F351152

General Info

Members Datasets Scaffolds Average Seq Length
238 172 476 124

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_0562437|Ga0395898_0562437_95_520
Length 141
Sequence LRNGTIRSDTNDPKGVLVDWKLELVQVPVSDVDRAKAFYVDQVGFNADHDHQVNDDLRFVQLTPPGSACSIAIGTGLSAMAPGSVEGLQIVIDDADVAHAELKARGVEVSDVQDLPWGRFVFFSDPDGNRWSLQQIVRPAS

Samples

Sample ID Description Type Environment
1 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
61 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
62 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
105 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
108 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
112 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
113 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
115 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
116 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
117 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
118 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
119 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
120 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
121 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
122 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
123 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
124 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
125 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
126 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
127 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
128 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
129 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
130 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
131 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
132 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
133 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
134 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
146 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
147 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
148 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
149 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
150 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
151 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
152 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
153 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
154 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
155 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
158 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
161 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
162 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
163 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
164 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
165 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
170 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
171 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
172 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.16
Metatranscriptomes 0
Isolates 0.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.68
Nodule 0
Rhizoplane 3.36
Rhizosphere 92.44
Stem 0
Stem Tuber 0
Unclassified 1.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395898_0562437 3300037466 Bacteria 1083
2 Ga0065707_10229100 3300005295 Unclassified 1195
3 Ga0070683_100076650 3300005329 Bacteria 3126
4 Ga0070670_100135012 3300005331 Bacteria 2132
5 Ga0068869_100010755 3300005334 Bacteria 5976
6 Ga0068868_100013566 3300005338 Bacteria 5980
7 Ga0070691_10716720 3300005341 Bacteria 602
8 Ga0070661_100022523 3300005344 Bacteria 4511
9 Ga0070668_100291639 3300005347 Bacteria 1366
10 Ga0070675_100006430 3300005354 Bacteria 9017
11 Ga0070659_100039242 3300005366 Bacteria 3696
12 Ga0070714_100001721 3300005435 Bacteria 15937
13 Ga0070714_100713403 3300005435 Bacteria 968
14 Ga0070713_100071422 3300005436 Bacteria 2933
15 Ga0070700_100006024 3300005441 Bacteria 6452
16 Ga0070663_100009388 3300005455 Bacteria 6055
17 Ga0070663_100083017 3300005455 Bacteria 2359
18 Ga0070678_100265040 3300005456 Bacteria 1447
19 Ga0070678_100591624 3300005456 Bacteria 989
20 Ga0070662_100268888 3300005457 Bacteria 1376
21 Ga0070707_100904947 3300005468 Bacteria 847
22 Ga0070679_100454820 3300005530 Bacteria 1225
23 Ga0070684_100003350 3300005535 Bacteria 12005
24 Ga0070684_100642262 3300005535 Bacteria 988
25 Ga0070684_100884637 3300005535 Bacteria 836
26 Ga0068853_100413481 3300005539 Bacteria 1264
27 Ga0070664_100017215 3300005564 Bacteria 5934
28 Ga0068857_100109699 3300005577 Bacteria 2480
29 Ga0068857_100400543 3300005577 Bacteria 1277
30 Ga0068857_100553661 3300005577 Bacteria 1084
31 Ga0068854_100623658 3300005578 Bacteria 923
32 Ga0068856_100370648 3300005614 Bacteria 1451
33 Ga0068852_100008876 3300005616 Bacteria 7436
34 Ga0068852_100064483 3300005616 Bacteria 3193
35 Ga0068859_102205243 3300005617 Bacteria 608
36 Ga0068864_101805310 3300005618 Bacteria 617
37 Ga0068861_100224660 3300005719 Bacteria 1589
38 Ga0068863_100268169 3300005841 Bacteria 1652
39 Ga0068862_100086186 3300005844 Bacteria 2730
40 Ga0081455_10061640 3300005937 Bacteria 3155
41 Ga0081539_10008241 3300005985 Bacteria 9157
42 Ga0081539_10012186 3300005985 Bacteria 6671
43 Ga0081539_10497064 3300005985 Bacteria 505
44 Ga0075364_10704534 3300006051 Bacteria 689
45 Ga0075428_100684344 3300006844 Bacteria 1093
46 Ga0075430_100117696 3300006846 Bacteria 2215
47 Ga0075431_100257291 3300006847 Bacteria 1772
48 Ga0075433_10111209 3300006852 Bacteria 2430
49 Ga0075433_10135333 3300006852 Bacteria 2190
50 Ga0075434_100121513 3300006871 Bacteria 2627
51 Ga0075429_100230588 3300006880 Bacteria 1622
52 Ga0075429_101586276 3300006880 Bacteria 569
53 Ga0068865_100073533 3300006881 Bacteria 2431
54 Ga0097620_102205690 3300006931 Bacteria 608
55 Ga0111539_10072700 3300009094 Bacteria 4055
56 Ga0111539_10125447 3300009094 Bacteria 3008
57 Ga0111539_10254034 3300009094 Bacteria 2047
58 Ga0105245_10047451 3300009098 Bacteria 3840
59 Ga0114129_10138433 3300009147 Bacteria 3339
60 Ga0114129_10376887 3300009147 Bacteria 1875
61 Ga0114129_10764842 3300009147 Bacteria 1235
62 Ga0105243_10991053 3300009148 Bacteria 842
63 Ga0105241_10201822 3300009174 Bacteria 1661
64 Ga0105241_12141082 3300009174 Bacteria 553
65 Ga0105237_10015000 3300009545 Bacteria 8076
66 Ga0105238_10238102 3300009551 Bacteria 1797
67 Ga0105238_10249981 3300009551 Bacteria 1751
68 Ga0105249_10061488 3300009553 Bacteria 3446
69 Ga0105249_11255548 3300009553 Bacteria 812
70 Ga0105239_10011306 3300010375 Bacteria 9959
71 Ga0105246_10700385 3300011119 Bacteria 888
72 Ga0157369_11591820 3300013105 Bacteria 664
73 Ga0157374_10827426 3300013296 Bacteria 942
74 Ga0157375_10233093 3300013308 Bacteria 2000
75 Ga0157375_11253745 3300013308 Bacteria 871
76 Ga0163163_12370303 3300014325 Bacteria 589
77 Ga0157380_11416428 3300014326 Bacteria 746
78 Ga0157377_10014153 3300014745 Bacteria 4054
79 Ga0163161_10104457 3300017792 Bacteria 2112
80 Ga0213873_10092982 3300021358 Bacteria 859
81 Ga0213875_10011719 3300021388 Bacteria 4352
82 Ga0207688_10732148 3300025901 Bacteria 626
83 Ga0207645_10019759 3300025907 Bacteria 4413
84 Ga0207654_10275700 3300025911 Bacteria 1136
85 Ga0207707_11163473 3300025912 Bacteria 626
86 Ga0207662_10307851 3300025918 Bacteria 1055
87 Ga0207657_10110793 3300025919 Bacteria 2267
88 Ga0207657_10642864 3300025919 Bacteria 826
89 Ga0207649_10271964 3300025920 Bacteria 1228
90 Ga0207649_10840092 3300025920 Bacteria 718
91 Ga0207652_10299653 3300025921 Bacteria 1451
92 Ga0207681_10151951 3300025923 Bacteria 1736
93 Ga0207650_10243237 3300025925 Bacteria 1455
94 Ga0207650_11147338 3300025925 Bacteria 661
95 Ga0207659_10004322 3300025926 Bacteria 8591
96 Ga0207687_10017283 3300025927 Bacteria 4747
97 Ga0207687_10022562 3300025927 Bacteria 4190
98 Ga0207700_10033555 3300025928 Bacteria 3674
99 Ga0207664_10004442 3300025929 Bacteria 9498
100 Ga0207644_10944158 3300025931 Bacteria 723
101 Ga0207690_10014269 3300025932 Bacteria 4797
102 Ga0207706_10113970 3300025933 Bacteria 2378
103 Ga0207704_10032795 3300025938 Bacteria 2945
104 Ga0207689_10005253 3300025942 Bacteria 11618
105 Ga0207689_10068556 3300025942 Bacteria 2915
106 Ga0207661_10210126 3300025944 Bacteria 1715
107 Ga0207661_10406479 3300025944 Bacteria 1235
108 Ga0207679_10370917 3300025945 Bacteria 1253
109 Ga0207667_10494416 3300025949 Bacteria 1241
110 Ga0207640_10678415 3300025981 Bacteria 881
111 Ga0207658_11532797 3300025986 Bacteria 610
112 Ga0207677_10027576 3300026023 Bacteria 3580
113 Ga0207639_10309184 3300026041 Bacteria 1400
114 Ga0207678_10023527 3300026067 Bacteria 5388
115 Ga0207678_10052102 3300026067 Bacteria 3532
116 Ga0207678_10541317 3300026067 Bacteria 1018
117 Ga0207708_10014203 3300026075 Bacteria 5955
118 Ga0207702_10743553 3300026078 Bacteria 968
119 Ga0207641_10177562 3300026088 Bacteria 1948
120 Ga0207674_10035046 3300026116 Bacteria 5239
121 Ga0207674_11965358 3300026116 Unclassified 550
122 Ga0207675_100389598 3300026118 Bacteria 1371
123 Ga0207683_10225136 3300026121 Bacteria 1710
124 Ga0207683_10362424 3300026121 Bacteria 1331
125 Ga0207698_10006133 3300026142 Bacteria 7482
126 Ga0207698_10081484 3300026142 Bacteria 2613
127 Ga0207428_10091297 3300027907 Bacteria 2364
128 Ga0268265_10076216 3300028380 Bacteria 2630
129 Ga0307413_10336689 3300031824 Bacteria 1159
130 Ga0307410_10060268 3300031852 Bacteria 2593
131 Ga0307410_11371901 3300031852 Bacteria 620
132 Ga0307406_10202169 3300031901 Bacteria 1463
133 Ga0307406_10355890 3300031901 Bacteria 1146
134 Ga0307406_12024624 3300031901 Bacteria 515
135 Ga0307407_10221805 3300031903 Bacteria 1279
136 Ga0307409_100032653 3300031995 Bacteria 3777
137 Ga0307409_100210258 3300031995 Bacteria 1748
138 Ga0307409_100347171 3300031995 Bacteria 1399
139 Ga0307409_100667340 3300031995 Bacteria 1035
140 Ga0307409_102944137 3300031995 Bacteria 503
141 Ga0307416_100042323 3300032002 Bacteria 3554
142 Ga0307416_103403983 3300032002 Bacteria 532
143 Ga0307415_100240470 3300032126 Bacteria 1464
144 Ga0395899_0033744 3300037312 Bacteria 3844
145 Ga0395899_0693029 3300037312 Bacteria 640
146 Ga0395899_0889610 3300037312 Bacteria 544
147 Ga0395900_0045355 3300037418 Bacteria 4528
148 Ga0395900_0275318 3300037418 Bacteria 1677
149 Ga0395900_0673175 3300037418 Bacteria 970
150 Ga0395898_0002025 3300037466 Bacteria 25413
151 Ga0395898_0126735 3300037466 Bacteria 2446
152 Ga0395898_0130756 3300037466 Bacteria 2405
153 Ga0395898_0198744 3300037466 Bacteria 1915
154 Ga0395898_1133554 3300037466 Bacteria 715
155 Ga0395898_1288744 3300037466 Bacteria 660
156 Ga0395905_0003246 3300037471 Bacteria 17494
157 Ga0395905_1084226 3300037471 Bacteria 704
158 Ga0395905_1193755 3300037471 Bacteria 664
159 Ga0436364_1207495 3300037853 Bacteria 11099
160 Ga0436364_1409920 3300037853 Bacteria 2281
161 Ga0395901_0004323 3300038443 Bacteria 14341
162 Ga0395901_0018053 3300038443 Bacteria 7201
163 Ga0395901_0252988 3300038443 Bacteria 1835
164 Ga0395901_0351831 3300038443 Bacteria 1520
165 Ga0395901_0367789 3300038443 Bacteria 1482
166 Ga0395901_0530044 3300038443 Bacteria 1196
167 Ga0395901_1214284 3300038443 Bacteria 719
168 Ga0395901_1753241 3300038443 Bacteria 571
169 Ga0436365_1252082 3300039437 Bacteria 1672
170 Ga0436362_0126253 3300039453 Bacteria 2999
171 Ga0436362_1206901 3300039453 Bacteria 1325
172 Ga0466963_0050724 3300044694 Bacteria 2747
173 Ga0466960_0368351 3300044901 Bacteria 823
174 Ga0466967_1587810 3300045976 Bacteria 652
175 Ga0495641_0157125 3300046461 Bacteria 1017
176 Ga0495580_0029306 3300046472 Bacteria 3996
177 Ga0495664_0739573 3300046477 Bacteria 580
178 Ga0495584_0613414 3300046491 Bacteria 555
179 Ga0495606_0119501 3300046507 Bacteria 1579
180 Ga0495642_0337617 3300046528 Bacteria 662
181 Ga0495665_0101121 3300046531 Bacteria 1513
182 Ga0495598_0147937 3300046537 Bacteria 818
183 Ga0495656_0129683 3300046615 Bacteria 1199
184 Ga0495588_0009330 3300046674 Bacteria 4532
185 Ga0495581_0158728 3300047315 Bacteria 1322
186 Ga0495676_0011512 3300047321 Bacteria 7979
187 Ga0496109_0004782 3300048912 Bacteria 11305
188 Ga0496110_0419666 3300048913 Bacteria 1220
189 Ga0496111_0110117 3300048914 Bacteria 2028
190 Ga0496111_0332139 3300048914 Bacteria 1126
191 Ga0496112_0063166 3300048915 Bacteria 3653
192 Ga0496112_0988452 3300048915 Bacteria 762
193 Ga0496113_0431136 3300048916 Bacteria 1059
194 Ga0496113_1188237 3300048916 Bacteria 596
195 Ga0496119_0098790 3300048922 Bacteria 1643
196 Ga0496120_0126728 3300048923 Bacteria 1313
197 Ga0501031_0025179 3300049568 Bacteria 3881
198 Ga0501032_0191381 3300049569 Bacteria 1337
199 Ga0501033_0906071 3300049570 Bacteria 592
200 Ga0501036_0010264 3300049572 Bacteria 7726
201 Ga0501037_0489910 3300049573 Bacteria 835
202 Ga0501038_0028237 3300049574 Bacteria 4985
203 Ga0501039_0016564 3300049575 Bacteria 5646
204 Ga0501041_0027911 3300049577 Bacteria 3403
205 Ga0501042_0220367 3300049578 Bacteria 1368
206 Ga0501046_0188715 3300049580 Bacteria 1538
207 Ga0501047_0551502 3300049581 Bacteria 977
208 Ga0501070_1123442 3300049586 Bacteria 605
209 Ga0501071_0152646 3300049587 Bacteria 1723
210 Ga0501072_0894741 3300049588 Bacteria 693
211 Ga0501074_0175715 3300049590 Bacteria 1528
212 Ga0501075_0058282 3300049591 Bacteria 2908
213 Ga0501076_0007615 3300049592 Bacteria 7884
214 Ga0501077_0183193 3300049593 Bacteria 1331
215 Ga0501077_0705705 3300049593 Bacteria 648
216 Ga0501234_102196 3300049707 Unclassified 522
217 Ga0501079_0006761 3300049741 Bacteria 8625
218 Ga0501081_0081315 3300049743 Bacteria 2269
219 Ga0501083_1012215 3300049744 Bacteria 541
220 Ga0501035_0370623 3300049822 Bacteria 1195
221 nmdc:mga00v17_555535_c1 3300050491 Bacteria 742
222 nmdc:mga0yw44_1082122_c1 3300050492 Bacteria 542
223 nmdc:mga05p37_16321_c1 3300050507 Bacteria 8941
224 nmdc:mga0qj67_216988_c1 3300050509 Bacteria 1553
225 nmdc:mga06r32_1382094_c1 3300050510 Bacteria 646
226 nmdc:mga06r32_248800_c1 3300050510 Bacteria 1765
227 nmdc:mga08y16_54803_c1 3300050511 Bacteria 4167
228 nmdc:mga08y16_81508_c1 3300050511 Bacteria 3373
229 nmdc:mga0n895_2203762_c1 3300050512 Unclassified 506
230 nmdc:mga0rr50_185995_c1 3300050513 Bacteria 1700
231 nmdc:mga08x19_789381_c1 3300050514 Bacteria 674
232 nmdc:mga0a205_74521_c1 3300050515 Bacteria 3279
233 Ga0500643_006082 3300053087 Bacteria 5101
234 Ga0501084_1132298 3300054114 Bacteria 657
235 Ga0501082_0001817 3300060353 Bacteria 18794
236 Ga0530510_0025077 3300061734 Bacteria 4263
237 2676474455 2675903058 Bacteria 6822861
238 2827633072 2827628540 Bacteria 6858585
239 Ga0395898_0562437
240 Ga0065707_10229100
241 Ga0070683_100076650
242 Ga0070670_100135012
243 Ga0068869_100010755
244 Ga0068868_100013566
245 Ga0070691_10716720
246 Ga0070661_100022523
247 Ga0070668_100291639
248 Ga0070675_100006430
249 Ga0070659_100039242
250 Ga0070714_100001721
251 Ga0070714_100713403
252 Ga0070713_100071422
253 Ga0070700_100006024
254 Ga0070663_100009388
255 Ga0070663_100083017
256 Ga0070678_100265040
257 Ga0070678_100591624
258 Ga0070662_100268888
259 Ga0070707_100904947
260 Ga0070679_100454820
261 Ga0070684_100003350
262 Ga0070684_100642262
263 Ga0070684_100884637
264 Ga0068853_100413481
265 Ga0070664_100017215
266 Ga0068857_100109699
267 Ga0068857_100400543
268 Ga0068857_100553661
269 Ga0068854_100623658
270 Ga0068856_100370648
271 Ga0068852_100008876
272 Ga0068852_100064483
273 Ga0068859_102205243
274 Ga0068864_101805310
275 Ga0068861_100224660
276 Ga0068863_100268169
277 Ga0068862_100086186
278 Ga0081455_10061640
279 Ga0081539_10008241
280 Ga0081539_10012186
281 Ga0081539_10497064
282 Ga0075364_10704534
283 Ga0075428_100684344
284 Ga0075430_100117696
285 Ga0075431_100257291
286 Ga0075433_10111209
287 Ga0075433_10135333
288 Ga0075434_100121513
289 Ga0075429_100230588
290 Ga0075429_101586276
291 Ga0068865_100073533
292 Ga0097620_102205690
293 Ga0111539_10072700
294 Ga0111539_10125447
295 Ga0111539_10254034
296 Ga0105245_10047451
297 Ga0114129_10138433
298 Ga0114129_10376887
299 Ga0114129_10764842
300 Ga0105243_10991053
301 Ga0105241_10201822
302 Ga0105241_12141082
303 Ga0105237_10015000
304 Ga0105238_10238102
305 Ga0105238_10249981
306 Ga0105249_10061488
307 Ga0105249_11255548
308 Ga0105239_10011306
309 Ga0105246_10700385
310 Ga0157369_11591820
311 Ga0157374_10827426
312 Ga0157375_10233093
313 Ga0157375_11253745
314 Ga0163163_12370303
315 Ga0157380_11416428
316 Ga0157377_10014153
317 Ga0163161_10104457
318 Ga0213873_10092982
319 Ga0213875_10011719
320 Ga0207688_10732148
321 Ga0207645_10019759
322 Ga0207654_10275700
323 Ga0207707_11163473
324 Ga0207662_10307851
325 Ga0207657_10110793
326 Ga0207657_10642864
327 Ga0207649_10271964
328 Ga0207649_10840092
329 Ga0207652_10299653
330 Ga0207681_10151951
331 Ga0207650_10243237
332 Ga0207650_11147338
333 Ga0207659_10004322
334 Ga0207687_10017283
335 Ga0207687_10022562
336 Ga0207700_10033555
337 Ga0207664_10004442
338 Ga0207644_10944158
339 Ga0207690_10014269
340 Ga0207706_10113970
341 Ga0207704_10032795
342 Ga0207689_10005253
343 Ga0207689_10068556
344 Ga0207661_10210126
345 Ga0207661_10406479
346 Ga0207679_10370917
347 Ga0207667_10494416
348 Ga0207640_10678415
349 Ga0207658_11532797
350 Ga0207677_10027576
351 Ga0207639_10309184
352 Ga0207678_10023527
353 Ga0207678_10052102
354 Ga0207678_10541317
355 Ga0207708_10014203
356 Ga0207702_10743553
357 Ga0207641_10177562
358 Ga0207674_10035046
359 Ga0207674_11965358
360 Ga0207675_100389598
361 Ga0207683_10225136
362 Ga0207683_10362424
363 Ga0207698_10006133
364 Ga0207698_10081484
365 Ga0207428_10091297
366 Ga0268265_10076216
367 Ga0307413_10336689
368 Ga0307410_10060268
369 Ga0307410_11371901
370 Ga0307406_10202169
371 Ga0307406_10355890
372 Ga0307406_12024624
373 Ga0307407_10221805
374 Ga0307409_100032653
375 Ga0307409_100210258
376 Ga0307409_100347171
377 Ga0307409_100667340
378 Ga0307409_102944137
379 Ga0307416_100042323
380 Ga0307416_103403983
381 Ga0307415_100240470
382 Ga0395899_0033744
383 Ga0395899_0693029
384 Ga0395899_0889610
385 Ga0395900_0045355
386 Ga0395900_0275318
387 Ga0395900_0673175
388 Ga0395898_0002025
389 Ga0395898_0126735
390 Ga0395898_0130756
391 Ga0395898_0198744
392 Ga0395898_1133554
393 Ga0395898_1288744
394 Ga0395905_0003246
395 Ga0395905_1084226
396 Ga0395905_1193755
397 Ga0436364_1207495
398 Ga0436364_1409920
399 Ga0395901_0004323
400 Ga0395901_0018053
401 Ga0395901_0252988
402 Ga0395901_0351831
403 Ga0395901_0367789
404 Ga0395901_0530044
405 Ga0395901_1214284
406 Ga0395901_1753241
407 Ga0436365_1252082
408 Ga0436362_0126253
409 Ga0436362_1206901
410 Ga0466963_0050724
411 Ga0466960_0368351
412 Ga0466967_1587810
413 Ga0495641_0157125
414 Ga0495580_0029306
415 Ga0495664_0739573
416 Ga0495584_0613414
417 Ga0495606_0119501
418 Ga0495642_0337617
419 Ga0495665_0101121
420 Ga0495598_0147937
421 Ga0495656_0129683
422 Ga0495588_0009330
423 Ga0495581_0158728
424 Ga0495676_0011512
425 Ga0496109_0004782
426 Ga0496110_0419666
427 Ga0496111_0110117
428 Ga0496111_0332139
429 Ga0496112_0063166
430 Ga0496112_0988452
431 Ga0496113_0431136
432 Ga0496113_1188237
433 Ga0496119_0098790
434 Ga0496120_0126728
435 Ga0501031_0025179
436 Ga0501032_0191381
437 Ga0501033_0906071
438 Ga0501036_0010264
439 Ga0501037_0489910
440 Ga0501038_0028237
441 Ga0501039_0016564
442 Ga0501041_0027911
443 Ga0501042_0220367
444 Ga0501046_0188715
445 Ga0501047_0551502
446 Ga0501070_1123442
447 Ga0501071_0152646
448 Ga0501072_0894741
449 Ga0501074_0175715
450 Ga0501075_0058282
451 Ga0501076_0007615
452 Ga0501077_0183193
453 Ga0501077_0705705
454 Ga0501234_102196
455 Ga0501079_0006761
456 Ga0501081_0081315
457 Ga0501083_1012215
458 Ga0501035_0370623
459 nmdc:mga00v17_555535_c1
460 nmdc:mga0yw44_1082122_c1
461 nmdc:mga05p37_16321_c1
462 nmdc:mga0qj67_216988_c1
463 nmdc:mga06r32_1382094_c1
464 nmdc:mga06r32_248800_c1
465 nmdc:mga08y16_54803_c1
466 nmdc:mga08y16_81508_c1
467 nmdc:mga0n895_2203762_c1
468 nmdc:mga0rr50_185995_c1
469 nmdc:mga08x19_789381_c1
470 nmdc:mga0a205_74521_c1
471 Ga0500643_006082
472 Ga0501084_1132298
473 Ga0501082_0001817
474 Ga0530510_0025077
475 2676474455
476 2827633072

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

21

133

0.87

PF19581

Glyoxalase_7

Glyoxalase superfamily protein

8

138

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ump-assembly1.cif.gz_B crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 0.8882 2 119
5ump-assembly1.cif.gz_B crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 0.8614 2 119
5ujp-assembly1.cif.gz_B the crystal structure of a glyoxalase/bleomycin resistance protein from streptomyces sp. cb03234 0.8594 4 117
5umq-assembly1.cif.gz_A crystal structure of tnms1, an antibiotic binding protein from streptomyces sp. cb03234 0.8594 1 118
5ujp-assembly1.cif.gz_B the crystal structure of a glyoxalase/bleomycin resistance protein from streptomyces sp. cb03234 0.8526 4 117
ID Description Score Start End Superfamily
5ujpB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8605 4 117 3.10.180.10
5ujpB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8536 4 117 3.10.180.10
4hc5C00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8201 1 118 3.10.180.10
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8195 66 119 3.30.720.110
5uhjB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8069 4 119 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A4P7GJC6-F1-model_v4 Glyoxalase 0.9925 1 120
AF-A0A0K1JFV7-F1-model_v4 Glyoxalase 0.9915 1 119
AF-A0A0Q9UH98-F1-model_v4 Glyoxalase 0.9913 1 119
AF-A0A4R7UQ10-F1-model_v4 Putative enzyme related to lactoylglutathione lyase 0.9899 1 117 GO:0016829
AF-A0A7W8C6X0-F1-model_v4 Catechol 2,3-dioxygenase-like lactoylglutathione lyase family enzyme 0.9872 1 119 GO:0016829
GO:0051213

Map