F351175

General Info

Members Datasets Scaffolds Average Seq Length
238 129 476 338

Family's Representative Sequence

Representative Sequence 3300039453|Ga0436362_0083266|Ga0436362_0083266_3790_4899
Length 369
Sequence MHQSSVPLDITRRPPRTATARVLLLGIKALAMALFALVISAQLSAQTETNPKHFFWAPGQPNTPNPSSLENDLIYHGGNAGSGAIGVETRPAVYLIFWGAQWTSGFTTIDGNGRLFASSTLENYVKSFLTNLGGTSWAAIQTEYCKNVPAGTTSCAAVGGGTYIGNPSYQLKGVWTDPTPVPSDIVALGLAENLANDPIAMEAMRASAHFRYDPLATYIVLTPPTTIATGEPVYCGYHTQTTSIDGLGNPYRLQYAFIPFLNASWPVIGQGGCGMNSVNKVSDSFGHGVFDGYSIVVGHEYSEAATDPDNFASVQDGWNDAQANENGDKCAWTNLANVPMNRKTNFAVQPLWSNKAFDATGQGCVLHAH

Samples

Sample ID Description Type Environment
1 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
72 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
73 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
74 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
75 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
76 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
77 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
78 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
82 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
83 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
84 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
85 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
86 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
87 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
88 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
89 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
90 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
91 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
92 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
93 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
94 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
95 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
96 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
97 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
98 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
99 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
100 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
101 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
102 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
103 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
104 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
105 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
106 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
107 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
108 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
109 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
110 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
111 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
112 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
113 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
114 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
115 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
116 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
117 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
118 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
119 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
120 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
121 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
123 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
124 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
125 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
126 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
127 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
128 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
129 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.48
Metatranscriptomes 2.52
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 18.07
Rhizosphere 81.51
Stem 0
Stem Tuber 0
Unclassified 15.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436362_0083266 3300039453 Bacteria 6349
2 Ga0070658_10012722 3300005327 Bacteria 6749
3 Ga0070683_100123174 3300005329 Unclassified 2450
4 Ga0070680_100005156 3300005336 Bacteria 9880
5 Ga0070680_100020526 3300005336 Bacteria 5244
6 Ga0070682_100016652 3300005337 Bacteria 4278
7 Ga0070660_100094482 3300005339 Unclassified 2362
8 Ga0070660_100205042 3300005339 Bacteria 1600
9 Ga0070661_100052873 3300005344 Bacteria 2972
10 Ga0070671_100073055 3300005355 Unclassified 2865
11 Ga0070709_10010956 3300005434 Bacteria 5036
12 Ga0070709_10077236 3300005434 Bacteria 2164
13 Ga0070709_10131251 3300005434 Unclassified 1711
14 Ga0070714_100020304 3300005435 Bacteria 5423
15 Ga0070714_100027246 3300005435 Bacteria 4730
16 Ga0070713_100011126 3300005436 Bacteria 6537
17 Ga0070713_100035943 3300005436 Bacteria 3993
18 Ga0070713_100101249 3300005436 Unclassified 2496
19 Ga0070710_10059724 3300005437 Bacteria 2167
20 Ga0070710_10133342 3300005437 Bacteria 1516
21 Ga0070711_100193849 3300005439 Unclassified 1563
22 Ga0070711_100262834 3300005439 Unclassified 1358
23 Ga0070708_100060982 3300005445 Bacteria 3368
24 Ga0070708_100207656 3300005445 Bacteria 1835
25 Ga0070663_100010972 3300005455 Bacteria 5667
26 Ga0070681_10010340 3300005458 Bacteria 9211
27 Ga0070681_10077281 3300005458 Bacteria 3287
28 Ga0070706_100340695 3300005467 Bacteria 1398
29 Ga0070707_100090492 3300005468 Bacteria 2961
30 Ga0070707_100339727 3300005468 Unclassified 1459
31 Ga0070698_100055127 3300005471 Bacteria 4033
32 Ga0070679_100023701 3300005530 Bacteria 6013
33 Ga0070684_100007891 3300005535 Bacteria 8303
34 Ga0070684_100222713 3300005535 Unclassified 1721
35 Ga0070697_100146101 3300005536 Bacteria 1990
36 Ga0070686_100014177 3300005544 Bacteria 4588
37 Ga0070695_100104082 3300005545 Bacteria 1916
38 Ga0070696_100054280 3300005546 Bacteria 2792
39 Ga0070696_100129992 3300005546 Bacteria 1831
40 Ga0070696_100236935 3300005546 Bacteria 1375
41 Ga0070665_100371360 3300005548 Unclassified 1437
42 Ga0068855_100041337 3300005563 Bacteria 5465
43 Ga0070717_10021061 3300006028 Bacteria 5136
44 Ga0070717_10172391 3300006028 Bacteria 1882
45 Ga0070715_10000992 3300006163 Bacteria 7942
46 Ga0070715_10055198 3300006163 Bacteria 1723
47 Ga0070716_100018234 3300006173 Bacteria 3652
48 Ga0070716_100025191 3300006173 Bacteria 3172
49 Ga0070716_100135430 3300006173 Unclassified 1563
50 Ga0070712_100009938 3300006175 Bacteria 5998
51 Ga0070712_100036434 3300006175 Bacteria 3348
52 Ga0070712_100048006 3300006175 Bacteria 2957
53 Ga0070712_100217208 3300006175 Bacteria 1511
54 Ga0097621_100044364 3300006237 Bacteria 3587
55 Ga0068871_100065225 3300006358 Bacteria 2982
56 Ga0075436_100169787 3300006914 Bacteria 1540
57 Ga0105240_10367080 3300009093 Bacteria 1629
58 Ga0105245_10123941 3300009098 Bacteria 2416
59 Ga0105245_10225642 3300009098 Bacteria 1810
60 Ga0105241_10234330 3300009174 Bacteria 1549
61 Ga0105238_10126982 3300009551 Bacteria 2529
62 Ga0105239_10257738 3300010375 Unclassified 1960
63 Ga0157373_10223431 3300013100 Bacteria 1329
64 Ga0157370_10012683 3300013104 Bacteria 8724
65 Ga0157370_10142491 3300013104 Bacteria 2233
66 Ga0157369_10007190 3300013105 Bacteria 12829
67 Ga0157369_10021428 3300013105 Bacteria 7230
68 Ga0157369_10024025 3300013105 Bacteria 6782
69 Ga0157369_10118080 3300013105 Bacteria 2815
70 Ga0157378_10161182 3300013297 Bacteria 2097
71 Ga0157372_10020720 3300013307 Bacteria 7097
72 Ga0157372_10467538 3300013307 Bacteria 1470
73 Ga0157375_10023825 3300013308 Bacteria 5656
74 Ga0157376_10021099 3300014969 Bacteria 5055
75 Ga0197907_10149958 3300020069 Bacteria 3816
76 Ga0206356_10891654 3300020070 Bacteria 4711
77 Ga0206354_11465106 3300020081 Bacteria 4657
78 Ga0206353_10790505 3300020082 Bacteria 8402
79 Ga0224712_10006950 3300022467 Unclassified 3265
80 Ga0224712_10126445 3300022467 Bacteria 1112
81 Ga0207692_10024677 3300025898 Bacteria 2798
82 Ga0207699_10215453 3300025906 Bacteria 1308
83 Ga0207684_10445362 3300025910 Unclassified 1112
84 Ga0207695_10100099 3300025913 Bacteria 2895
85 Ga0207693_10001026 3300025915 Bacteria 25010
86 Ga0207693_10002631 3300025915 Bacteria 15592
87 Ga0207693_10007250 3300025915 Bacteria 9125
88 Ga0207693_10010770 3300025915 Bacteria 7424
89 Ga0207693_10017576 3300025915 Bacteria 5702
90 Ga0207693_10030407 3300025915 Bacteria 4265
91 Ga0207663_10131619 3300025916 Bacteria 1729
92 Ga0207657_10000271 3300025919 Bacteria 55055
93 Ga0207657_10089157 3300025919 Bacteria 2577
94 Ga0207649_10016465 3300025920 Bacteria 4170
95 Ga0207652_10035526 3300025921 Bacteria 4207
96 Ga0207652_10240727 3300025921 Bacteria 1631
97 Ga0207646_10143286 3300025922 Bacteria 2153
98 Ga0207700_10213903 3300025928 Bacteria 1631
99 Ga0207664_10115791 3300025929 Unclassified 2235
100 Ga0207664_10306076 3300025929 Bacteria 1399
101 Ga0207644_10140277 3300025931 Bacteria 1861
102 Ga0207644_10171022 3300025931 Unclassified 1696
103 Ga0207704_10104114 3300025938 Bacteria 1900
104 Ga0207665_10000927 3300025939 Bacteria 19822
105 Ga0207661_10055495 3300025944 Unclassified 3178
106 Ga0207678_10028375 3300026067 Bacteria 4886
107 Ga0207702_10001791 3300026078 Bacteria 21150
108 Ga0207683_10004424 3300026121 Bacteria 12146
109 Ga0265338_10004746 3300028800 Bacteria 18180
110 Ga0265338_10016740 3300028800 Bacteria 7944
111 Ga0265325_10054994 3300031241 Bacteria 2036
112 Ga0265339_10010444 3300031249 Bacteria 5768
113 Ga0373949_0006069 3300035090 Bacteria 2673
114 Ga0373941_0018242 3300035115 Bacteria 1936
115 Ga0373962_0037393 3300035242 Bacteria 1355
116 Ga0373931_0013547 3300035691 Bacteria 3972
117 Ga0395899_0054974 3300037312 Bacteria 2945
118 Ga0395900_0088033 3300037418 Bacteria 3192
119 Ga0395900_0213638 3300037418 Bacteria 1947
120 Ga0395900_0253248 3300037418 Bacteria 1761
121 Ga0395898_0075492 3300037466 Bacteria 3256
122 Ga0395898_0083640 3300037466 Bacteria 3076
123 Ga0395901_0142903 3300038443 Bacteria 2515
124 Ga0436360_0338887 3300039438 Bacteria 5089
125 Ga0436363_1678646 3300039450 Unclassified 1959
126 Ga0436362_1007912 3300039453 Bacteria 1608
127 Ga0466969_0034186 3300044656 Bacteria 2577
128 Ga0466966_0008819 3300044684 Bacteria 6676
129 Ga0466966_0054563 3300044684 Bacteria 2532
130 Ga0466966_0091287 3300044684 Bacteria 1891
131 Ga0466961_0006912 3300044693 Bacteria 7218
132 Ga0466961_0061863 3300044693 Unclassified 2379
133 Ga0466961_0096757 3300044693 Unclassified 1861
134 Ga0466961_0128408 3300044693 Bacteria 1589
135 Ga0466961_0179677 3300044693 Bacteria 1314
136 Ga0466961_0186702 3300044693 Unclassified 1286
137 Ga0466961_0233855 3300044693 Unclassified 1131
138 Ga0466963_0000718 3300044694 Bacteria 16196
139 Ga0466963_0001231 3300044694 Bacteria 13515
140 Ga0466963_0001723 3300044694 Bacteria 11905
141 Ga0466963_0001999 3300044694 Bacteria 11199
142 Ga0466963_0096632 3300044694 Bacteria 2018
143 Ga0466963_0143313 3300044694 Bacteria 1656
144 Ga0466964_0001088 3300044706 Bacteria 9101
145 Ga0466964_0065706 3300044706 Bacteria 1520
146 Ga0466964_0076899 3300044706 Unclassified 1424
147 Ga0466971_0000490 3300044719 Bacteria 15532
148 Ga0466968_0011481 3300044735 Bacteria 3451
149 Ga0466957_0008636 3300044842 Bacteria 5799
150 Ga0466957_0027870 3300044842 Bacteria 3359
151 Ga0466959_0004547 3300045049 Bacteria 9305
152 Ga0466959_0008485 3300045049 Bacteria 7270
153 Ga0466959_0036178 3300045049 Bacteria 3648
154 Ga0466959_0121061 3300045049 Unclassified 1860
155 Ga0451576_0456262 3300045051 Bacteria 1342
156 Ga0466958_0000168 3300045836 Bacteria 23429
157 Ga0466958_0009038 3300045836 Bacteria 5534
158 Ga0466958_0021298 3300045836 Bacteria 3787
159 Ga0466958_0084214 3300045836 Bacteria 1961
160 Ga0466958_0225247 3300045836 Bacteria 1197
161 Ga0466967_0000893 3300045976 Bacteria 15945
162 Ga0466967_0007762 3300045976 Bacteria 7784
163 Ga0466967_0048771 3300045976 Bacteria 3700
164 Ga0466967_0079931 3300045976 Bacteria 2949
165 Ga0466967_0102004 3300045976 Bacteria 2624
166 Ga0466967_0110274 3300045976 Bacteria 2527
167 Ga0466967_0153714 3300045976 Bacteria 2153
168 Ga0466967_0195691 3300045976 Bacteria 1912
169 Ga0466967_0206175 3300045976 Bacteria 1863
170 Ga0466967_0208511 3300045976 Bacteria 1853
171 Ga0466967_0343885 3300045976 Unclassified 1443
172 Ga0466967_0434812 3300045976 Bacteria 1280
173 Ga0466967_0509031 3300045976 Bacteria 1182
174 Ga0495592_0189282 3300046454 Unclassified 1396
175 Ga0495603_0010126 3300046455 Bacteria 5705
176 Ga0495641_0081861 3300046461 Bacteria 1446
177 Ga0495653_0154235 3300046463 Unclassified 1602
178 Ga0495653_0195513 3300046463 Bacteria 1377
179 Ga0495582_0043976 3300046473 Bacteria 2459
180 Ga0495618_0057242 3300046514 Unclassified 2468
181 Ga0495634_0038453 3300046642 Bacteria 3263
182 Ga0495634_0126491 3300046642 Bacteria 1633
183 Ga0495674_0087939 3300047319 Unclassified 2658
184 Ga0495676_0214272 3300047321 Unclassified 1331
185 Ga0496100_0016527 3300048903 Bacteria 4335
186 Ga0496100_0099785 3300048903 Bacteria 1998
187 Ga0496101_0016389 3300048904 Bacteria 5006
188 Ga0496102_0002429 3300048905 Bacteria 15881
189 Ga0496102_0432036 3300048905 Unclassified 1236
190 Ga0496103_0011554 3300048906 Bacteria 5235
191 Ga0496103_0026939 3300048906 Bacteria 3480
192 Ga0496103_0033168 3300048906 Bacteria 3154
193 Ga0496103_0251596 3300048906 Bacteria 1137
194 Ga0496104_0006709 3300048907 Bacteria 10132
195 Ga0496104_0008563 3300048907 Bacteria 9096
196 Ga0496104_0063992 3300048907 Bacteria 3489
197 Ga0496105_0004515 3300048908 Bacteria 10478
198 Ga0496105_0149442 3300048908 Bacteria 1920
199 Ga0496106_0079581 3300048909 Bacteria 2516
200 Ga0496106_0127952 3300048909 Bacteria 1990
201 Ga0496106_0222721 3300048909 Bacteria 1505
202 Ga0496107_0004675 3300048910 Bacteria 9291
203 Ga0496108_0010686 3300048911 Bacteria 7449
204 Ga0496108_0083625 3300048911 Bacteria 2707
205 Ga0496108_0236638 3300048911 Unclassified 1588
206 Ga0496109_0029386 3300048912 Bacteria 4922
207 Ga0496109_0125454 3300048912 Bacteria 2393
208 Ga0496110_0019317 3300048913 Bacteria 5732
209 Ga0496110_0021187 3300048913 Bacteria 5497
210 Ga0496110_0040108 3300048913 Bacteria 4080
211 Ga0496110_0099328 3300048913 Bacteria 2609
212 Ga0496111_0003225 3300048914 Bacteria 10070
213 Ga0496111_0005326 3300048914 Bacteria 8220
214 Ga0496111_0072078 3300048914 Bacteria 2514
215 Ga0496111_0095372 3300048914 Unclassified 2183
216 Ga0496111_0095911 3300048914 Unclassified 2176
217 Ga0496112_0000024 3300048915 Bacteria 154372
218 Ga0496112_0007181 3300048915 Bacteria 9865
219 Ga0496112_0168102 3300048915 Bacteria 2159
220 Ga0496113_0045065 3300048916 Bacteria 3270
221 Ga0496114_0006382 3300048917 Bacteria 9283
222 Ga0496114_0017444 3300048917 Bacteria 5794
223 Ga0496114_0252673 3300048917 Bacteria 1551
224 Ga0496115_0031874 3300048918 Bacteria 4155
225 Ga0496115_0077340 3300048918 Bacteria 2706
226 Ga0496115_0113706 3300048918 Bacteria 2224
227 Ga0496115_0170026 3300048918 Bacteria 1802
228 Ga0501047_0095022 3300049581 Bacteria 2860
229 Ga0501067_0006701 3300049583 Bacteria 6392
230 Ga0501067_0084746 3300049583 Bacteria 1758
231 Ga0501068_0059999 3300049584 Bacteria 2309
232 Ga0501069_0073380 3300049585 Unclassified 1919
233 Ga0501069_0123221 3300049585 Bacteria 1481
234 Ga0501044_0369595 3300049823 Unclassified 1351
235 nmdc:mga0rr50_76946_c1 3300050513 Bacteria 2562
236 Ga0495601_0206050 3300053077 Unclassified 1285
237 Ga0495655_0005140 3300053083 Bacteria 2293
238 Ga0466962_0002228 3300061719 Bacteria 9161
239 Ga0436362_0083266
240 Ga0070658_10012722
241 Ga0070683_100123174
242 Ga0070680_100005156
243 Ga0070680_100020526
244 Ga0070682_100016652
245 Ga0070660_100094482
246 Ga0070660_100205042
247 Ga0070661_100052873
248 Ga0070671_100073055
249 Ga0070709_10010956
250 Ga0070709_10077236
251 Ga0070709_10131251
252 Ga0070714_100020304
253 Ga0070714_100027246
254 Ga0070713_100011126
255 Ga0070713_100035943
256 Ga0070713_100101249
257 Ga0070710_10059724
258 Ga0070710_10133342
259 Ga0070711_100193849
260 Ga0070711_100262834
261 Ga0070708_100060982
262 Ga0070708_100207656
263 Ga0070663_100010972
264 Ga0070681_10010340
265 Ga0070681_10077281
266 Ga0070706_100340695
267 Ga0070707_100090492
268 Ga0070707_100339727
269 Ga0070698_100055127
270 Ga0070679_100023701
271 Ga0070684_100007891
272 Ga0070684_100222713
273 Ga0070697_100146101
274 Ga0070686_100014177
275 Ga0070695_100104082
276 Ga0070696_100054280
277 Ga0070696_100129992
278 Ga0070696_100236935
279 Ga0070665_100371360
280 Ga0068855_100041337
281 Ga0070717_10021061
282 Ga0070717_10172391
283 Ga0070715_10000992
284 Ga0070715_10055198
285 Ga0070716_100018234
286 Ga0070716_100025191
287 Ga0070716_100135430
288 Ga0070712_100009938
289 Ga0070712_100036434
290 Ga0070712_100048006
291 Ga0070712_100217208
292 Ga0097621_100044364
293 Ga0068871_100065225
294 Ga0075436_100169787
295 Ga0105240_10367080
296 Ga0105245_10123941
297 Ga0105245_10225642
298 Ga0105241_10234330
299 Ga0105238_10126982
300 Ga0105239_10257738
301 Ga0157373_10223431
302 Ga0157370_10012683
303 Ga0157370_10142491
304 Ga0157369_10007190
305 Ga0157369_10021428
306 Ga0157369_10024025
307 Ga0157369_10118080
308 Ga0157378_10161182
309 Ga0157372_10020720
310 Ga0157372_10467538
311 Ga0157375_10023825
312 Ga0157376_10021099
313 Ga0197907_10149958
314 Ga0206356_10891654
315 Ga0206354_11465106
316 Ga0206353_10790505
317 Ga0224712_10006950
318 Ga0224712_10126445
319 Ga0207692_10024677
320 Ga0207699_10215453
321 Ga0207684_10445362
322 Ga0207695_10100099
323 Ga0207693_10001026
324 Ga0207693_10002631
325 Ga0207693_10007250
326 Ga0207693_10010770
327 Ga0207693_10017576
328 Ga0207693_10030407
329 Ga0207663_10131619
330 Ga0207657_10000271
331 Ga0207657_10089157
332 Ga0207649_10016465
333 Ga0207652_10035526
334 Ga0207652_10240727
335 Ga0207646_10143286
336 Ga0207700_10213903
337 Ga0207664_10115791
338 Ga0207664_10306076
339 Ga0207644_10140277
340 Ga0207644_10171022
341 Ga0207704_10104114
342 Ga0207665_10000927
343 Ga0207661_10055495
344 Ga0207678_10028375
345 Ga0207702_10001791
346 Ga0207683_10004424
347 Ga0265338_10004746
348 Ga0265338_10016740
349 Ga0265325_10054994
350 Ga0265339_10010444
351 Ga0373949_0006069
352 Ga0373941_0018242
353 Ga0373962_0037393
354 Ga0373931_0013547
355 Ga0395899_0054974
356 Ga0395900_0088033
357 Ga0395900_0213638
358 Ga0395900_0253248
359 Ga0395898_0075492
360 Ga0395898_0083640
361 Ga0395901_0142903
362 Ga0436360_0338887
363 Ga0436363_1678646
364 Ga0436362_1007912
365 Ga0466969_0034186
366 Ga0466966_0008819
367 Ga0466966_0054563
368 Ga0466966_0091287
369 Ga0466961_0006912
370 Ga0466961_0061863
371 Ga0466961_0096757
372 Ga0466961_0128408
373 Ga0466961_0179677
374 Ga0466961_0186702
375 Ga0466961_0233855
376 Ga0466963_0000718
377 Ga0466963_0001231
378 Ga0466963_0001723
379 Ga0466963_0001999
380 Ga0466963_0096632
381 Ga0466963_0143313
382 Ga0466964_0001088
383 Ga0466964_0065706
384 Ga0466964_0076899
385 Ga0466971_0000490
386 Ga0466968_0011481
387 Ga0466957_0008636
388 Ga0466957_0027870
389 Ga0466959_0004547
390 Ga0466959_0008485
391 Ga0466959_0036178
392 Ga0466959_0121061
393 Ga0451576_0456262
394 Ga0466958_0000168
395 Ga0466958_0009038
396 Ga0466958_0021298
397 Ga0466958_0084214
398 Ga0466958_0225247
399 Ga0466967_0000893
400 Ga0466967_0007762
401 Ga0466967_0048771
402 Ga0466967_0079931
403 Ga0466967_0102004
404 Ga0466967_0110274
405 Ga0466967_0153714
406 Ga0466967_0195691
407 Ga0466967_0206175
408 Ga0466967_0208511
409 Ga0466967_0343885
410 Ga0466967_0434812
411 Ga0466967_0509031
412 Ga0495592_0189282
413 Ga0495603_0010126
414 Ga0495641_0081861
415 Ga0495653_0154235
416 Ga0495653_0195513
417 Ga0495582_0043976
418 Ga0495618_0057242
419 Ga0495634_0038453
420 Ga0495634_0126491
421 Ga0495674_0087939
422 Ga0495676_0214272
423 Ga0496100_0016527
424 Ga0496100_0099785
425 Ga0496101_0016389
426 Ga0496102_0002429
427 Ga0496102_0432036
428 Ga0496103_0011554
429 Ga0496103_0026939
430 Ga0496103_0033168
431 Ga0496103_0251596
432 Ga0496104_0006709
433 Ga0496104_0008563
434 Ga0496104_0063992
435 Ga0496105_0004515
436 Ga0496105_0149442
437 Ga0496106_0079581
438 Ga0496106_0127952
439 Ga0496106_0222721
440 Ga0496107_0004675
441 Ga0496108_0010686
442 Ga0496108_0083625
443 Ga0496108_0236638
444 Ga0496109_0029386
445 Ga0496109_0125454
446 Ga0496110_0019317
447 Ga0496110_0021187
448 Ga0496110_0040108
449 Ga0496110_0099328
450 Ga0496111_0003225
451 Ga0496111_0005326
452 Ga0496111_0072078
453 Ga0496111_0095372
454 Ga0496111_0095911
455 Ga0496112_0000024
456 Ga0496112_0007181
457 Ga0496112_0168102
458 Ga0496113_0045065
459 Ga0496114_0006382
460 Ga0496114_0017444
461 Ga0496114_0252673
462 Ga0496115_0031874
463 Ga0496115_0077340
464 Ga0496115_0113706
465 Ga0496115_0170026
466 Ga0501047_0095022
467 Ga0501067_0006701
468 Ga0501067_0084746
469 Ga0501068_0059999
470 Ga0501069_0073380
471 Ga0501069_0123221
472 Ga0501044_0369595
473 nmdc:mga0rr50_76946_c1
474 Ga0495601_0206050
475 Ga0495655_0005140
476 Ga0466962_0002228

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4on1-assembly1.cif.gz_A crystal structure of metalloproteinase-ii from bacteroides fragilis 0.5208 68 238
2v4b-assembly2.cif.gz_B crystal structure of human adamts-1 catalytic domain and cysteine- rich domain (apo-form) 0.5141 72 238
7uyx-assembly1.cif.gz_A structure of bacteriophage pa1c gp2 0.507 84 109
7ki3-assembly1.cif.gz_A human argonaute2:mir-122 bound to the hcv genotype 1a site-1 rna 0.4943 67 205
7uyx-assembly2.cif.gz_D structure of bacteriophage pa1c gp2 0.4906 86 109
ID Description Score Start End Superfamily
af_Q9R157_168_376_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.558 72 239 3.40.390.10
af_A0A1D6HKS2_51_306_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.5484 68 300 3.40.390.10
af_Q811Q3_195_394_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.5202 72 243 3.40.390.10
af_A8WHP4_67_255_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.4971 178 210 3.20.20.100
af_Q67W03_44_314_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.4951 58 335 3.40.390.10
ID Description Score Start End GO Terms
AF-A0A2V9WFJ7-F1-model_v4 Uncharacterized protein 0.8832 49 346
AF-A0A538HGY5-F1-model_v4 Uncharacterized protein 0.8799 92 347
AF-A0A538HGY5-F1-model_v4 Uncharacterized protein 0.8766 92 347
AF-A0A535JXG3-F1-model_v4 Uncharacterized protein 0.8312 53 347
AF-A0A535JXG3-F1-model_v4 Uncharacterized protein 0.825 53 347

Map