F351261

General Info

Members Datasets Scaffolds Average Seq Length
238 166 476 120

Family's Representative Sequence

Representative Sequence 3300046516|Ga0495628_0069964|Ga0495628_0069964_1727_2134
Length 135
Sequence MTPNGALTNKERDMGQPVVHFEVIGKDGGKLQSYYADLFGWNIDASNPMGYGIVKGEDNPSNMGSIGGGVATGPDGYEGHVTFYIAVPDIEAALQRAEELGGERVMGPEKVMDSVELGQFKDPEGHLIGLVRGSE

Samples

Sample ID Description Type Environment
1 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
102 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
103 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
104 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
111 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
112 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
113 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
114 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
115 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
116 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
117 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
118 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
119 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
122 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
123 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
124 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
125 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
126 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
127 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
128 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
129 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
130 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
131 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
132 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
133 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
134 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
135 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
136 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
137 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
138 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
139 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
144 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
145 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
146 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
147 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
148 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
151 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
152 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
153 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
156 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
157 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
158 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
159 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
160 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
161 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
162 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
163 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
164 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
165 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
166 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.64
Metatranscriptomes 3.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.68
Nodule 0
Rhizoplane 12.18
Rhizosphere 85.71
Stem 0
Stem Tuber 0
Unclassified 13.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495628_0069964 3300046516 Bacteria 2736
2 Ga0070658_11516973 3300005327 Bacteria 581
3 Ga0070683_100027654 3300005329 Bacteria 5117
4 Ga0070683_100288010 3300005329 Bacteria 1562
5 Ga0070683_101900380 3300005329 Bacteria 572
6 Ga0068869_101025096 3300005334 Bacteria 719
7 Ga0070680_100194490 3300005336 Bacteria 1709
8 Ga0070682_100867801 3300005337 Bacteria 739
9 Ga0070660_100782932 3300005339 Bacteria 802
10 Ga0070689_101800103 3300005340 Bacteria 558
11 Ga0070691_10698557 3300005341 Bacteria 609
12 Ga0070687_101046039 3300005343 Bacteria 594
13 Ga0070661_100222799 3300005344 Bacteria 1447
14 Ga0070674_100000020 3300005356 Bacteria 88217
15 Ga0070674_100107702 3300005356 Bacteria 2041
16 Ga0070709_10929308 3300005434 Unclassified 689
17 Ga0070700_100145622 3300005441 Unclassified 1614
18 Ga0070700_100542326 3300005441 Unclassified 902
19 Ga0070663_100085873 3300005455 Bacteria 2323
20 Ga0070681_10243587 3300005458 Bacteria 1711
21 Ga0068867_101434671 3300005459 Bacteria 641
22 Ga0068867_102212586 3300005459 Bacteria 522
23 Ga0070707_100668539 3300005468 Bacteria 1001
24 Ga0070679_100157808 3300005530 Bacteria 2243
25 Ga0070684_100020582 3300005535 Bacteria 5472
26 Ga0070684_100159569 3300005535 Bacteria 2045
27 Ga0070686_100972489 3300005544 Unclassified 695
28 Ga0070695_100075748 3300005545 Bacteria 2215
29 Ga0070695_100794531 3300005545 Bacteria 758
30 Ga0070696_100080691 3300005546 Bacteria 2304
31 Ga0070696_100902989 3300005546 Unclassified 733
32 Ga0070693_100831362 3300005547 Bacteria 687
33 Ga0070665_101181533 3300005548 Unclassified 776
34 Ga0070704_100195027 3300005549 Bacteria 1631
35 Ga0070704_100293071 3300005549 Bacteria 1353
36 Ga0068855_100484712 3300005563 Bacteria 1345
37 Ga0068857_100393444 3300005577 Bacteria 1289
38 Ga0068857_102462106 3300005577 Bacteria 511
39 Ga0068854_100031275 3300005578 Bacteria 3698
40 Ga0068856_100251467 3300005614 Bacteria 1782
41 Ga0068856_101994494 3300005614 Unclassified 591
42 Ga0068856_102552991 3300005614 Unclassified 517
43 Ga0070702_101453851 3300005615 Unclassified 562
44 Ga0068852_101286916 3300005616 Bacteria 753
45 Ga0068859_101791113 3300005617 Bacteria 678
46 Ga0068866_10000019 3300005718 Bacteria 64778
47 Ga0068861_100632745 3300005719 Bacteria 986
48 Ga0068858_100006307 3300005842 Bacteria 11549
49 Ga0068858_101077536 3300005842 Bacteria 789
50 Ga0081538_10000686 3300005981 Bacteria 37157
51 Ga0081538_10060753 3300005981 Bacteria 2170
52 Ga0081540_1029820 3300005983 Bacteria 3033
53 Ga0081539_10029895 3300005985 Bacteria 3394
54 Ga0075365_10007120 3300006038 Bacteria 6239
55 Ga0075365_11076606 3300006038 Bacteria 566
56 Ga0070712_100359847 3300006175 Bacteria 1193
57 Ga0070712_101689335 3300006175 Bacteria 554
58 Ga0075431_100426900 3300006847 Bacteria 1324
59 Ga0075431_100797412 3300006847 Bacteria 918
60 Ga0075434_100764998 3300006871 Bacteria 983
61 Ga0075429_100874133 3300006880 Bacteria 787
62 Ga0075436_100308912 3300006914 Bacteria 1134
63 Ga0097620_101790919 3300006931 Bacteria 678
64 Ga0075435_100010570 3300007076 Bacteria 6755
65 Ga0105240_10012796 3300009093 Bacteria 11561
66 Ga0105240_12347454 3300009093 Bacteria 552
67 Ga0105245_10161891 3300009098 Bacteria 2124
68 Ga0105245_10766488 3300009098 Bacteria 1001
69 Ga0105243_10310118 3300009148 Bacteria 1433
70 Ga0105243_10854069 3300009148 Bacteria 902
71 Ga0105241_11155804 3300009174 Unclassified 731
72 Ga0105242_10068974 3300009176 Bacteria 2927
73 Ga0105242_10766990 3300009176 Bacteria 951
74 Ga0105237_10067288 3300009545 Bacteria 3576
75 Ga0105237_11828292 3300009545 Bacteria 615
76 Ga0105238_10769504 3300009551 Bacteria 977
77 Ga0105249_10478736 3300009553 Bacteria 1287
78 Ga0105249_11272244 3300009553 Bacteria 807
79 Ga0105249_11479233 3300009553 Unclassified 751
80 Ga0105239_10156356 3300010375 Bacteria 2546
81 Ga0157370_10005853 3300013104 Bacteria 13734
82 Ga0157369_10044404 3300013105 Bacteria 4837
83 Ga0157369_10483675 3300013105 Bacteria 1281
84 Ga0157374_10478812 3300013296 Unclassified 1248
85 Ga0157378_10046585 3300013297 Bacteria 3854
86 Ga0157375_10000707 3300013308 Bacteria 29426
87 Ga0163163_10209810 3300014325 Bacteria 1997
88 Ga0163163_11472510 3300014325 Bacteria 742
89 Ga0182008_10210417 3300014497 Bacteria 992
90 Ga0182008_10571605 3300014497 Unclassified 631
91 Ga0163161_12097204 3300017792 Bacteria 503
92 Ga0197907_11351217 3300020069 Bacteria 1008
93 Ga0206350_10409821 3300020080 Bacteria 527
94 Ga0206354_10780920 3300020081 Bacteria 1653
95 Ga0206354_11674180 3300020081 Bacteria 769
96 Ga0206353_10085842 3300020082 Bacteria 592
97 Ga0206353_10232417 3300020082 Bacteria 836
98 Ga0224712_10117355 3300022467 Bacteria 1148
99 Ga0224712_10335987 3300022467 Bacteria 712
100 Ga0207656_10048877 3300025321 Unclassified 1822
101 Ga0207642_10000017 3300025899 Bacteria 64774
102 Ga0207654_10109673 3300025911 Bacteria 1715
103 Ga0207707_10016165 3300025912 Bacteria 6510
104 Ga0207695_10015680 3300025913 Bacteria 8914
105 Ga0207671_10761573 3300025914 Bacteria 769
106 Ga0207693_10095586 3300025915 Bacteria 2329
107 Ga0207660_10253199 3300025917 Bacteria 1390
108 Ga0207657_10231062 3300025919 Unclassified 1479
109 Ga0207652_10204479 3300025921 Bacteria 1777
110 Ga0207652_10303851 3300025921 Bacteria 1440
111 Ga0207646_10072812 3300025922 Bacteria 3069
112 Ga0207681_11370273 3300025923 Bacteria 594
113 Ga0207694_10208231 3300025924 Bacteria 1592
114 Ga0207687_10042956 3300025927 Bacteria 3113
115 Ga0207687_11033497 3300025927 Bacteria 705
116 Ga0207687_11167083 3300025927 Bacteria 662
117 Ga0207690_11853885 3300025932 Bacteria 503
118 Ga0207686_10006424 3300025934 Bacteria 6327
119 Ga0207686_10841116 3300025934 Bacteria 738
120 Ga0207709_10556522 3300025935 Bacteria 903
121 Ga0207669_10000016 3300025937 Bacteria 124532
122 Ga0207661_10062249 3300025944 Bacteria 3018
123 Ga0207661_10132968 3300025944 Bacteria 2133
124 Ga0207661_11025155 3300025944 Bacteria 760
125 Ga0207679_11090631 3300025945 Bacteria 732
126 Ga0207667_10487238 3300025949 Bacteria 1251
127 Ga0207640_10033331 3300025981 Bacteria 3203
128 Ga0207677_12044444 3300026023 Bacteria 533
129 Ga0207703_10000053 3300026035 Bacteria 143924
130 Ga0207639_11252114 3300026041 Bacteria 696
131 Ga0207678_10063204 3300026067 Bacteria 3181
132 Ga0207678_11158275 3300026067 Bacteria 685
133 Ga0207708_10258715 3300026075 Unclassified 1404
134 Ga0207702_10043885 3300026078 Bacteria 3756
135 Ga0207702_10780145 3300026078 Bacteria 944
136 Ga0207648_11254860 3300026089 Bacteria 696
137 Ga0207674_10044264 3300026116 Bacteria 4584
138 Ga0207698_10533697 3300026142 Bacteria 1147
139 Ga0307511_10098811 3300030521 Bacteria 1930
140 Ga0373933_0078153 3300035724 Bacteria 2024
141 Ga0373947_0399901 3300035725 Bacteria 926
142 Ga0373937_0390335 3300036401 Bacteria 1320
143 Ga0395899_0005470 3300037312 Bacteria 9851
144 Ga0395899_0504564 3300037312 Unclassified 784
145 Ga0395900_0005824 3300037418 Bacteria 12875
146 Ga0395900_0564114 3300037418 Bacteria 1082
147 Ga0395900_1429220 3300037418 Unclassified 604
148 Ga0395898_0009530 3300037466 Bacteria 10195
149 Ga0395898_0140261 3300037466 Bacteria 2314
150 Ga0395898_0207699 3300037466 Bacteria 1869
151 Ga0395898_0248475 3300037466 Bacteria 1696
152 Ga0395898_1006091 3300037466 Bacteria 769
153 Ga0395905_0008991 3300037471 Bacteria 9802
154 Ga0395905_0052008 3300037471 Bacteria 3836
155 Ga0395901_0097450 3300038443 Bacteria 3083
156 Ga0395901_0289105 3300038443 Bacteria 1701
157 Ga0395901_0526229 3300038443 Bacteria 1201
158 Ga0395901_0650668 3300038443 Unclassified 1057
159 Ga0395901_1357904 3300038443 Unclassified 670
160 Ga0451800_0377511 3300041459 Bacteria 585
161 Ga0439455_0106827 3300042012 Bacteria 777
162 Ga0439434_0176521 3300042435 Bacteria 714
163 Ga0451577_1578948 3300042876 Unclassified 579
164 Ga0466963_0000290 3300044694 Bacteria 22659
165 Ga0453684_1685741 3300044712 Unclassified 648
166 Ga0466971_0083397 3300044719 Unclassified 1459
167 Ga0466971_0206950 3300044719 Bacteria 927
168 Ga0466957_0055598 3300044842 Bacteria 2419
169 Ga0466957_0071499 3300044842 Bacteria 2146
170 Ga0451576_0304745 3300045051 Bacteria 1666
171 Ga0466958_0006041 3300045836 Bacteria 6563
172 Ga0466958_0025277 3300045836 Bacteria 3500
173 Ga0466958_0321400 3300045836 Bacteria 995
174 Ga0466967_0002748 3300045976 Bacteria 11129
175 Ga0466967_0769389 3300045976 Bacteria 955
176 Ga0495592_0169078 3300046454 Bacteria 1498
177 Ga0495641_0084290 3300046461 Bacteria 1423
178 Ga0495662_0211827 3300046476 Bacteria 955
179 Ga0495608_0629507 3300046511 Bacteria 642
180 Ga0495618_0000138 3300046514 Bacteria 52087
181 Ga0495652_0013763 3300046529 Bacteria 7279
182 Ga0495645_0000018 3300046543 Bacteria 155263
183 Ga0495645_0423946 3300046543 Bacteria 844
184 Ga0495634_0000024 3300046642 Bacteria 116230
185 Ga0495634_0017256 3300046642 Bacteria 5154
186 Ga0495635_0230687 3300046663 Bacteria 1251
187 Ga0495599_0497121 3300046678 Unclassified 718
188 Ga0495658_0882641 3300046683 Bacteria 572
189 Ga0495669_0044806 3300046684 Bacteria 1971
190 Ga0495676_0342893 3300047321 Bacteria 1000
191 Ga0495680_0137581 3300047322 Bacteria 1790
192 Ga0495593_0050831 3300047673 Bacteria 2195
193 Ga0495602_0293082 3300048088 Bacteria 1194
194 Ga0495614_0012204 3300048089 Bacteria 3773
195 Ga0496100_0050973 3300048903 Bacteria 2684
196 Ga0496100_0873534 3300048903 Unclassified 706
197 Ga0496101_0034329 3300048904 Bacteria 3582
198 Ga0496102_0285665 3300048905 Bacteria 1555
199 Ga0496102_1504689 3300048905 Unclassified 592
200 Ga0496103_0175383 3300048906 Bacteria 1377
201 Ga0496103_0538095 3300048906 Bacteria 746
202 Ga0496104_0647769 3300048907 Bacteria 965
203 Ga0496104_0783419 3300048907 Bacteria 860
204 Ga0496105_0164378 3300048908 Bacteria 1821
205 Ga0496105_0499299 3300048908 Bacteria 955
206 Ga0496106_0925901 3300048909 Bacteria 687
207 Ga0496106_1255397 3300048909 Unclassified 576
208 Ga0496107_0014952 3300048910 Bacteria 5435
209 Ga0496108_0008008 3300048911 Bacteria 8574
210 Ga0496110_0071012 3300048913 Bacteria 3086
211 Ga0496110_0805372 3300048913 Bacteria 844
212 Ga0496111_0206735 3300048914 Unclassified 1459
213 Ga0496111_0712825 3300048914 Bacteria 729
214 Ga0496112_0546909 3300048915 Bacteria 1092
215 Ga0496112_1220306 3300048915 Bacteria 669
216 Ga0496113_0002837 3300048916 Bacteria 10193
217 Ga0496113_0054411 3300048916 Bacteria 2996
218 Ga0496114_0046141 3300048917 Bacteria 3620
219 Ga0496114_0117384 3300048917 Bacteria 2286
220 Ga0496115_0018072 3300048918 Bacteria 5404
221 Ga0496115_0113827 3300048918 Unclassified 2223
222 Ga0496115_1277226 3300048918 Unclassified 548
223 Ga0501036_1383511 3300049572 Bacteria 571
224 Ga0501048_0995356 3300049582 Bacteria 603
225 Ga0501067_0019659 3300049583 Bacteria 3738
226 Ga0501068_0157324 3300049584 Bacteria 1431
227 Ga0501069_0062381 3300049585 Bacteria 2081
228 Ga0501081_1463720 3300049743 Bacteria 519
229 nmdc:mga0yw44_667789_c1 3300050492 Bacteria 706
230 nmdc:mga0yw44_924302_c1 3300050492 Bacteria 591
231 nmdc:mga06r32_903420_c1 3300050510 Unclassified 839
232 nmdc:mga0n895_165542_c1 3300050512 Unclassified 2243
233 nmdc:mga08x19_23514_c1 3300050514 Bacteria 3823
234 nmdc:mga0a205_696019_c1 3300050515 Bacteria 866
235 nmdc:mga0a205_7944_c1 3300050515 Bacteria 9634
236 Ga0495612_0365167 3300053078 Unclassified 653
237 Ga0495619_0000024 3300053085 Bacteria 180821
238 Ga0530510_0550974 3300061734 Bacteria 876
239 Ga0495628_0069964
240 Ga0070658_11516973
241 Ga0070683_100027654
242 Ga0070683_100288010
243 Ga0070683_101900380
244 Ga0068869_101025096
245 Ga0070680_100194490
246 Ga0070682_100867801
247 Ga0070660_100782932
248 Ga0070689_101800103
249 Ga0070691_10698557
250 Ga0070687_101046039
251 Ga0070661_100222799
252 Ga0070674_100000020
253 Ga0070674_100107702
254 Ga0070709_10929308
255 Ga0070700_100145622
256 Ga0070700_100542326
257 Ga0070663_100085873
258 Ga0070681_10243587
259 Ga0068867_101434671
260 Ga0068867_102212586
261 Ga0070707_100668539
262 Ga0070679_100157808
263 Ga0070684_100020582
264 Ga0070684_100159569
265 Ga0070686_100972489
266 Ga0070695_100075748
267 Ga0070695_100794531
268 Ga0070696_100080691
269 Ga0070696_100902989
270 Ga0070693_100831362
271 Ga0070665_101181533
272 Ga0070704_100195027
273 Ga0070704_100293071
274 Ga0068855_100484712
275 Ga0068857_100393444
276 Ga0068857_102462106
277 Ga0068854_100031275
278 Ga0068856_100251467
279 Ga0068856_101994494
280 Ga0068856_102552991
281 Ga0070702_101453851
282 Ga0068852_101286916
283 Ga0068859_101791113
284 Ga0068866_10000019
285 Ga0068861_100632745
286 Ga0068858_100006307
287 Ga0068858_101077536
288 Ga0081538_10000686
289 Ga0081538_10060753
290 Ga0081540_1029820
291 Ga0081539_10029895
292 Ga0075365_10007120
293 Ga0075365_11076606
294 Ga0070712_100359847
295 Ga0070712_101689335
296 Ga0075431_100426900
297 Ga0075431_100797412
298 Ga0075434_100764998
299 Ga0075429_100874133
300 Ga0075436_100308912
301 Ga0097620_101790919
302 Ga0075435_100010570
303 Ga0105240_10012796
304 Ga0105240_12347454
305 Ga0105245_10161891
306 Ga0105245_10766488
307 Ga0105243_10310118
308 Ga0105243_10854069
309 Ga0105241_11155804
310 Ga0105242_10068974
311 Ga0105242_10766990
312 Ga0105237_10067288
313 Ga0105237_11828292
314 Ga0105238_10769504
315 Ga0105249_10478736
316 Ga0105249_11272244
317 Ga0105249_11479233
318 Ga0105239_10156356
319 Ga0157370_10005853
320 Ga0157369_10044404
321 Ga0157369_10483675
322 Ga0157374_10478812
323 Ga0157378_10046585
324 Ga0157375_10000707
325 Ga0163163_10209810
326 Ga0163163_11472510
327 Ga0182008_10210417
328 Ga0182008_10571605
329 Ga0163161_12097204
330 Ga0197907_11351217
331 Ga0206350_10409821
332 Ga0206354_10780920
333 Ga0206354_11674180
334 Ga0206353_10085842
335 Ga0206353_10232417
336 Ga0224712_10117355
337 Ga0224712_10335987
338 Ga0207656_10048877
339 Ga0207642_10000017
340 Ga0207654_10109673
341 Ga0207707_10016165
342 Ga0207695_10015680
343 Ga0207671_10761573
344 Ga0207693_10095586
345 Ga0207660_10253199
346 Ga0207657_10231062
347 Ga0207652_10204479
348 Ga0207652_10303851
349 Ga0207646_10072812
350 Ga0207681_11370273
351 Ga0207694_10208231
352 Ga0207687_10042956
353 Ga0207687_11033497
354 Ga0207687_11167083
355 Ga0207690_11853885
356 Ga0207686_10006424
357 Ga0207686_10841116
358 Ga0207709_10556522
359 Ga0207669_10000016
360 Ga0207661_10062249
361 Ga0207661_10132968
362 Ga0207661_11025155
363 Ga0207679_11090631
364 Ga0207667_10487238
365 Ga0207640_10033331
366 Ga0207677_12044444
367 Ga0207703_10000053
368 Ga0207639_11252114
369 Ga0207678_10063204
370 Ga0207678_11158275
371 Ga0207708_10258715
372 Ga0207702_10043885
373 Ga0207702_10780145
374 Ga0207648_11254860
375 Ga0207674_10044264
376 Ga0207698_10533697
377 Ga0307511_10098811
378 Ga0373933_0078153
379 Ga0373947_0399901
380 Ga0373937_0390335
381 Ga0395899_0005470
382 Ga0395899_0504564
383 Ga0395900_0005824
384 Ga0395900_0564114
385 Ga0395900_1429220
386 Ga0395898_0009530
387 Ga0395898_0140261
388 Ga0395898_0207699
389 Ga0395898_0248475
390 Ga0395898_1006091
391 Ga0395905_0008991
392 Ga0395905_0052008
393 Ga0395901_0097450
394 Ga0395901_0289105
395 Ga0395901_0526229
396 Ga0395901_0650668
397 Ga0395901_1357904
398 Ga0451800_0377511
399 Ga0439455_0106827
400 Ga0439434_0176521
401 Ga0451577_1578948
402 Ga0466963_0000290
403 Ga0453684_1685741
404 Ga0466971_0083397
405 Ga0466971_0206950
406 Ga0466957_0055598
407 Ga0466957_0071499
408 Ga0451576_0304745
409 Ga0466958_0006041
410 Ga0466958_0025277
411 Ga0466958_0321400
412 Ga0466967_0002748
413 Ga0466967_0769389
414 Ga0495592_0169078
415 Ga0495641_0084290
416 Ga0495662_0211827
417 Ga0495608_0629507
418 Ga0495618_0000138
419 Ga0495652_0013763
420 Ga0495645_0000018
421 Ga0495645_0423946
422 Ga0495634_0000024
423 Ga0495634_0017256
424 Ga0495635_0230687
425 Ga0495599_0497121
426 Ga0495658_0882641
427 Ga0495669_0044806
428 Ga0495676_0342893
429 Ga0495680_0137581
430 Ga0495593_0050831
431 Ga0495602_0293082
432 Ga0495614_0012204
433 Ga0496100_0050973
434 Ga0496100_0873534
435 Ga0496101_0034329
436 Ga0496102_0285665
437 Ga0496102_1504689
438 Ga0496103_0175383
439 Ga0496103_0538095
440 Ga0496104_0647769
441 Ga0496104_0783419
442 Ga0496105_0164378
443 Ga0496105_0499299
444 Ga0496106_0925901
445 Ga0496106_1255397
446 Ga0496107_0014952
447 Ga0496108_0008008
448 Ga0496110_0071012
449 Ga0496110_0805372
450 Ga0496111_0206735
451 Ga0496111_0712825
452 Ga0496112_0546909
453 Ga0496112_1220306
454 Ga0496113_0002837
455 Ga0496113_0054411
456 Ga0496114_0046141
457 Ga0496114_0117384
458 Ga0496115_0018072
459 Ga0496115_0113827
460 Ga0496115_1277226
461 Ga0501036_1383511
462 Ga0501048_0995356
463 Ga0501067_0019659
464 Ga0501068_0157324
465 Ga0501069_0062381
466 Ga0501081_1463720
467 nmdc:mga0yw44_667789_c1
468 nmdc:mga0yw44_924302_c1
469 nmdc:mga06r32_903420_c1
470 nmdc:mga0n895_165542_c1
471 nmdc:mga08x19_23514_c1
472 nmdc:mga0a205_696019_c1
473 nmdc:mga0a205_7944_c1
474 Ga0495612_0365167
475 Ga0495619_0000024
476 Ga0530510_0550974

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

18

130

0.78

PF18029

Glyoxalase_6

Glyoxalase-like domain

20

131

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
7yvv-assembly1.cif.gz_A acmp1, r-4-hydroxymandelate synthase 0.8391 64 114
1ss4-assembly1.cif.gz_A crystal structure of the glyoxalase family protein apc24694 from bacillus cereus 0.8341 55 114
3r6a-assembly1.cif.gz_B crystal structure of an uncharacterized protein (hypothetical protein mm_3218) from methanosarcina mazei. 0.7999 63 116
5cj3-assembly1.cif.gz_B crystal structure of the zorbamycin binding protein (zbma) from streptomyces flavoviridis with zorbamycin 0.7872 66 116
1yfo-assembly2.cif.gz_B receptor protein tyrosine phosphatase alpha, domain 1 from mouse 0.7585 84 114
ID Description Score Start End Superfamily
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8733 63 114 3.30.720.110
2r5vB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8351 63 115 3.10.180.10
af_Q76NV5_1_156_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8228 64 114 3.10.180.10
1ss4B00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8022 55 114 3.10.180.10
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7979 62 114 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A1V4DM52-F1-model_v4 Glyoxalase 0.9491 61 114
AF-A0A7V8WBB3-F1-model_v4 Glyoxalase 0.9475 61 116
AF-A0A7V8WBB3-F1-model_v4 Glyoxalase 0.9008 61 116
AF-J6CXC3-F1-model_v4 deleted 0.8693 55 114
AF-A0A370HPI2-F1-model_v4 Putative enzyme related to lactoylglutathione lyase 0.8627 54 116 GO:0016829

Map