688
105 Ga0105239_10204404 3300010375 Bacteria 2213
106 Ga0105239_10438585 3300010375 Bacteria 1481
107 Ga0105239_10727009 3300010375 Bacteria 1136
108 Ga0105246_10029464 3300011119 Unclassified 3616
109 Ga0105246_10061703 3300011119 Bacteria 2609
110 Ga0157373_10006460 3300013100 Bacteria 8752
111 Ga0157373_10012171 3300013100 Bacteria 6324
112 Ga0157378_10492205 3300013297 Unclassified 1224
113 Ga0163162_10016548 3300013306 Bacteria 7207
114 Ga0163162_10497323 3300013306 Bacteria 1350
115 Ga0163162_10569378 3300013306 Bacteria 1260
116 Ga0157372_10231136 3300013307 Unclassified 2144
117 Ga0157375_10004034 3300013308 Bacteria 12736
118 Ga0163163_10051194 3300014325 Bacteria 4072
119 Ga0163163_10125875 3300014325 Unclassified 2600
120 Ga0163163_10282287 3300014325 Bacteria 1712
121 Ga0207642_10092790 3300025899 Bacteria 1496
122 Ga0207710_10000938 3300025900 Bacteria 15505
123 Ga0207647_10009964 3300025904 Bacteria 6731
124 Ga0207647_10047540 3300025904 Unclassified 2668
125 Ga0207647_10223102 3300025904 Unclassified 1086
126 Ga0207645_10156149 3300025907 Unclassified 1491
127 Ga0207643_10000914 3300025908 Bacteria 17655
128 Ga0207643_10067616 3300025908 Bacteria 2051
129 Ga0207684_10000065 3300025910 Bacteria 194463
130 Ga0207654_10200173 3300025911 Bacteria 1314
131 Ga0207654_10278808 3300025911 Bacteria 1130
132 Ga0207707_10005634 3300025912 Bacteria 10958
133 Ga0207695_10024477 3300025913 Bacteria 6791
134 Ga0207671_10003695 3300025914 Bacteria 15087
135 Ga0207662_10159098 3300025918 Unclassified 1442
136 Ga0207662_10194400 3300025918 Bacteria 1310
137 Ga0207652_10106238 3300025921 Unclassified 2485
138 Ga0207646_10040501 3300025922 Bacteria 4189
139 Ga0207681_10169190 3300025923 Bacteria 1655
140 Ga0207694_10040239 3300025924 Bacteria 3598
141 Ga0207650_10000046 3300025925 Bacteria 178190
142 Ga0207687_10345187 3300025927 Unclassified 1211
143 Ga0207686_10083353 3300025934 Bacteria 2092
144 Ga0207709_10007926 3300025935 Bacteria 5885
145 Ga0207709_10062293 3300025935 Bacteria 2334
146 Ga0207670_10005166 3300025936 Bacteria 7135
147 Ga0207711_10003384 3300025941 Bacteria 13822
148 Ga0207711_10023680 3300025941 Bacteria 5141
149 Ga0207651_10214291 3300025960 Bacteria 1553
150 Ga0207712_10013300 3300025961 Bacteria 5276
151 Ga0207640_10152592 3300025981 Bacteria 1699
152 Ga0207703_10081887 3300026035 Unclassified 2692
153 Ga0207639_10301708 3300026041 Bacteria 1416
154 Ga0207708_10000083 3300026075 Bacteria 74423
155 Ga0207708_10013727 3300026075 Bacteria 6053
156 Ga0207708_10058648 3300026075 Bacteria 2937
157 Ga0207708_10340496 3300026075 Bacteria 1228
158 Ga0207641_10285910 3300026088 Bacteria 1553
159 Ga0207641_10523578 3300026088 Bacteria 1154
160 Ga0207641_10564460 3300026088 Bacteria 1111
161 Ga0207648_10179937 3300026089 Bacteria 1871
162 Ga0207648_10360651 3300026089 Bacteria 1311
163 Ga0207676_10055298 3300026095 Unclassified 3115
164 Ga0207676_10214386 3300026095 Bacteria 1710
165 Ga0207676_10385274 3300026095 Bacteria 1306
166 Ga0207674_10039908 3300026116 Unclassified 4864
167 Ga0207674_10081858 3300026116 Unclassified 3230
168 Ga0207674_10090517 3300026116 Unclassified 3051
169 Ga0207674_10094217 3300026116 Bacteria 2981
170 Ga0207674_10582654 3300026116 Bacteria 1081
171 Ga0207674_10685636 3300026116 Bacteria 989
172 Ga0207675_100122481 3300026118 Bacteria 2462
173 Ga0207428_10049832 3300027907 Bacteria 3353
174 Ga0207428_10268410 3300027907 Bacteria 1269
175 Ga0268265_10327087 3300028380 Bacteria 1391
176 Ga0268264_10102343 3300028381 Unclassified 2492
177 Ga0268264_10158651 3300028381 Bacteria 2035
178 Ga0268264_10565148 3300028381 Unclassified 1117
179 Ga0307405_10064906 3300031731 Bacteria 2322
180 Ga0307406_10004902 3300031901 Bacteria 7292
181 Ga0307406_10096405 3300031901 Bacteria 2004
182 Ga0307412_10136478 3300031911 Unclassified 1790
183 Ga0307412_10300414 3300031911 Bacteria 1269
184 Ga0307409_100350408 3300031995 Bacteria 1393
185 Ga0307416_100422843 3300032002 Unclassified 1377
186 Ga0307415_100100188 3300032126 Bacteria 2122
187 Ga0373951_0000419 3300035091 Bacteria 12462
188 Ga0373942_0013553 3300035207 Bacteria 1962
189 Ga0395900_0199012 3300037418 Bacteria 2028
190 Ga0395901_0085275 3300038443 Bacteria 3302
191 Ga0395901_0198392 3300038443 Bacteria 2104
192 Ga0439458_0008776 3300042157 Bacteria 2255
193 Ga0451576_0894245 3300045051 Bacteria 932
194 Ga0496106_0142668 3300048909 Bacteria 1885
195 Ga0496112_0070362 3300048915 Bacteria 3458
196 Ga0496112_0315856 3300048915 Bacteria 1507
197 Ga0496113_0503576 3300048916 Unclassified 972
198 Ga0501291_004536 3300049514 Bacteria 1776
199 Ga0501292_016229 3300049515 Bacteria 1170
200 Ga0501295_038044 3300049518 Bacteria 985
201 Ga0501077_0156860 3300049593 Bacteria 1445
202 Ga0501202_006482 3300049652 Bacteria 2097
203 Ga0501202_019503 3300049652 Unclassified 1340
204 Ga0501207_001099 3300049654 Bacteria 3307
205 Ga0501207_008951 3300049654 Unclassified 1455
206 Ga0501216_007112 3300049660 Bacteria 1733
207 Ga0501217_013726 3300049661 Bacteria 1820
208 Ga0501223_011611 3300049663 Bacteria 1768
209 Ga0501224_003647 3300049664 Bacteria 2161
210 Ga0501224_004282 3300049664 Bacteria 2022
211 Ga0501224_015676 3300049664 Bacteria 1123
212 Ga0501227_006010 3300049665 Bacteria 2605
213 Ga0501227_020529 3300049665 Unclassified 1516
214 Ga0501235_012623 3300049669 Bacteria 1859
215 Ga0501235_015095 3300049669 Unclassified 1703
216 Ga0501249_009998 3300049679 Bacteria 1978
217 Ga0501249_025250 3300049679 Bacteria 1311
218 Ga0501251_002693 3300049681 Bacteria 1738
219 Ga0501257_014675 3300049686 Bacteria 1805
220 Ga0501259_008045 3300049688 Bacteria 1693
221 Ga0501225_0023741 3300049705 Unclassified 1689
222 Ga0501229_004646 3300049706 Bacteria 1671
223 Ga0501268_009057 3300049765 Bacteria 1522
224 Ga0501268_015761 3300049765 Bacteria 1246
225 Ga0501271_002208 3300049768 Bacteria 1723
226 Ga0501273_000648 3300049770 Bacteria 2908
227 Ga0501274_005480 3300049771 Bacteria 1074
228 Ga0501283_011871 3300049779 Bacteria 1302
229 Ga0501212_010420 3300049851 Bacteria 1325
230 nmdc:mga0qj67_423910_c1 3300050509 Bacteria 1073
231 nmdc:mga06r32_127230_c1 3300050510 Bacteria 2517
232 nmdc:mga06r32_64206_c1 3300050510 Bacteria 3540
233 nmdc:mga08y16_972_c1 3300050511 Bacteria 27899
234 nmdc:mga0n895_143450_c1 3300050512 Bacteria 2417
235 nmdc:mga0n895_480684_c1 3300050512 Bacteria 1253
236 nmdc:mga0rr50_145064_c1 3300050513 Unclassified 1913
237 nmdc:mga0a205_112768_c1 3300050515 Bacteria 2618
238 nmdc:mga0a205_46956_c1 3300050515 Bacteria 4165
239 nmdc:mga08y16_20270_c1
240 CNAas_1000283
241 JGI24751J29686_10000125
242 JGI24751J29686_10000249
243 Ga0065714_10068342
244 Ga0065704_10006077
245 Ga0065712_10067742
246 Ga0065715_10001142
247 Ga0065715_10095448
248 Ga0065715_10123557
249 Ga0065715_10245357
250 Ga0065707_10012714
251 Ga0070670_100000118
252 Ga0070670_100041102
253 Ga0070670_100055672
254 Ga0070670_100122804
255 Ga0070682_100006412
256 Ga0070682_100020775
257 Ga0070689_100005660
258 Ga0070687_100166176
259 Ga0070692_10271096
260 Ga0070675_100471377
261 Ga0070673_100122981
262 Ga0070659_100178482
263 Ga0070705_100015666
264 Ga0070700_100000115
265 Ga0070700_100303726
266 Ga0070694_100016972
267 Ga0070694_100030921
268 Ga0070694_100218438
269 Ga0070706_100000032
270 Ga0070707_100095406
271 Ga0070699_100010733
272 Ga0070699_100012930
273 Ga0070679_100122042
274 Ga0070697_100129698
275 Ga0070695_100048884
276 Ga0070693_100052811
277 Ga0070693_100053257
278 Ga0070693_100207072
279 Ga0070704_100043807
280 Ga0068857_100050689
281 Ga0068857_100274177
282 Ga0070702_100102231
283 Ga0070702_100121022
284 Ga0068859_100016327
285 Ga0068859_100044911
286 Ga0068859_100046038
287 Ga0068859_100069234
288 Ga0068859_100073501
289 Ga0068859_100291292
290 Ga0068859_100306012
291 Ga0068859_100668001
292 Ga0068864_100194704
293 Ga0068861_100057992
294 Ga0068851_10020757
295 Ga0068870_10017596
296 Ga0068863_100030113
297 Ga0068863_100200882
298 Ga0068863_100504265
299 Ga0068858_100420809
300 Ga0068860_100068525
301 Ga0068860_100114099
302 Ga0068860_100429579
303 Ga0068862_100308422
304 Ga0081539_10001451
305 Ga0081539_10077596
306 Ga0097621_100015988
307 Ga0068871_100007050
308 Ga0075431_100220974
309 Ga0075431_100224217
310 Ga0075433_10102064
311 Ga0075433_10233911
312 Ga0075433_10464935
313 Ga0097620_100016326
314 Ga0097620_100044911
315 Ga0097620_100046041
316 Ga0097620_100069242
317 Ga0097620_100073499
318 Ga0097620_100291296
319 Ga0097620_100306027
320 Ga0097620_100667984
321 Ga0105240_10688187
322 Ga0111539_10023286
323 Ga0105245_10381347
324 Ga0105247_10004069
325 Ga0114129_10100702
326 Ga0105243_10006761
327 Ga0105243_10100892
328 Ga0105243_10131110
329 Ga0105243_10465981
330 Ga0105241_10195378
331 Ga0105241_10221326
332 Ga0105241_10235788
333 Ga0105241_10236923
334 Ga0105241_10417549
335 Ga0105242_10046413
336 Ga0105248_10003642
337 Ga0105248_10099110
338 Ga0105248_10373630
339 Ga0105237_10004036
340 Ga0105238_10026121
341 Ga0105238_10070257
342 Ga0105249_10009091
343 Ga0105239_10204404
344 Ga0105239_10438585
345 Ga0105239_10727009
346 Ga0105246_10029464
347 Ga0105246_10061703
348 Ga0157373_10006460
349 Ga0157373_10012171
350 Ga0157378_10492205
351 Ga0163162_10016548
352 Ga0163162_10497323
353 Ga0163162_10569378
354 Ga0157372_10231136
355 Ga0157375_10004034
356 Ga0163163_10051194
357 Ga0163163_10125875
358 Ga0163163_10282287
359 Ga0207642_10092790
360 Ga0207710_10000938
361 Ga0207647_10009964
362 Ga0207647_10047540
363 Ga0207647_10223102
364 Ga0207645_10156149
365 Ga0207643_10000914
366 Ga0207643_10067616
367 Ga0207684_10000065
368 Ga0207654_10200173
369 Ga0207654_10278808
370 Ga0207707_10005634
371 Ga0207695_10024477
372 Ga0207671_10003695
373 Ga0207662_10159098
374 Ga0207662_10194400
375 Ga0207652_10106238
376 Ga0207646_10040501
377 Ga0207681_10169190
378 Ga0207694_10040239
379 Ga0207650_10000046
380 Ga0207687_10345187
381 Ga0207686_10083353
382 Ga0207709_10007926
383 Ga0207709_10062293
384 Ga0207670_10005166
385 Ga0207711_10003384
386 Ga0207711_10023680
387 Ga0207651_10214291
388 Ga0207712_10013300
389 Ga0207640_10152592
390 Ga0207703_10081887
391 Ga0207639_10301708
392 Ga0207708_10000083
393 Ga0207708_10013727
394 Ga0207708_10058648
395 Ga0207708_10340496
396 Ga0207641_10285910
397 Ga0207641_10523578
398 Ga0207641_10564460
399 Ga0207648_10179937
400 Ga0207648_10360651
401 Ga0207676_10055298
402 Ga0207676_10214386
403 Ga0207676_10385274
404 Ga0207674_10039908
405 Ga0207674_10081858
406 Ga0207674_10090517
407 Ga0207674_10094217
408 Ga0207674_10582654
409 Ga0207674_10685636
410 Ga0207675_100122481
411 Ga0207428_10049832
412 Ga0207428_10268410
413 Ga0268265_10327087
414 Ga0268264_10102343
415 Ga0268264_10158651
416 Ga0268264_10565148
417 Ga0307405_10064906
418 Ga0307406_10004902
419 Ga0307406_10096405
420 Ga0307412_10136478
421 Ga0307412_10300414
422 Ga0307409_100350408
423 Ga0307416_100422843
424 Ga0307415_100100188
425 Ga0373951_0000419
426 Ga0373942_0013553
427 Ga0395900_0199012
428 Ga0395901_0085275
429 Ga0395901_0198392
430 Ga0439458_0008776
431 Ga0451576_0894245
432 Ga0496106_0142668
433 Ga0496112_0070362
434 Ga0496112_0315856
435 Ga0496113_0503576
436 Ga0501291_004536
437 Ga0501292_016229
438 Ga0501295_038044
439 Ga0501077_0156860
440 Ga0501202_006482
441 Ga0501202_019503
442 Ga0501207_001099
443 Ga0501207_008951
444 Ga0501216_007112
445 Ga0501217_013726
446 Ga0501223_011611
447 Ga0501224_003647
448 Ga0501224_004282
449 Ga0501224_015676
450 Ga0501227_006010
451 Ga0501227_020529
452 Ga0501235_012623
453 Ga0501235_015095
454 Ga0501249_009998
455 Ga0501249_025250
456 Ga0501251_002693
457 Ga0501257_014675
458 Ga0501259_008045
459 Ga0501225_0023741
460 Ga0501229_004646
461 Ga0501268_009057
462 Ga0501268_015761
463 Ga0501271_002208
464 Ga0501273_000648
465 Ga0501274_005480
466 Ga0501283_011871
467 Ga0501212_010420
468 nmdc:mga0qj67_423910_c1
469 nmdc:mga06r32_127230_c1
470 nmdc:mga06r32_64206_c1
471 nmdc:mga08y16_972_c1
472 nmdc:mga0n895_143450_c1
473 nmdc:mga0n895_480684_c1
474 nmdc:mga0rr50_145064_c1
475 nmdc:mga0a205_112768_c1
476 nmdc:mga0a205_46956_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11604

CusF_Ec

Copper binding periplasmic protein CusF

19

81

0.94

PF02630

SCO1-SenC

SCO1/SenC

107

248

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c2q-assembly1.cif.gz_A silver ion-bound structure of the silver specific chaperone silf needed for bacterial silver resistance 0.8873 29 100
1zeq-assembly1.cif.gz_X 1.5 a structure of apo-cusf residues 6-88 from escherichia coli 0.8588 23 99
4hde-assembly1.cif.gz_A the crystal structure of a sco1/senc family lipoprotein from bacillus anthracis str. ames 0.8417 118 281
2b7k-assembly3.cif.gz_C crystal structure of yeast sco1 0.8387 118 283
2vb3-assembly1.cif.gz_X crystal structure of ag(i)cusf 0.8211 26 98
ID Description Score Start End Superfamily
3me8B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.818 114 284 3.40.30.10
2b7jA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8172 113 283 3.40.30.10
3me8B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8133 114 284 3.40.30.10
2vb2X01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Copper binding periplasmic protein CusF 0.807 26 99 2.40.50.320
af_Q54TT7_154_312_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.805 119 283 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7Y5LEJ7-F1-model_v4 Copper-binding protein 0.9859 25 101
AF-A0A7Y3L612-F1-model_v4 Copper-binding protein 0.9823 24 101
AF-A0A2V9ZHD8-F1-model_v4 Copper-binding protein 0.9791 25 100
AF-A0A7T9JKC9-F1-model_v4 deleted 0.9782 24 99
AF-A0A2V8C3D2-F1-model_v4 Copper-binding protein 0.9742 24 100

Map