F351249

General Info

Members Datasets Scaffolds Average Seq Length
238 118 476 197

Family's Representative Sequence

Representative Sequence 3300046473|Ga0495582_0216659|Ga0495582_0216659_327_1049
Length 240
Sequence LLDHQLEAHGRELPHGLRDERDTPLALRRLARNADPHPANSLRTLTHFFTSHGLPLLFAVVMLESFGIPLPGETALIAFGVLASQGHYSIAEVIAVAAAAAIIGDNLGYWLIGRLGGRRLFERTRVGRRYAERFLPEAERLMTKHGGKVVFFGRFISILRFTAAWAAGIARMPWWRFLFWNAAGGIAWATAVGLVAYYGGAAAADAIQRYGIYAAVVIVIAVLIGFFFTHYGKKWLERRL

Samples

Sample ID Description Type Environment
1 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
28 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
36 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
37 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
38 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
57 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
58 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
59 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
60 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
61 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
62 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
63 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
64 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
65 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
66 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
67 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
68 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
69 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
70 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
71 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
72 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
73 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
74 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
75 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
76 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
77 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
78 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
79 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
80 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
81 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
82 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
83 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
84 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
85 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
86 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
87 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
88 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
89 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
90 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
91 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
92 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
93 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
94 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
95 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
96 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
97 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
98 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
99 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
100 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
101 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
102 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
103 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
104 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
105 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
106 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
107 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
108 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
109 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
110 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
111 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
112 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
113 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
114 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
115 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
116 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
117 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
118 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 13.45
Rhizosphere 86.55
Stem 0
Stem Tuber 0
Unclassified 5.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495582_0216659 3300046473 Bacteria 1095
2 Ga0070658_10037019 3300005327 Bacteria 3932
3 Ga0070683_100126471 3300005329 Bacteria 2416
4 Ga0070683_100585096 3300005329 Unclassified 1068
5 Ga0070683_100974450 3300005329 Bacteria 814
6 Ga0070680_100800394 3300005336 Bacteria 812
7 Ga0070709_10201168 3300005434 Bacteria 1411
8 Ga0070714_100024089 3300005435 Bacteria 5008
9 Ga0070714_100138662 3300005435 Bacteria 2181
10 Ga0070714_100392820 3300005435 Bacteria 1310
11 Ga0070714_100460495 3300005435 Bacteria 1209
12 Ga0070714_100695531 3300005435 Bacteria 981
13 Ga0070713_100005051 3300005436 Bacteria 8974
14 Ga0070713_100041779 3300005436 Bacteria 3738
15 Ga0070713_100042227 3300005436 Bacteria 3721
16 Ga0070711_100219007 3300005439 Bacteria 1478
17 Ga0070708_100002568 3300005445 Bacteria 14054
18 Ga0070681_10136892 3300005458 Bacteria 2379
19 Ga0070681_10147898 3300005458 Bacteria 2277
20 Ga0070681_10289817 3300005458 Bacteria 1547
21 Ga0070706_100055882 3300005467 Bacteria 3644
22 Ga0070706_100085939 3300005467 Bacteria 2915
23 Ga0070707_100015223 3300005468 Bacteria 7219
24 Ga0070707_100142001 3300005468 Bacteria 2337
25 Ga0070707_100484653 3300005468 Bacteria 1198
26 Ga0070698_100117720 3300005471 Bacteria 2619
27 Ga0070698_100217563 3300005471 Bacteria 1844
28 Ga0070698_100596672 3300005471 Bacteria 1045
29 Ga0070699_100159396 3300005518 Bacteria 1997
30 Ga0070679_100046975 3300005530 Bacteria 4304
31 Ga0070679_100154425 3300005530 Bacteria 2271
32 Ga0070679_100215764 3300005530 Bacteria 1881
33 Ga0070679_100227287 3300005530 Bacteria 1826
34 Ga0070679_100242895 3300005530 Bacteria 1758
35 Ga0070679_100261734 3300005530 Bacteria 1685
36 Ga0070684_100121961 3300005535 Bacteria 2345
37 Ga0070697_100393455 3300005536 Bacteria 1202
38 Ga0070695_100000334 3300005545 Bacteria 24267
39 Ga0070696_100283390 3300005546 Bacteria 1264
40 Ga0070664_100079242 3300005564 Bacteria 2827
41 Ga0068857_100312430 3300005577 Bacteria 1450
42 Ga0070716_100007042 3300006173 Bacteria 5518
43 Ga0070716_100457403 3300006173 Bacteria 932
44 Ga0070712_100154000 3300006175 Bacteria 1768
45 Ga0070712_100293575 3300006175 Bacteria 1313
46 Ga0075436_100207988 3300006914 Bacteria 1387
47 Ga0075436_100629513 3300006914 Bacteria 792
48 Ga0105240_10033877 3300009093 Bacteria 6595
49 Ga0114129_10431387 3300009147 Bacteria 1731
50 Ga0105241_10482671 3300009174 Bacteria 1102
51 Ga0105248_10443352 3300009177 Unclassified 1463
52 Ga0105237_10030249 3300009545 Bacteria 5501
53 Ga0105239_11021675 3300010375 Bacteria 951
54 Ga0157371_10150253 3300013102 Bacteria 1661
55 Ga0157370_10503476 3300013104 Unclassified 1112
56 Ga0157370_10516722 3300013104 Bacteria 1096
57 Ga0157370_10661817 3300013104 Bacteria 954
58 Ga0157370_10745822 3300013104 Bacteria 892
59 Ga0157369_10002166 3300013105 Bacteria 23672
60 Ga0157369_11312127 3300013105 Bacteria 737
61 Ga0157372_10024543 3300013307 Bacteria 6552
62 Ga0157372_10162973 3300013307 Bacteria 2577
63 Ga0157372_10623647 3300013307 Bacteria 1256
64 Ga0182008_10030506 3300014497 Bacteria 2718
65 Ga0182008_10139801 3300014497 Bacteria 1211
66 Ga0182006_1062235 3300015261 Bacteria 1405
67 Ga0182007_10009300 3300015262 Bacteria 3972
68 Ga0207699_10062769 3300025906 Bacteria 2241
69 Ga0207705_10126056 3300025909 Bacteria 1903
70 Ga0207684_10212912 3300025910 Bacteria 1667
71 Ga0207684_10674497 3300025910 Bacteria 880
72 Ga0207707_10045724 3300025912 Bacteria 3815
73 Ga0207707_10081208 3300025912 Bacteria 2830
74 Ga0207707_10109945 3300025912 Bacteria 2409
75 Ga0207707_10146307 3300025912 Bacteria 2066
76 Ga0207695_10138115 3300025913 Bacteria 2389
77 Ga0207671_10136876 3300025914 Bacteria 1884
78 Ga0207693_10001626 3300025915 Bacteria 19847
79 Ga0207660_10127451 3300025917 Bacteria 1934
80 Ga0207660_10223936 3300025917 Bacteria 1477
81 Ga0207657_10004733 3300025919 Bacteria 14367
82 Ga0207652_10021549 3300025921 Bacteria 5319
83 Ga0207652_10023030 3300025921 Bacteria 5159
84 Ga0207652_10316850 3300025921 Bacteria 1408
85 Ga0207646_10007499 3300025922 Bacteria 11072
86 Ga0207646_10160223 3300025922 Bacteria 2030
87 Ga0207646_10414658 3300025922 Bacteria 1216
88 Ga0207700_10000001 3300025928 Bacteria 1122509
89 Ga0207700_10585608 3300025928 Bacteria 992
90 Ga0207664_10054250 3300025929 Bacteria 3175
91 Ga0207664_10206032 3300025929 Bacteria 1700
92 Ga0207664_10219404 3300025929 Bacteria 1648
93 Ga0207664_10334740 3300025929 Bacteria 1338
94 Ga0207664_10587464 3300025929 Bacteria 1000
95 Ga0207664_10597642 3300025929 Bacteria 991
96 Ga0207665_10051510 3300025939 Bacteria 2771
97 Ga0207665_10507129 3300025939 Bacteria 933
98 Ga0207711_10290179 3300025941 Bacteria 1508
99 Ga0207661_10073084 3300025944 Bacteria 2807
100 Ga0207661_10155907 3300025944 Bacteria 1978
101 Ga0207661_10466874 3300025944 Bacteria 1151
102 Ga0207667_10529267 3300025949 Bacteria 1193
103 Ga0207702_10115274 3300026078 Bacteria 2396
104 Ga0265319_1003779 3300028563 Bacteria 7763
105 Ga0265338_10022046 3300028800 Bacteria 6617
106 Ga0265320_10069579 3300031240 Unclassified 1661
107 Ga0395899_0007735 3300037312 Bacteria 8287
108 Ga0395900_0018504 3300037418 Bacteria 7105
109 Ga0395898_0004532 3300037466 Bacteria 15167
110 Ga0395898_0446682 3300037466 Bacteria 1232
111 Ga0395898_1079582 3300037466 Bacteria 737
112 Ga0395905_0035362 3300037471 Bacteria 4691
113 Ga0395901_0000956 3300038443 Bacteria 31448
114 Ga0436360_1034257 3300039438 Bacteria 2022
115 Ga0466969_0000334 3300044656 Bacteria 26092
116 Ga0466972_0012646 3300044658 Bacteria 4240
117 Ga0466965_0036888 3300044683 Bacteria 2399
118 Ga0466965_0080723 3300044683 Bacteria 1644
119 Ga0466966_0124317 3300044684 Bacteria 1583
120 Ga0466961_0021621 3300044693 Bacteria 4139
121 Ga0466961_0043099 3300044693 Bacteria 2891
122 Ga0466961_0082781 3300044693 Bacteria 2030
123 Ga0466963_0000561 3300044694 Bacteria 17527
124 Ga0466963_0000849 3300044694 Bacteria 15394
125 Ga0466963_0001549 3300044694 Bacteria 12465
126 Ga0466963_0007974 3300044694 Bacteria 6339
127 Ga0466963_0012854 3300044694 Bacteria 5129
128 Ga0466963_0021022 3300044694 Bacteria 4112
129 Ga0466963_0034810 3300044694 Bacteria 3278
130 Ga0466963_0069865 3300044694 Bacteria 2361
131 Ga0466963_0072212 3300044694 Bacteria 2324
132 Ga0466963_0159500 3300044694 Bacteria 1570
133 Ga0466963_0167542 3300044694 Bacteria 1530
134 Ga0466963_0198466 3300044694 Bacteria 1403
135 Ga0466964_0000591 3300044706 Bacteria 11457
136 Ga0466964_0010270 3300044706 Bacteria 3531
137 Ga0466964_0014106 3300044706 Bacteria 3036
138 Ga0466964_0105775 3300044706 Bacteria 1248
139 Ga0466971_0000267 3300044719 Bacteria 20039
140 Ga0466971_0008611 3300044719 Bacteria 4449
141 Ga0466971_0010412 3300044719 Bacteria 4064
142 Ga0466968_0000593 3300044735 Bacteria 12324
143 Ga0466968_0132714 3300044735 Bacteria 1134
144 Ga0466968_0347216 3300044735 Unclassified 720
145 Ga0466970_0051718 3300044765 Bacteria 2193
146 Ga0466957_0014590 3300044842 Bacteria 4577
147 Ga0466957_0021097 3300044842 Bacteria 3836
148 Ga0466957_0021760 3300044842 Bacteria 3779
149 Ga0466957_0060746 3300044842 Bacteria 2318
150 Ga0466957_0088033 3300044842 Bacteria 1942
151 Ga0466957_0160842 3300044842 Bacteria 1458
152 Ga0466957_0255228 3300044842 Bacteria 1167
153 Ga0466960_0009241 3300044901 Bacteria 4059
154 Ga0466960_0236664 3300044901 Bacteria 1010
155 Ga0466959_0037637 3300045049 Bacteria 3575
156 Ga0466958_0000366 3300045836 Bacteria 18277
157 Ga0466958_0001423 3300045836 Bacteria 11328
158 Ga0466958_0015830 3300045836 Bacteria 4332
159 Ga0466958_0020696 3300045836 Bacteria 3838
160 Ga0466958_0071459 3300045836 Bacteria 2125
161 Ga0466958_0369631 3300045836 Unclassified 924
162 Ga0466967_0000827 3300045976 Bacteria 16302
163 Ga0466967_0016321 3300045976 Bacteria 5852
164 Ga0466967_0036991 3300045976 Bacteria 4173
165 Ga0466967_0037816 3300045976 Bacteria 4134
166 Ga0466967_0115024 3300045976 Bacteria 2477
167 Ga0466967_0139354 3300045976 Bacteria 2258
168 Ga0466967_0586809 3300045976 Bacteria 1099
169 Ga0466967_0642987 3300045976 Bacteria 1048
170 Ga0466967_0670157 3300045976 Archaea 1026
171 Ga0466967_1265554 3300045976 Bacteria 735
172 Ga0495603_0054140 3300046455 Bacteria 2379
173 Ga0495582_0158845 3300046473 Bacteria 1285
174 Ga0495639_0245812 3300046475 Bacteria 884
175 Ga0495594_0142128 3300046499 Unclassified 1362
176 Ga0495630_0430664 3300046517 Bacteria 1011
177 Ga0495667_0051561 3300046559 Bacteria 2714
178 Ga0495657_0050521 3300046675 Bacteria 2795
179 Ga0495613_0254860 3300046689 Unclassified 1224
180 Ga0495613_0631157 3300046689 Unclassified 710
181 Ga0495624_0444360 3300046690 Bacteria 777
182 Ga0495600_0235582 3300046809 Bacteria 1167
183 Ga0495676_0096377 3300047321 Bacteria 2199
184 Ga0495676_0368344 3300047321 Bacteria 958
185 Ga0495680_0040908 3300047322 Bacteria 3689
186 Ga0495675_0357515 3300047444 Bacteria 858
187 Ga0495684_0041940 3300047471 Bacteria 3506
188 Ga0496100_0059783 3300048903 Bacteria 2506
189 Ga0496100_0937239 3300048903 Bacteria 680
190 Ga0496102_0037538 3300048905 Bacteria 4371
191 Ga0496102_0044582 3300048905 Bacteria 4026
192 Ga0496102_0094154 3300048905 Bacteria 2775
193 Ga0496103_0026862 3300048906 Bacteria 3484
194 Ga0496104_0194114 3300048907 Bacteria 1942
195 Ga0496105_0119769 3300048908 Bacteria 2171
196 Ga0496105_0121772 3300048908 Bacteria 2151
197 Ga0496106_0002389 3300048909 Bacteria 13989
198 Ga0496107_0007016 3300048910 Bacteria 7762
199 Ga0496107_0518145 3300048910 Bacteria 884
200 Ga0496108_0545360 3300048911 Bacteria 1012
201 Ga0496109_0119279 3300048912 Bacteria 2456
202 Ga0496109_0209920 3300048912 Bacteria 1831
203 Ga0496109_0820971 3300048912 Bacteria 868
204 Ga0496109_0959735 3300048912 Bacteria 793
205 Ga0496110_0039665 3300048913 Bacteria 4101
206 Ga0496110_1236627 3300048913 Bacteria 656
207 Ga0496111_0067661 3300048914 Bacteria 2595
208 Ga0496111_0333574 3300048914 Bacteria 1123
209 Ga0496112_0013440 3300048915 Bacteria 7557
210 Ga0496112_0029060 3300048915 Bacteria 5344
211 Ga0496112_0039476 3300048915 Bacteria 4614
212 Ga0496112_0052937 3300048915 Bacteria 3985
213 Ga0496112_0091826 3300048915 Bacteria 3005
214 Ga0496112_0117625 3300048915 Unclassified 2628
215 Ga0496112_0659844 3300048915 Bacteria 975
216 Ga0496113_0040918 3300048916 Bacteria 3417
217 Ga0496113_0514441 3300048916 Bacteria 961
218 Ga0496114_0088395 3300048917 Bacteria 2628
219 Ga0496115_0153540 3300048918 Bacteria 1901
220 Ga0501067_0301244 3300049583 Bacteria 892
221 Ga0501069_0118088 3300049585 Bacteria 1513
222 Ga0501069_0137723 3300049585 Bacteria 1399
223 Ga0501069_0369811 3300049585 Unclassified 846
224 nmdc:mga05p37_869896_c1 3300050507 Bacteria 976
225 nmdc:mga0rr50_33298_c1 3300050513 Bacteria 3680
226 nmdc:mga08x19_386396_c1 3300050514 Bacteria 980
227 nmdc:mga08x19_443501_c1 3300050514 Bacteria 913
228 Ga0495601_0087737 3300053077 Bacteria 2000
229 Ga0495655_0002901 3300053083 Bacteria 2769
230 Ga0495595_0006487 3300053084 Bacteria 4774
231 Ga0495595_0062530 3300053084 Bacteria 1746
232 Ga0495619_0237998 3300053085 Bacteria 1261
233 Ga0466962_0002302 3300061719 Bacteria 9052
234 Ga0466962_0004013 3300061719 Bacteria 7051
235 Ga0466962_0018002 3300061719 Bacteria 3399
236 Ga0466962_0030590 3300061719 Bacteria 2579
237 Ga0466962_0107366 3300061719 Unclassified 1343
238 Ga0530510_0463862 3300061734 Bacteria 958
239 Ga0495582_0216659
240 Ga0070658_10037019
241 Ga0070683_100126471
242 Ga0070683_100585096
243 Ga0070683_100974450
244 Ga0070680_100800394
245 Ga0070709_10201168
246 Ga0070714_100024089
247 Ga0070714_100138662
248 Ga0070714_100392820
249 Ga0070714_100460495
250 Ga0070714_100695531
251 Ga0070713_100005051
252 Ga0070713_100041779
253 Ga0070713_100042227
254 Ga0070711_100219007
255 Ga0070708_100002568
256 Ga0070681_10136892
257 Ga0070681_10147898
258 Ga0070681_10289817
259 Ga0070706_100055882
260 Ga0070706_100085939
261 Ga0070707_100015223
262 Ga0070707_100142001
263 Ga0070707_100484653
264 Ga0070698_100117720
265 Ga0070698_100217563
266 Ga0070698_100596672
267 Ga0070699_100159396
268 Ga0070679_100046975
269 Ga0070679_100154425
270 Ga0070679_100215764
271 Ga0070679_100227287
272 Ga0070679_100242895
273 Ga0070679_100261734
274 Ga0070684_100121961
275 Ga0070697_100393455
276 Ga0070695_100000334
277 Ga0070696_100283390
278 Ga0070664_100079242
279 Ga0068857_100312430
280 Ga0070716_100007042
281 Ga0070716_100457403
282 Ga0070712_100154000
283 Ga0070712_100293575
284 Ga0075436_100207988
285 Ga0075436_100629513
286 Ga0105240_10033877
287 Ga0114129_10431387
288 Ga0105241_10482671
289 Ga0105248_10443352
290 Ga0105237_10030249
291 Ga0105239_11021675
292 Ga0157371_10150253
293 Ga0157370_10503476
294 Ga0157370_10516722
295 Ga0157370_10661817
296 Ga0157370_10745822
297 Ga0157369_10002166
298 Ga0157369_11312127
299 Ga0157372_10024543
300 Ga0157372_10162973
301 Ga0157372_10623647
302 Ga0182008_10030506
303 Ga0182008_10139801
304 Ga0182006_1062235
305 Ga0182007_10009300
306 Ga0207699_10062769
307 Ga0207705_10126056
308 Ga0207684_10212912
309 Ga0207684_10674497
310 Ga0207707_10045724
311 Ga0207707_10081208
312 Ga0207707_10109945
313 Ga0207707_10146307
314 Ga0207695_10138115
315 Ga0207671_10136876
316 Ga0207693_10001626
317 Ga0207660_10127451
318 Ga0207660_10223936
319 Ga0207657_10004733
320 Ga0207652_10021549
321 Ga0207652_10023030
322 Ga0207652_10316850
323 Ga0207646_10007499
324 Ga0207646_10160223
325 Ga0207646_10414658
326 Ga0207700_10000001
327 Ga0207700_10585608
328 Ga0207664_10054250
329 Ga0207664_10206032
330 Ga0207664_10219404
331 Ga0207664_10334740
332 Ga0207664_10587464
333 Ga0207664_10597642
334 Ga0207665_10051510
335 Ga0207665_10507129
336 Ga0207711_10290179
337 Ga0207661_10073084
338 Ga0207661_10155907
339 Ga0207661_10466874
340 Ga0207667_10529267
341 Ga0207702_10115274
342 Ga0265319_1003779
343 Ga0265338_10022046
344 Ga0265320_10069579
345 Ga0395899_0007735
346 Ga0395900_0018504
347 Ga0395898_0004532
348 Ga0395898_0446682
349 Ga0395898_1079582
350 Ga0395905_0035362
351 Ga0395901_0000956
352 Ga0436360_1034257
353 Ga0466969_0000334
354 Ga0466972_0012646
355 Ga0466965_0036888
356 Ga0466965_0080723
357 Ga0466966_0124317
358 Ga0466961_0021621
359 Ga0466961_0043099
360 Ga0466961_0082781
361 Ga0466963_0000561
362 Ga0466963_0000849
363 Ga0466963_0001549
364 Ga0466963_0007974
365 Ga0466963_0012854
366 Ga0466963_0021022
367 Ga0466963_0034810
368 Ga0466963_0069865
369 Ga0466963_0072212
370 Ga0466963_0159500
371 Ga0466963_0167542
372 Ga0466963_0198466
373 Ga0466964_0000591
374 Ga0466964_0010270
375 Ga0466964_0014106
376 Ga0466964_0105775
377 Ga0466971_0000267
378 Ga0466971_0008611
379 Ga0466971_0010412
380 Ga0466968_0000593
381 Ga0466968_0132714
382 Ga0466968_0347216
383 Ga0466970_0051718
384 Ga0466957_0014590
385 Ga0466957_0021097
386 Ga0466957_0021760
387 Ga0466957_0060746
388 Ga0466957_0088033
389 Ga0466957_0160842
390 Ga0466957_0255228
391 Ga0466960_0009241
392 Ga0466960_0236664
393 Ga0466959_0037637
394 Ga0466958_0000366
395 Ga0466958_0001423
396 Ga0466958_0015830
397 Ga0466958_0020696
398 Ga0466958_0071459
399 Ga0466958_0369631
400 Ga0466967_0000827
401 Ga0466967_0016321
402 Ga0466967_0036991
403 Ga0466967_0037816
404 Ga0466967_0115024
405 Ga0466967_0139354
406 Ga0466967_0586809
407 Ga0466967_0642987
408 Ga0466967_0670157
409 Ga0466967_1265554
410 Ga0495603_0054140
411 Ga0495582_0158845
412 Ga0495639_0245812
413 Ga0495594_0142128
414 Ga0495630_0430664
415 Ga0495667_0051561
416 Ga0495657_0050521
417 Ga0495613_0254860
418 Ga0495613_0631157
419 Ga0495624_0444360
420 Ga0495600_0235582
421 Ga0495676_0096377
422 Ga0495676_0368344
423 Ga0495680_0040908
424 Ga0495675_0357515
425 Ga0495684_0041940
426 Ga0496100_0059783
427 Ga0496100_0937239
428 Ga0496102_0037538
429 Ga0496102_0044582
430 Ga0496102_0094154
431 Ga0496103_0026862
432 Ga0496104_0194114
433 Ga0496105_0119769
434 Ga0496105_0121772
435 Ga0496106_0002389
436 Ga0496107_0007016
437 Ga0496107_0518145
438 Ga0496108_0545360
439 Ga0496109_0119279
440 Ga0496109_0209920
441 Ga0496109_0820971
442 Ga0496109_0959735
443 Ga0496110_0039665
444 Ga0496110_1236627
445 Ga0496111_0067661
446 Ga0496111_0333574
447 Ga0496112_0013440
448 Ga0496112_0029060
449 Ga0496112_0039476
450 Ga0496112_0052937
451 Ga0496112_0091826
452 Ga0496112_0117625
453 Ga0496112_0659844
454 Ga0496113_0040918
455 Ga0496113_0514441
456 Ga0496114_0088395
457 Ga0496115_0153540
458 Ga0501067_0301244
459 Ga0501069_0118088
460 Ga0501069_0137723
461 Ga0501069_0369811
462 nmdc:mga05p37_869896_c1
463 nmdc:mga0rr50_33298_c1
464 nmdc:mga08x19_386396_c1
465 nmdc:mga08x19_443501_c1
466 Ga0495601_0087737
467 Ga0495655_0002901
468 Ga0495595_0006487
469 Ga0495595_0062530
470 Ga0495619_0237998
471 Ga0466962_0002302
472 Ga0466962_0004013
473 Ga0466962_0018002
474 Ga0466962_0030590
475 Ga0466962_0107366
476 Ga0530510_0463862

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09335

VTT_dom

VTT domain

70

199

0.84

Map