F351178

General Info

Members Datasets Scaffolds Average Seq Length
238 188 229 156

Family's Representative Sequence

Representative Sequence 3300041452|Ga0451793_1903217|Ga0451793_1903217_89_580
Length 163
Sequence MGAGGATLTMSYLVVKWIHVLSSTVLFGTGLGIAFFLWIAHRRGDVAHIAATARSVVTADLVFTAPAVVVQFASGLWLVHHLGLPLSMFWLKTALVLFFVVGACWLPVLWLQWRLREFAGAAAQTGSPLPVAYHRTFRLWFWLGWPAFFSVLAIFWLMVAKPM

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 2643221559 Lysobacter sp. Root559 Isolate Unclassified
4 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
5 2643221586 Lysobacter sp. Root667 Isolate Unclassified
6 2643221593 Lysobacter sp. Root690 Isolate Unclassified
7 2643221612 Lysobacter sp. Root76 Isolate Unclassified
8 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
9 2643221727 Lysobacter sp. Root96 Isolate Unclassified
10 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
11 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
53 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
56 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
59 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
61 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
79 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
80 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
81 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
82 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
83 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
84 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
85 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
86 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
87 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
88 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
89 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
90 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
91 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
92 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
93 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
98 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
99 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
100 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
101 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
102 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
103 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
104 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
105 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
106 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
107 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
108 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
109 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
110 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
111 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
112 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
113 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
114 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
115 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
116 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
117 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
118 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
119 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
120 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
121 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
122 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
123 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
124 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
125 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
126 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
127 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
128 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
129 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
130 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
131 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
132 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
133 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
134 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
135 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
136 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
137 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
138 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
139 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
140 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
141 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
142 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
143 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
144 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
148 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
149 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
150 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
151 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
152 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
153 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
160 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
161 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
162 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
163 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
164 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
165 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
166 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
169 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
171 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
172 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
173 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
174 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
175 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
178 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
179 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
180 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
181 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
182 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
183 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
184 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
185 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
186 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
187 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
188 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.22
Metatranscriptomes 0
Isolates 3.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.81
Nodule 0
Rhizoplane 2.94
Rhizosphere 74.37
Stem 0
Stem Tuber 0
Unclassified 5.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_533075 2162886007 Bacteria 3551
2 MBSR1b_contig_4541377 2162886012 Bacteria 1087
3 MBSR1b_contig_951218 2162886012 Bacteria 1088
4 JGI25151J46595_10000160 3300003187 Bacteria 86811
5 JGI25153J46596_10138373 3300003215 Bacteria 533
6 Ga0055526_1000014 3300003771 Bacteria 233327
7 Ga0055537_1000059 3300003773 Bacteria 79628
8 Ga0055524_1000019 3300003775 Bacteria 233561
9 Ga0055524_1007011 3300003775 Bacteria 4840
10 Ga0055534_1000012 3300003784 Bacteria 153530
11 Ga0055528_1000007 3300003790 Bacteria 233327
12 Ga0055530_10001396 3300003791 Bacteria 17854
13 Ga0055531_10037764 3300003794 Bacteria 1462
14 Ga0055531_10038643 3300003794 Bacteria 1429
15 Ga0065704_10003976 3300005289 Bacteria 6843
16 Ga0070658_10017884 3300005327 Bacteria 5670
17 Ga0070680_100167963 3300005336 Bacteria 1845
18 Ga0070680_100578403 3300005336 Bacteria 963
19 Ga0070680_101056907 3300005336 Bacteria 701
20 Ga0070692_10268926 3300005345 Bacteria 1028
21 Ga0070668_101129149 3300005347 Bacteria 708
22 Ga0070709_10077580 3300005434 Bacteria 2160
23 Ga0070713_100077684 3300005436 Bacteria 2824
24 Ga0070708_100526080 3300005445 Bacteria 1115
25 Ga0070663_100220107 3300005455 Bacteria 1490
26 Ga0070681_10008130 3300005458 Bacteria 10267
27 Ga0070681_10365406 3300005458 Bacteria 1353
28 Ga0070681_10636586 3300005458 Bacteria 981
29 Ga0070679_100002016 3300005530 Bacteria 18231
30 Ga0070679_100171276 3300005530 Bacteria 2144
31 Ga0070684_100173619 3300005535 Bacteria 1958
32 Ga0070696_100077834 3300005546 Bacteria 2344
33 Ga0068855_100749073 3300005563 Bacteria 1042
34 Ga0068855_100750123 3300005563 Unclassified 1041
35 Ga0068857_101395475 3300005577 Bacteria 681
36 Ga0075363_100256195 3300006048 Bacteria 1008
37 Ga0070712_100238107 3300006175 Unclassified 1449
38 Ga0070712_100849139 3300006175 Unclassified 785
39 Ga0075367_10110607 3300006178 Bacteria 1686
40 Ga0075369_10347225 3300006186 Unclassified 696
41 Ga0097621_101511163 3300006237 Unclassified 637
42 Ga0075433_10038485 3300006852 Bacteria 4131
43 Ga0075434_100013631 3300006871 Bacteria 7747
44 Ga0105240_10013878 3300009093 Bacteria 11035
45 Ga0105240_10133885 3300009093 Bacteria 2969
46 Ga0105240_10462517 3300009093 Unclassified 1417
47 Ga0111539_10159814 3300009094 Bacteria 2636
48 Ga0114129_10028814 3300009147 Bacteria 7868
49 Ga0114129_11285250 3300009147 Bacteria 907
50 Ga0114129_12384197 3300009147 Unclassified 634
51 Ga0105238_10175760 3300009551 Bacteria 2118
52 Ga0157373_10218156 3300013100 Bacteria 1345
53 Ga0157370_10030157 3300013104 Bacteria 5316
54 Ga0157372_10319014 3300013307 Bacteria 1809
55 Ga0157375_10014395 3300013308 Bacteria 7054
56 Ga0157376_10509319 3300014969 Bacteria 1184
57 Ga0183360_10002 3300015689 Bacteria 953821
58 Ga0209565_1000001 3300025263 Bacteria 2950419
59 Ga0209673_1000001 3300025273 Bacteria 3176258
60 Ga0209130_1007074 3300025284 Bacteria 3521
61 Ga0209675_1000001 3300025291 Bacteria 2950293
62 Ga0209676_1006481 3300025292 Bacteria 5765
63 Ga0209025_1000006 3300025294 Bacteria 1153444
64 Ga0209564_1000001 3300025295 Bacteria 3176258
65 Ga0209564_1007240 3300025295 Bacteria 5772
66 Ga0209564_1008102 3300025295 Bacteria 5259
67 Ga0209758_1041509 3300025297 Bacteria 1719
68 Ga0209050_1002116 3300025298 Bacteria 18094
69 Ga0209256_1000006 3300025299 Bacteria 1250310
70 Ga0209256_1001986 3300025299 Bacteria 18396
71 Ga0209051_1022773 3300025303 Bacteria 2626
72 Ga0209257_1012708 3300025304 Bacteria 3850
73 Ga0209257_1017637 3300025304 Bacteria 2799
74 Ga0207692_10402134 3300025898 Bacteria 854
75 Ga0207699_10072831 3300025906 Bacteria 2105
76 Ga0207707_10013124 3300025912 Bacteria 7219
77 Ga0207707_10580517 3300025912 Bacteria 950
78 Ga0207707_10820848 3300025912 Bacteria 773
79 Ga0207707_11153762 3300025912 Unclassified 629
80 Ga0207695_10000831 3300025913 Bacteria 57278
81 Ga0207695_10068230 3300025913 Bacteria 3643
82 Ga0207693_10029611 3300025915 Bacteria 4323
83 Ga0207693_10100420 3300025915 Bacteria 2269
84 Ga0207660_11133608 3300025917 Bacteria 637
85 Ga0207652_10047112 3300025921 Bacteria 3682
86 Ga0207652_10256561 3300025921 Bacteria 1577
87 Ga0207652_10288104 3300025921 Unclassified 1482
88 Ga0207650_10781369 3300025925 Bacteria 809
89 Ga0207700_10170274 3300025928 Bacteria 1816
90 Ga0207668_10937596 3300025972 Bacteria 772
91 Ga0207678_10450206 3300026067 Unclassified 1119
92 Ga0207702_10215841 3300026078 Unclassified 1786
93 Ga0207674_11125356 3300026116 Bacteria 754
94 Ga0207428_10047562 3300027907 Bacteria 3444
95 Ga0307513_10069400 3300031456 Bacteria 3688
96 Ga0307406_10054515 3300031901 Bacteria 2552
97 Ga0373923_0001286 3300035111 Bacteria 7082
98 Ga0373936_0024008 3300035113 Bacteria 2378
99 Ga0373945_0010533 3300035116 Bacteria 3046
100 Ga0373954_0001827 3300035118 Bacteria 8779
101 Ga0373956_0214043 3300035119 Bacteria 914
102 Ga0373943_0043578 3300035170 Bacteria 2180
103 Ga0373946_0007729 3300035171 Bacteria 3940
104 Ga0373955_0000323 3300035172 Bacteria 19864
105 Ga0373955_0096367 3300035172 Bacteria 1693
106 Ga0373955_0346284 3300035172 Bacteria 900
107 Ga0373924_0002816 3300035410 Bacteria 5884
108 Ga0373924_0188232 3300035410 Bacteria 909
109 Ga0373935_0000126 3300035692 Bacteria 34519
110 Ga0373927_0013375 3300035695 Bacteria 5457
111 Ga0373927_0210230 3300035695 Bacteria 1278
112 Ga0373927_0527070 3300035695 Bacteria 781
113 Ga0373933_0000787 3300035724 Bacteria 19357
114 Ga0373933_0012533 3300035724 Bacteria 4685
115 Ga0373933_0074715 3300035724 Bacteria 2068
116 Ga0373947_0007287 3300035725 Bacteria 6409
117 Ga0373947_0529838 3300035725 Bacteria 801
118 Ga0373937_0006059 3300036401 Bacteria 10409
119 Ga0373937_0130011 3300036401 Bacteria 2351
120 Ga0373937_0134009 3300036401 Unclassified 2315
121 Ga0373925_0000353 3300037068 Bacteria 47782
122 Ga0395900_0008745 3300037418 Bacteria 10402
123 Ga0436363_0224229 3300039450 Bacteria 1806
124 Ga0439439_0003429 3300041406 Bacteria 3496
125 Ga0451793_1903217 3300041452 Bacteria 619
126 Ga0451807_1813092 3300041486 Bacteria 1191
127 Ga0451837_1726734 3300041494 Bacteria 969
128 Ga0439445_0006654 3300042004 Bacteria 2662
129 Ga0439449_0004317 3300042007 Bacteria 5492
130 Ga0439449_0199096 3300042007 Bacteria 750
131 Ga0450900_034823 3300042136 Bacteria 740
132 Ga0451577_0147167 3300042876 Bacteria 2118
133 Ga0495592_0000284 3300046454 Bacteria 43567
134 Ga0495629_0127888 3300046459 Bacteria 1770
135 Ga0495638_0014933 3300046460 Bacteria 5230
136 Ga0495651_0060221 3300046462 Bacteria 2909
137 Ga0495653_0000330 3300046463 Bacteria 38640
138 Ga0495580_0464715 3300046472 Bacteria 848
139 Ga0495582_0124782 3300046473 Bacteria 1452
140 Ga0495662_0010166 3300046476 Bacteria 4611
141 Ga0495664_0000098 3300046477 Bacteria 43069
142 Ga0495664_0460885 3300046477 Bacteria 761
143 Ga0495584_0195647 3300046491 Bacteria 1028
144 Ga0495608_0000318 3300046511 Bacteria 33912
145 Ga0495618_0000235 3300046514 Bacteria 40243
146 Ga0495618_0590513 3300046514 Bacteria 662
147 Ga0495628_0001752 3300046516 Bacteria 19728
148 Ga0495628_1004971 3300046516 Unclassified 574
149 Ga0495630_0002403 3300046517 Bacteria 12996
150 Ga0495652_0000305 3300046529 Bacteria 58441
151 Ga0495640_0000388 3300046533 Bacteria 31270
152 Ga0495640_0080380 3300046533 Bacteria 2168
153 Ga0495587_0000249 3300046536 Bacteria 39283
154 Ga0495609_0035341 3300046538 Bacteria 2262
155 Ga0495645_0000902 3300046543 Bacteria 20216
156 Ga0495667_0000195 3300046559 Bacteria 40983
157 Ga0495634_0002926 3300046642 Bacteria 13957
158 Ga0495634_0103015 3300046642 Bacteria 1842
159 Ga0495635_0000185 3300046663 Bacteria 39314
160 Ga0495657_0001331 3300046675 Bacteria 21493
161 Ga0495599_0000168 3300046678 Bacteria 43232
162 Ga0495623_0000908 3300046679 Bacteria 20056
163 Ga0495646_0000490 3300046680 Bacteria 21118
164 Ga0495658_0133168 3300046683 Bacteria 1515
165 Ga0495613_0067982 3300046689 Bacteria 2600
166 Ga0495613_0129442 3300046689 Bacteria 1808
167 Ga0495624_0021955 3300046690 Bacteria 4226
168 Ga0495600_0000210 3300046809 Bacteria 33567
169 Ga0495581_0037371 3300047315 Bacteria 2810
170 Ga0495604_0000003 3300047317 Bacteria 464246
171 Ga0495674_0000006 3300047319 Bacteria 341772
172 Ga0495680_0001799 3300047322 Bacteria 22686
173 Ga0495675_0000336 3300047444 Bacteria 33140
174 Ga0495684_0000287 3300047471 Bacteria 40835
175 Ga0495686_0450393 3300047472 Bacteria 684
176 Ga0495593_0003871 3300047673 Bacteria 8942
177 Ga0495602_0000805 3300048088 Bacteria 29994
178 Ga0496102_0048466 3300048905 Bacteria 3863
179 Ga0496104_0102119 3300048907 Bacteria 2746
180 Ga0496110_0601706 3300048913 Bacteria 997
181 Ga0496114_0005851 3300048917 Bacteria 9659
182 Ga0496115_0151385 3300048918 Unclassified 1916
183 Ga0496121_0001866 3300048924 Bacteria 33822
184 Ga0496124_0000034 3300048927 Bacteria 325332
185 Ga0496126_0047708 3300048929 Bacteria 3920
186 Ga0501033_0189578 3300049570 Bacteria 1472
187 Ga0501034_0278592 3300049571 Bacteria 1612
188 Ga0501037_0032125 3300049573 Bacteria 3875
189 Ga0501038_0232357 3300049574 Bacteria 1467
190 Ga0501042_0166823 3300049578 Bacteria 1589
191 Ga0501047_0002537 3300049581 Bacteria 17406
192 Ga0501047_0152042 3300049581 Unclassified 2190
193 Ga0501068_0112615 3300049584 Bacteria 1693
194 Ga0501069_0107173 3300049585 Bacteria 1589
195 Ga0501070_0009411 3300049586 Bacteria 8258
196 Ga0501071_0005970 3300049587 Bacteria 7887
197 Ga0501072_0271671 3300049588 Bacteria 1349
198 Ga0501073_0020769 3300049589 Bacteria 4735
199 Ga0501073_0813453 3300049589 Bacteria 644
200 Ga0501074_0002091 3300049590 Bacteria 13779
201 Ga0501077_0957316 3300049593 Bacteria 551
202 Ga0501080_0004757 3300049742 Bacteria 12108
203 Ga0501080_1583842 3300049742 Bacteria 555
204 Ga0501083_0166026 3300049744 Bacteria 1443
205 Ga0501035_0014951 3300049822 Bacteria 7161
206 Ga0501044_0007417 3300049823 Bacteria 12064
207 nmdc:mga03n38_495496_c1 3300050490 Bacteria 685
208 nmdc:mga0yw44_9507_c2 3300050492 Bacteria 2194
209 nmdc:mga0k408_120993_c1 3300050493 Bacteria 1550
210 nmdc:mga06z11_336421_c1 3300050494 Bacteria 902
211 nmdc:mga06z11_664420_c1 3300050494 Bacteria 634
212 nmdc:mga04h51_7856_c2 3300050495 Bacteria 2434
213 nmdc:mga05p37_1622379_c1 3300050507 Unclassified 636
214 nmdc:mga05p37_416864_c1 3300050507 Bacteria 1564
215 nmdc:mga0n895_2770_c1 3300050512 Bacteria 13857
216 nmdc:mga08x19_915060_c1 3300050514 Unclassified 623
217 nmdc:mga0a205_30683_c1 3300050515 Bacteria 5149
218 Ga0495601_0000004 3300053077 Bacteria 449178
219 Ga0495601_0008916 3300053077 Bacteria 5921
220 Ga0495601_0261279 3300053077 Bacteria 1130
221 Ga0495612_0000008 3300053078 Bacteria 232633
222 Ga0495595_0000720 3300053084 Bacteria 12606
223 Ga0495619_0003271 3300053085 Bacteria 10472
224 Ga0500578_0655994 3300053086 Bacteria 570
225 Ga0500641_0011359 3300053096 Bacteria 3230
226 Ga0500595_016561 3300053119 Bacteria 2743
227 Ga0500642_0102055 3300053130 Bacteria 1335
228 Ga0501082_0115450 3300060353 Bacteria 2325
229 Ga0501082_1612538 3300060353 Bacteria 566

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025972 Ga0207668_10937596 Ga0207668_109375961 136
2 3300053086 Ga0500578_0655994 Ga0500578_0655994_78_548 139
3 3300005445 Ga0070708_100526080 Ga0070708_1005260802 140
4 3300009147 Ga0114129_11285250 Ga0114129_112852501 140
5 3300050494 nmdc:mga06z11_664420_c1 nmdc:mga06z11_664420_c1_14_436 140
6 3300015689 Ga0183360_10002 Ga0183360_10002724 141
7 3300048924 Ga0496121_0001866 Ga0496121_0001866_19739_20212 141
8 3300009147 Ga0114129_10028814 Ga0114129_100288146 143
9 3300046683 Ga0495658_0133168 Ga0495658_0133168_416_862 143
10 3300050507 nmdc:mga05p37_416864_c1 nmdc:mga05p37_416864_c1_229_705 143
11 3300046689 Ga0495613_0067982 Ga0495613_0067982_1623_2063 144
12 3300046460 Ga0495638_0014933 Ga0495638_0014933_555_1025 145
13 3300042876 Ga0451577_0147167 Ga0451577_0147167_249_728 147
14 iso_pu_bacteria 2643221559 2643818238 150
15 iso_pu_bacteria 2643221579 2643906680 150
16 iso_pu_bacteria 2643221586 2643937907 150
17 iso_pu_bacteria 2643221593 2643973430 150
18 iso_pu_bacteria 2643221612 2644078816 150
19 iso_pu_bacteria 2643221663 2644352848 150
20 iso_pu_bacteria 2643221727 2644693593 150
21 iso_pu_bacteria 2941489479 2941493638 150
22 iso_pu_bacteria 2995948881 2995949583 150
23 3300005336 Ga0070680_100167963 Ga0070680_1001679632 153
24 3300005458 Ga0070681_10008130 Ga0070681_100081303 153
25 3300005458 Ga0070681_10636586 Ga0070681_106365862 153
26 3300005530 Ga0070679_100002016 Ga0070679_10000201613 153
27 3300005530 Ga0070679_100171276 Ga0070679_1001712763 153
28 3300005535 Ga0070684_100173619 Ga0070684_1001736193 153
29 3300005563 Ga0068855_100750123 Ga0068855_1007501232 153
30 3300006175 Ga0070712_100238107 Ga0070712_1002381073 153
31 3300006237 Ga0097621_101511163 Ga0097621_1015111631 153
32 3300009551 Ga0105238_10175760 Ga0105238_101757603 153
33 3300014969 Ga0157376_10509319 Ga0157376_105093191 153
34 3300025912 Ga0207707_10013124 Ga0207707_100131245 153
35 3300025915 Ga0207693_10100420 Ga0207693_101004202 153
36 3300025917 Ga0207660_11133608 Ga0207660_111336081 153
37 3300025921 Ga0207652_10047112 Ga0207652_100471123 153
38 3300025921 Ga0207652_10288104 Ga0207652_102881043 153
39 3300026078 Ga0207702_10215841 Ga0207702_102158412 153
40 3300035724 Ga0373933_0012533 Ga0373933_0012533_529_993 153
41 3300036401 Ga0373937_0130011 Ga0373937_0130011_752_1216 153
42 3300049593 Ga0501077_0957316 Ga0501077_0957316_29_490 153
43 3300060353 Ga0501082_1612538 Ga0501082_1612538_76_537 153
44 2162886007 SwRhRL2b_contig_533075 SwRhRL2b_0178.00004680 154
45 2162886012 MBSR1b_contig_4541377 MBSR1b_0129.00002100 154
46 2162886012 MBSR1b_contig_951218 MBSR1b_0969.00002690 154
47 3300003187 JGI25151J46595_10000160 JGI25151J46595_1000016043 154
48 3300003215 JGI25153J46596_10138373 JGI25153J46596_101383731 154
49 3300003771 Ga0055526_1000014 Ga0055526_100001482 154
50 3300003773 Ga0055537_1000059 Ga0055537_100005977 154
51 3300003775 Ga0055524_1000019 Ga0055524_1000019134 154
52 3300003775 Ga0055524_1007011 Ga0055524_10070114 154
53 3300003784 Ga0055534_1000012 Ga0055534_100001282 154
54 3300003790 Ga0055528_1000007 Ga0055528_100000782 154
55 3300003791 Ga0055530_10001396 Ga0055530_100013963 154
56 3300003794 Ga0055531_10037764 Ga0055531_100377642 154
57 3300003794 Ga0055531_10038643 Ga0055531_100386432 154
58 3300005289 Ga0065704_10003976 Ga0065704_100039764 154
59 3300005327 Ga0070658_10017884 Ga0070658_100178843 154
60 3300005336 Ga0070680_100578403 Ga0070680_1005784032 154
61 3300005336 Ga0070680_101056907 Ga0070680_1010569072 154
62 3300005345 Ga0070692_10268926 Ga0070692_102689262 154
63 3300005347 Ga0070668_101129149 Ga0070668_1011291491 154
64 3300005434 Ga0070709_10077580 Ga0070709_100775802 154
65 3300005436 Ga0070713_100077684 Ga0070713_1000776843 154
66 3300005455 Ga0070663_100220107 Ga0070663_1002201072 154
67 3300005458 Ga0070681_10365406 Ga0070681_103654062 154
68 3300005546 Ga0070696_100077834 Ga0070696_1000778342 154
69 3300005563 Ga0068855_100749073 Ga0068855_1007490732 154
70 3300005577 Ga0068857_101395475 Ga0068857_1013954752 154
71 3300006048 Ga0075363_100256195 Ga0075363_1002561951 154
72 3300006175 Ga0070712_100849139 Ga0070712_1008491392 154
73 3300006178 Ga0075367_10110607 Ga0075367_101106072 154
74 3300006186 Ga0075369_10347225 Ga0075369_103472252 154
75 3300006852 Ga0075433_10038485 Ga0075433_100384856 154
76 3300006871 Ga0075434_100013631 Ga0075434_1000136314 154
77 3300009093 Ga0105240_10013878 Ga0105240_100138782 154
78 3300009093 Ga0105240_10133885 Ga0105240_101338852 154
79 3300009093 Ga0105240_10462517 Ga0105240_104625172 154
80 3300009094 Ga0111539_10159814 Ga0111539_101598145 154
81 3300009147 Ga0114129_12384197 Ga0114129_123841971 154
82 3300013100 Ga0157373_10218156 Ga0157373_102181562 154
83 3300013104 Ga0157370_10030157 Ga0157370_100301573 154
84 3300013307 Ga0157372_10319014 Ga0157372_103190142 154
85 3300013308 Ga0157375_10014395 Ga0157375_100143952 154
86 3300025263 Ga0209565_1000001 Ga0209565_1000001376 154
87 3300025273 Ga0209673_1000001 Ga0209673_1000001376 154
88 3300025284 Ga0209130_1007074 Ga0209130_10070744 154
89 3300025291 Ga0209675_1000001 Ga0209675_10000012155 154
90 3300025292 Ga0209676_1006481 Ga0209676_10064815 154
91 3300025294 Ga0209025_1000006 Ga0209025_1000006701 154
92 3300025295 Ga0209564_1000001 Ga0209564_10000012317 154
93 3300025295 Ga0209564_1007240 Ga0209564_10072403 154
94 3300025295 Ga0209564_1008102 Ga0209564_10081024 154
95 3300025297 Ga0209758_1041509 Ga0209758_10415092 154
96 3300025298 Ga0209050_1002116 Ga0209050_100211615 154
97 3300025299 Ga0209256_1000006 Ga0209256_1000006753 154
98 3300025299 Ga0209256_1001986 Ga0209256_10019864 154
99 3300025303 Ga0209051_1022773 Ga0209051_10227732 154
100 3300025304 Ga0209257_1012708 Ga0209257_10127083 154
101 3300025304 Ga0209257_1017637 Ga0209257_10176372 154
102 3300025898 Ga0207692_10402134 Ga0207692_104021342 154
103 3300025906 Ga0207699_10072831 Ga0207699_100728312 154
104 3300025912 Ga0207707_10580517 Ga0207707_105805172 154
105 3300025912 Ga0207707_10820848 Ga0207707_108208481 154
106 3300025912 Ga0207707_11153762 Ga0207707_111537621 154
107 3300025913 Ga0207695_10000831 Ga0207695_100008312 154
108 3300025913 Ga0207695_10068230 Ga0207695_100682302 154
109 3300025915 Ga0207693_10029611 Ga0207693_100296115 154
110 3300025921 Ga0207652_10256561 Ga0207652_102565612 154
111 3300025925 Ga0207650_10781369 Ga0207650_107813692 154
112 3300025928 Ga0207700_10170274 Ga0207700_101702742 154
113 3300026067 Ga0207678_10450206 Ga0207678_104502062 154
114 3300026116 Ga0207674_11125356 Ga0207674_111253562 154
115 3300027907 Ga0207428_10047562 Ga0207428_100475625 154
116 3300031456 Ga0307513_10069400 Ga0307513_100694004 154
117 3300031901 Ga0307406_10054515 Ga0307406_100545153 154
118 3300035111 Ga0373923_0001286 Ga0373923_0001286_4044_4523 154
119 3300035113 Ga0373936_0024008 Ga0373936_0024008_571_1050 154
120 3300035116 Ga0373945_0010533 Ga0373945_0010533_1219_1698 154
121 3300035118 Ga0373954_0001827 Ga0373954_0001827_435_914 154
122 3300035119 Ga0373956_0214043 Ga0373956_0214043_134_610 154
123 3300035170 Ga0373943_0043578 Ga0373943_0043578_31_513 154
124 3300035171 Ga0373946_0007729 Ga0373946_0007729_2330_2809 154
125 3300035172 Ga0373955_0000323 Ga0373955_0000323_11614_12093 154
126 3300035172 Ga0373955_0096367 Ga0373955_0096367_728_1204 154
127 3300035172 Ga0373955_0346284 Ga0373955_0346284_245_721 154
128 3300035410 Ga0373924_0002816 Ga0373924_0002816_1148_1627 154
129 3300035410 Ga0373924_0188232 Ga0373924_0188232_399_875 154
130 3300035692 Ga0373935_0000126 Ga0373935_0000126_31996_32475 154
131 3300035695 Ga0373927_0013375 Ga0373927_0013375_2950_3429 154
132 3300035695 Ga0373927_0210230 Ga0373927_0210230_213_680 154
133 3300035695 Ga0373927_0527070 Ga0373927_0527070_30_512 154
134 3300035724 Ga0373933_0000787 Ga0373933_0000787_11751_12230 154
135 3300035724 Ga0373933_0074715 Ga0373933_0074715_465_941 154
136 3300035725 Ga0373947_0007287 Ga0373947_0007287_4730_5209 154
137 3300035725 Ga0373947_0529838 Ga0373947_0529838_231_713 154
138 3300036401 Ga0373937_0006059 Ga0373937_0006059_1183_1662 154
139 3300036401 Ga0373937_0134009 Ga0373937_0134009_728_1204 154
140 3300037068 Ga0373925_0000353 Ga0373925_0000353_11627_12106 154
141 3300037418 Ga0395900_0008745 Ga0395900_0008745_7195_7665 154
142 3300039450 Ga0436363_0224229 Ga0436363_0224229_1112_1585 154
143 3300041406 Ga0439439_0003429 Ga0439439_0003429_760_1224 154
144 3300041452 Ga0451793_1903217 Ga0451793_1903217_89_580 154
145 3300041486 Ga0451807_1813092 Ga0451807_1813092_292_783 154
146 3300041494 Ga0451837_1726734 Ga0451837_1726734_174_638 154
147 3300042004 Ga0439445_0006654 Ga0439445_0006654_987_1451 154
148 3300042007 Ga0439449_0004317 Ga0439449_0004317_4072_4536 154
149 3300042007 Ga0439449_0199096 Ga0439449_0199096_218_682 154
150 3300042136 Ga0450900_034823 Ga0450900_034823_241_714 154
151 3300046454 Ga0495592_0000284 Ga0495592_0000284_8937_9416 154
152 3300046459 Ga0495629_0127888 Ga0495629_0127888_79_558 154
153 3300046462 Ga0495651_0060221 Ga0495651_0060221_1558_2037 154
154 3300046463 Ga0495653_0000330 Ga0495653_0000330_1201_1680 154
155 3300046472 Ga0495580_0464715 Ga0495580_0464715_337_819 154
156 3300046473 Ga0495582_0124782 Ga0495582_0124782_251_730 154
157 3300046476 Ga0495662_0010166 Ga0495662_0010166_1259_1738 154
158 3300046477 Ga0495664_0000098 Ga0495664_0000098_4366_4845 154
159 3300046477 Ga0495664_0460885 Ga0495664_0460885_204_686 154
160 3300046491 Ga0495584_0195647 Ga0495584_0195647_375_848 154
161 3300046511 Ga0495608_0000318 Ga0495608_0000318_4293_4772 154
162 3300046514 Ga0495618_0000235 Ga0495618_0000235_35656_36135 154
163 3300046514 Ga0495618_0590513 Ga0495618_0590513_48_530 154
164 3300046516 Ga0495628_0001752 Ga0495628_0001752_1164_1643 154
165 3300046516 Ga0495628_1004971 Ga0495628_1004971_16_498 154
166 3300046517 Ga0495630_0002403 Ga0495630_0002403_11405_11884 154
167 3300046529 Ga0495652_0000305 Ga0495652_0000305_46321_46800 154
168 3300046533 Ga0495640_0000388 Ga0495640_0000388_19149_19628 154
169 3300046533 Ga0495640_0080380 Ga0495640_0080380_1590_2072 154
170 3300046536 Ga0495587_0000249 Ga0495587_0000249_34567_35046 154
171 3300046538 Ga0495609_0035341 Ga0495609_0035341_1497_1970 154
172 3300046543 Ga0495645_0000902 Ga0495645_0000902_10711_11190 154
173 3300046559 Ga0495667_0000195 Ga0495667_0000195_39336_39815 154
174 3300046642 Ga0495634_0002926 Ga0495634_0002926_9252_9731 154
175 3300046642 Ga0495634_0103015 Ga0495634_0103015_870_1352 154
176 3300046663 Ga0495635_0000185 Ga0495635_0000185_34462_34941 154
177 3300046675 Ga0495657_0001331 Ga0495657_0001331_4213_4692 154
178 3300046678 Ga0495599_0000168 Ga0495599_0000168_4230_4709 154
179 3300046679 Ga0495623_0000908 Ga0495623_0000908_9294_9773 154
180 3300046680 Ga0495646_0000490 Ga0495646_0000490_9072_9551 154
181 3300046689 Ga0495613_0129442 Ga0495613_0129442_1205_1684 154
182 3300046690 Ga0495624_0021955 Ga0495624_0021955_2553_3032 154
183 3300046809 Ga0495600_0000210 Ga0495600_0000210_1208_1687 154
184 3300047315 Ga0495581_0037371 Ga0495581_0037371_1168_1647 154
185 3300047317 Ga0495604_0000003 Ga0495604_0000003_429445_429924 154
186 3300047319 Ga0495674_0000006 Ga0495674_0000006_37812_38291 154
187 3300047322 Ga0495680_0001799 Ga0495680_0001799_17954_18433 154
188 3300047444 Ga0495675_0000336 Ga0495675_0000336_28275_28754 154
189 3300047471 Ga0495684_0000287 Ga0495684_0000287_1187_1666 154
190 3300047472 Ga0495686_0450393 Ga0495686_0450393_73_543 154
191 3300047673 Ga0495593_0003871 Ga0495593_0003871_8119_8598 154
192 3300048088 Ga0495602_0000805 Ga0495602_0000805_20444_20923 154
193 3300048905 Ga0496102_0048466 Ga0496102_0048466_2254_2730 154
194 3300048907 Ga0496104_0102119 Ga0496104_0102119_1547_2023 154
195 3300048913 Ga0496110_0601706 Ga0496110_0601706_413_889 154
196 3300048917 Ga0496114_0005851 Ga0496114_0005851_2282_2746 154
197 3300048918 Ga0496115_0151385 Ga0496115_0151385_552_1019 154
198 3300048927 Ga0496124_0000034 Ga0496124_0000034_67660_68124 154
199 3300048929 Ga0496126_0047708 Ga0496126_0047708_2311_2775 154
200 3300049570 Ga0501033_0189578 Ga0501033_0189578_884_1354 154
201 3300049571 Ga0501034_0278592 Ga0501034_0278592_84_548 154
202 3300049573 Ga0501037_0032125 Ga0501037_0032125_1193_1663 154
203 3300049574 Ga0501038_0232357 Ga0501038_0232357_451_921 154
204 3300049578 Ga0501042_0166823 Ga0501042_0166823_475_945 154
205 3300049581 Ga0501047_0002537 Ga0501047_0002537_10056_10526 154
206 3300049581 Ga0501047_0152042 Ga0501047_0152042_1489_1953 154
207 3300049584 Ga0501068_0112615 Ga0501068_0112615_709_1179 154
208 3300049585 Ga0501069_0107173 Ga0501069_0107173_438_908 154
209 3300049586 Ga0501070_0009411 Ga0501070_0009411_6983_7453 154
210 3300049587 Ga0501071_0005970 Ga0501071_0005970_3276_3746 154
211 3300049588 Ga0501072_0271671 Ga0501072_0271671_317_787 154
212 3300049589 Ga0501073_0020769 Ga0501073_0020769_2472_2942 154
213 3300049589 Ga0501073_0813453 Ga0501073_0813453_35_508 154
214 3300049590 Ga0501074_0002091 Ga0501074_0002091_2892_3362 154
215 3300049742 Ga0501080_0004757 Ga0501080_0004757_9167_9637 154
216 3300049742 Ga0501080_1583842 Ga0501080_1583842_49_519 154
217 3300049744 Ga0501083_0166026 Ga0501083_0166026_839_1309 154
218 3300049822 Ga0501035_0014951 Ga0501035_0014951_3093_3563 154
219 3300049823 Ga0501044_0007417 Ga0501044_0007417_10586_11056 154
220 3300050490 nmdc:mga03n38_495496_c1 nmdc:mga03n38_495496_c1_57_530 154
221 3300050492 nmdc:mga0yw44_9507_c2 nmdc:mga0yw44_9507_c2_30_506 154
222 3300050493 nmdc:mga0k408_120993_c1 nmdc:mga0k408_120993_c1_760_1230 154
223 3300050494 nmdc:mga06z11_336421_c1 nmdc:mga06z11_336421_c1_211_687 154
224 3300050495 nmdc:mga04h51_7856_c2 nmdc:mga04h51_7856_c2_54_530 154
225 3300050507 nmdc:mga05p37_1622379_c1 nmdc:mga05p37_1622379_c1_45_518 154
226 3300050512 nmdc:mga0n895_2770_c1 nmdc:mga0n895_2770_c1_2882_3355 154
227 3300050514 nmdc:mga08x19_915060_c1 nmdc:mga08x19_915060_c1_58_531 154
228 3300050515 nmdc:mga0a205_30683_c1 nmdc:mga0a205_30683_c1_484_957 154
229 3300053077 Ga0495601_0000004 Ga0495601_0000004_18925_19404 154
230 3300053077 Ga0495601_0008916 Ga0495601_0008916_492_974 154
231 3300053077 Ga0495601_0261279 Ga0495601_0261279_194_670 154
232 3300053078 Ga0495612_0000008 Ga0495612_0000008_193858_194337 154
233 3300053084 Ga0495595_0000720 Ga0495595_0000720_7945_8424 154
234 3300053085 Ga0495619_0003271 Ga0495619_0003271_8789_9268 154
235 3300053096 Ga0500641_0011359 Ga0500641_0011359_2283_2753 154
236 3300053119 Ga0500595_016561 Ga0500595_016561_1913_2383 154
237 3300053130 Ga0500642_0102055 Ga0500642_0102055_611_1081 154
238 3300060353 Ga0501082_0115450 Ga0501082_0115450_724_1194 154

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10027

DUF2269

Predicted integral membrane protein (DUF2269)

13

162

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jbk-assembly1.cif.gz_M cryo-em reconstruction of the metavinculin-actin interface 0.6694 19 148
3zdl-assembly1.cif.gz_A vinculin head (1-258) in complex with a riam fragment 0.666 10 154
8pkp-assembly1.cif.gz_I cryo-em structure of the apo anaphase-promoting complex/cyclosome (apc/c) at 3.2 angstrom resolution 0.6474 37 124
3jbk-assembly1.cif.gz_M cryo-em reconstruction of the metavinculin-actin interface 0.6204 19 148
7cub-assembly1.cif.gz_C 2.55-angstrom cryo-em structure of cytochrome bo3 from escherichia coli in native membrane 0.618 10 151
ID Description Score Start End Superfamily
af_K7KY41_460_574_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.841 88 145 1.20.58.390
af_Q5ZCC9_1_210_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.771 3 150 1.20.1270.60
af_A0A3B1E9Z2_1_144_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.7563 78 152 1.20.140.150
af_Q5ZCC9_1_210_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.7404 3 150 1.20.1270.60
af_A2AP89_11_249_1.20.120.810 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Vinculin, Vh2 four-helix bundle 0.6797 13 150 1.20.120.810
ID Description Score Start End GO Terms
AF-A0A0U3F183-F1-model_v4 DUF2269 domain-containing protein 0.9365 1 153 GO:0016020
AF-A0A2G1ZQR7-F1-model_v4 DUF2269 domain-containing protein 0.9361 1 154 GO:0016020
AF-A0A4Q5PVK4-F1-model_v4 DUF2269 domain-containing protein 0.9349 1 153 GO:0016020
AF-A0A5R9PHJ6-F1-model_v4 DUF2269 domain-containing protein 0.9312 1 154 GO:0016020
AF-A0A378J8G7-F1-model_v4 Integral membrane protein 0.9306 1 154 GO:0016020

Feature Viewer

pLDDT pTM Quality
96.01 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map