F351064

General Info

Members Datasets Scaffolds Average Seq Length
238 177 476 267

Family's Representative Sequence

Representative Sequence 3300028573|Ga0265334_10003792|Ga0265334_100037924
Length 297
Sequence MADTHGGPKHPYHLVDPSPWPALGALGAFLLAFGAAIGMHPDIFKEVLSEIFKPDTAKAMSASWEAFFKSVGWWIVAPGFAIVFAESRKFHTAVVQLGLRYGMILFIASEVLFFAAFFWAFFDSSLYPNSPEMPMRTEADGGVWPPKGVRVIAPFDLPFMNTLILLLSGTTVTWAHHAIIQGNKRDAVRGLLLTVLLGVCFTSIQAYEYIHAPFKFDANIYSSTFFMATGFHGFHVFVGTTFLLVCLFRAMAGQFKPNQHFGFEAAAWYWHFVDVVWLFLFFCIYWWGSGNAPIALH

Samples

Sample ID Description Type Environment
1 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
68 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
69 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
70 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
71 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
72 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
73 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
75 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
108 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
109 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
110 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
111 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
112 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
113 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
114 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
115 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
117 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
118 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
119 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
120 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
123 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
129 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
130 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
131 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
132 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
133 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
136 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
143 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
144 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
147 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
148 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
149 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
150 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
151 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
152 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
153 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
154 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
155 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
156 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
157 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
158 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
159 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
160 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
161 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
162 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
163 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
164 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
165 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
166 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
168 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
169 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
170 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
171 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
172 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
173 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
174 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
175 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
176 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
177 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.96
Metatranscriptomes 0.84
Isolates 4.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.91
Nodule 0.42
Rhizoplane 0.42
Rhizosphere 74.37
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265334_10003792 3300028573 Bacteria 6833
2 JGI25153J46596_10000140 3300003215 Bacteria 74706
3 JGI25153J46596_10000145 3300003215 Bacteria 72113
4 JGI25153J46596_10000325 3300003215 Bacteria 34505
5 Ga0055531_10022042 3300003794 Bacteria 2444
6 Ga0070658_10001958 3300005327 Bacteria 17323
7 Ga0070666_10423014 3300005335 Bacteria 960
8 Ga0070660_100138993 3300005339 Bacteria 1948
9 Ga0070689_100176679 3300005340 Bacteria 1732
10 Ga0070691_10062610 3300005341 Bacteria 1792
11 Ga0070675_100033629 3300005354 Bacteria 4158
12 Ga0070671_100217183 3300005355 Bacteria 1622
13 Ga0070674_100134995 3300005356 Bacteria 1844
14 Ga0070659_100038307 3300005366 Bacteria 3738
15 Ga0070709_10221098 3300005434 Bacteria 1350
16 Ga0070714_100056465 3300005435 Bacteria 3358
17 Ga0070713_100017686 3300005436 Bacteria 5401
18 Ga0070713_100342372 3300005436 Bacteria 1386
19 Ga0070710_10001733 3300005437 Bacteria 10306
20 Ga0070711_100032130 3300005439 Bacteria 3488
21 Ga0070705_100064329 3300005440 Bacteria 2191
22 Ga0070694_100124967 3300005444 Bacteria 1851
23 Ga0070708_100064321 3300005445 Bacteria 3286
24 Ga0070681_10046214 3300005458 Bacteria 4353
25 Ga0070681_10131301 3300005458 Bacteria 2437
26 Ga0070681_10303627 3300005458 Bacteria 1505
27 Ga0070681_10335268 3300005458 Bacteria 1422
28 Ga0070685_10223638 3300005466 Bacteria 1234
29 Ga0070706_100047980 3300005467 Bacteria 3942
30 Ga0070707_100006192 3300005468 Bacteria 11141
31 Ga0070698_100002982 3300005471 Bacteria 18626
32 Ga0070698_100013890 3300005471 Bacteria 8517
33 Ga0070699_100467673 3300005518 Bacteria 1144
34 Ga0070679_100010546 3300005530 Bacteria 8766
35 Ga0070679_100550207 3300005530 Bacteria 1098
36 Ga0070684_100066312 3300005535 Bacteria 3169
37 Ga0070697_100033470 3300005536 Bacteria 4140
38 Ga0070697_100104804 3300005536 Bacteria 2352
39 Ga0068853_100255432 3300005539 Bacteria 1610
40 Ga0070695_100066138 3300005545 Bacteria 2355
41 Ga0068855_100002842 3300005563 Bacteria 21281
42 Ga0068855_100498561 3300005563 Bacteria 1323
43 Ga0068857_100040567 3300005577 Bacteria 4128
44 Ga0068856_100017407 3300005614 Bacteria 6965
45 Ga0068858_100159455 3300005842 Bacteria 2124
46 Ga0068858_100378049 3300005842 Bacteria 1359
47 Ga0068860_100257974 3300005843 Bacteria 1699
48 Ga0068860_100307288 3300005843 Bacteria 1555
49 Ga0068862_100024902 3300005844 Bacteria 5022
50 Ga0081455_10010719 3300005937 Bacteria 9271
51 Ga0081455_10109917 3300005937 Bacteria 2193
52 Ga0081538_10035253 3300005981 Bacteria 3290
53 Ga0081540_1007148 3300005983 Bacteria 8009
54 Ga0081539_10006279 3300005985 Bacteria 11490
55 Ga0081539_10023348 3300005985 Bacteria 4053
56 Ga0070717_10029108 3300006028 Bacteria 4428
57 Ga0070717_10058943 3300006028 Bacteria 3175
58 Ga0075365_10022659 3300006038 Bacteria 3939
59 Ga0075363_100019185 3300006048 Bacteria 3416
60 Ga0075364_10143216 3300006051 Bacteria 1609
61 Ga0070716_100205542 3300006173 Bacteria 1312
62 Ga0070712_100090831 3300006175 Bacteria 2236
63 Ga0075362_10006421 3300006177 Bacteria 4382
64 Ga0075362_10014372 3300006177 Bacteria 3193
65 Ga0075362_10075188 3300006177 Bacteria 1549
66 Ga0075367_10038542 3300006178 Bacteria 2782
67 Ga0075367_10099893 3300006178 Bacteria 1772
68 Ga0075369_10003429 3300006186 Bacteria 5773
69 Ga0075369_10003923 3300006186 Bacteria 5453
70 Ga0075366_10015954 3300006195 Bacteria 4312
71 Ga0075370_10168353 3300006353 Bacteria 1287
72 Ga0075428_100284561 3300006844 Bacteria 1779
73 Ga0105240_10014155 3300009093 Bacteria 10897
74 Ga0105240_10310404 3300009093 Bacteria 1801
75 Ga0105248_10220783 3300009177 Bacteria 2134
76 Ga0105238_10014986 3300009551 Bacteria 7848
77 Ga0099796_10033825 3300010159 Bacteria 1685
78 Ga0157370_10177711 3300013104 Bacteria 1978
79 Ga0157369_10092454 3300013105 Bacteria 3228
80 Ga0157374_10214711 3300013296 Bacteria 1887
81 Ga0157374_10500551 3300013296 Bacteria 1219
82 Ga0157372_10197817 3300013307 Bacteria 2328
83 Ga0163163_10314885 3300014325 Bacteria 1618
84 Ga0163163_10366628 3300014325 Bacteria 1497
85 Ga0157380_10205960 3300014326 Bacteria 1749
86 Ga0182008_10081686 3300014497 Bacteria 1591
87 Ga0157379_10171254 3300014968 Bacteria 1960
88 Ga0157379_10481992 3300014968 Bacteria 1148
89 Ga0157376_10280446 3300014969 Bacteria 1569
90 Ga0157376_10281930 3300014969 Bacteria 1565
91 Ga0213873_10067755 3300021358 Bacteria 978
92 Ga0213872_10183193 3300021361 Bacteria 904
93 Ga0213874_10013783 3300021377 Bacteria 2103
94 Ga0213875_10000586 3300021388 Bacteria 29487
95 Ga0213875_10000960 3300021388 Bacteria 20598
96 Ga0213871_10002166 3300021441 Bacteria 3555
97 Ga0209758_1000060 3300025297 Bacteria 324326
98 Ga0209050_1005125 3300025298 Bacteria 8420
99 Ga0207426_1022958 3300025302 Bacteria 2134
100 Ga0209257_1000749 3300025304 Bacteria 49070
101 Ga0207697_10080750 3300025315 Bacteria 1370
102 Ga0207692_10084382 3300025898 Bacteria 1706
103 Ga0207680_10269418 3300025903 Bacteria 1181
104 Ga0207699_10094599 3300025906 Bacteria 1882
105 Ga0207699_10128646 3300025906 Bacteria 1648
106 Ga0207705_10004064 3300025909 Bacteria 11102
107 Ga0207684_10007090 3300025910 Bacteria 10130
108 Ga0207707_10018964 3300025912 Bacteria 5999
109 Ga0207707_10120167 3300025912 Bacteria 2297
110 Ga0207707_10339481 3300025912 Bacteria 1295
111 Ga0207695_10052462 3300025913 Bacteria 4272
112 Ga0207693_10004129 3300025915 Bacteria 12327
113 Ga0207693_10093985 3300025915 Bacteria 2350
114 Ga0207663_10101546 3300025916 Bacteria 1933
115 Ga0207663_10389032 3300025916 Bacteria 1064
116 Ga0207660_10184377 3300025917 Bacteria 1622
117 Ga0207652_10138784 3300025921 Bacteria 2172
118 Ga0207646_10034213 3300025922 Bacteria 4593
119 Ga0207681_10171457 3300025923 Bacteria 1645
120 Ga0207681_10283202 3300025923 Bacteria 1306
121 Ga0207694_10039720 3300025924 Bacteria 3622
122 Ga0207694_10104908 3300025924 Bacteria 2243
123 Ga0207659_10088255 3300025926 Bacteria 2310
124 Ga0207664_10063936 3300025929 Bacteria 2942
125 Ga0207644_10110360 3300025931 Bacteria 2079
126 Ga0207669_10098945 3300025937 Bacteria 1922
127 Ga0207711_10379352 3300025941 Bacteria 1312
128 Ga0207689_10136702 3300025942 Bacteria 2018
129 Ga0207661_10308720 3300025944 Bacteria 1420
130 Ga0207679_10698313 3300025945 Bacteria 920
131 Ga0207667_10102707 3300025949 Bacteria 2949
132 Ga0207703_10127514 3300026035 Bacteria 2193
133 Ga0207708_10253383 3300026075 Bacteria 1419
134 Ga0207683_10035287 3300026121 Bacteria 4349
135 Ga0268266_10008101 3300028379 Bacteria 9380
136 Ga0268266_10238550 3300028379 Bacteria 1677
137 Ga0268265_10006068 3300028380 Bacteria 8207
138 Ga0268265_10241747 3300028380 Bacteria 1594
139 Ga0268264_10462799 3300028381 Bacteria 1231
140 Ga0265338_10047287 3300028800 Bacteria 3931
141 Ga0265338_10077619 3300028800 Bacteria 2807
142 Ga0311001_1053265 3300029277 Bacteria 1307
143 Ga0265331_10003066 3300031250 Bacteria 10959
144 Ga0265327_10001035 3300031251 Bacteria 39226
145 Ga0265327_10004532 3300031251 Bacteria 12243
146 Ga0265313_10000138 3300031595 Bacteria 75121
147 Ga0316575_10076124 3300031665 Bacteria 1351
148 Ga0265314_10030593 3300031711 Bacteria 3982
149 Ga0265342_10003760 3300031712 Bacteria 12247
150 Ga0316578_10191910 3300031728 Bacteria 1231
151 Ga0373923_0186067 3300035111 Bacteria 956
152 Ga0373932_0141761 3300035112 Bacteria 818
153 Ga0373941_0074547 3300035115 Bacteria 1134
154 Ga0373955_0092911 3300035172 Bacteria 1722
155 Ga0373931_0025332 3300035691 Bacteria 3013
156 Ga0373935_0114386 3300035692 Bacteria 1795
157 Ga0373937_0012269 3300036401 Bacteria 7530
158 Ga0373937_0058633 3300036401 Bacteria 3537
159 Ga0373937_0228570 3300036401 Bacteria 1752
160 Ga0316582_0240655 3300036647 Bacteria 1240
161 Ga0395899_0082497 3300037312 Bacteria 2339
162 Ga0395900_0009931 3300037418 Bacteria 9744
163 Ga0395900_0201781 3300037418 Bacteria 2012
164 Ga0395900_0229337 3300037418 Bacteria 1868
165 Ga0395898_0029804 3300037466 Bacteria 5462
166 Ga0395898_0035958 3300037466 Bacteria 4922
167 Ga0436364_0690763 3300037853 Bacteria 27958
168 Ga0436364_1067516 3300037853 Bacteria 3014
169 Ga0436364_1246752 3300037853 Bacteria 40716
170 Ga0395901_0008225 3300038443 Bacteria 10540
171 Ga0395901_0016059 3300038443 Bacteria 7627
172 Ga0395901_0102686 3300038443 Bacteria 3000
173 Ga0395901_0138346 3300038443 Bacteria 2559
174 Ga0436360_0295059 3300039438 Bacteria 2142
175 Ga0436360_0498289 3300039438 Bacteria 9205
176 Ga0436361_0205284 3300039447 Bacteria 1994
177 Ga0436361_0214175 3300039447 Bacteria 893
178 Ga0436361_0515506 3300039447 Bacteria 3074
179 Ga0436363_1052032 3300039450 Bacteria 6112
180 Ga0436362_0821541 3300039453 Bacteria 1413
181 Ga0436362_1011129 3300039453 Bacteria 982
182 Ga0439455_0040546 3300042012 Bacteria 1191
183 Ga0466963_0313140 3300044694 Bacteria 1104
184 Ga0466967_0224738 3300045976 Bacteria 1785
185 Ga0495638_0256795 3300046460 Bacteria 961
186 Ga0495625_0334878 3300046660 Bacteria 960
187 Ga0496112_0639895 3300048915 Bacteria 994
188 Ga0496126_0266977 3300048929 Bacteria 1421
189 Ga0501034_0005903 3300049571 Bacteria 13289
190 Ga0501046_0055666 3300049580 Bacteria 3107
191 Ga0501047_0029258 3300049581 Bacteria 5313
192 Ga0501047_0219558 3300049581 Bacteria 1757
193 Ga0501073_0022407 3300049589 Bacteria 4548
194 Ga0501080_0032528 3300049742 Bacteria 4865
195 Ga0501080_0086101 3300049742 Bacteria 2919
196 Ga0501083_0028543 3300049744 Bacteria 3844
197 Ga0501083_0237857 3300049744 Bacteria 1186
198 Ga0501035_0166052 3300049822 Bacteria 1909
199 Ga0501044_0032580 3300049823 Bacteria 5477
200 Ga0501044_0052135 3300049823 Bacteria 4217
201 nmdc:mga03683_109276_c1 3300050489 Bacteria 1221
202 nmdc:mga03683_18128_c1 3300050489 Bacteria 2673
203 nmdc:mga03683_4776_c1 3300050489 Bacteria 4523
204 nmdc:mga03n38_8180_c1 3300050490 Bacteria 3740
205 nmdc:mga0yw44_208308_c1 3300050492 Bacteria 1293
206 nmdc:mga0yw44_22415_c1 3300050492 Bacteria 3541
207 nmdc:mga0yw44_36014_c1 3300050492 Bacteria 2914
208 nmdc:mga0k408_15006_c1 3300050493 Bacteria 4280
209 nmdc:mga0k408_69744_c1 3300050493 Bacteria 2052
210 nmdc:mga07m45_100701_c1 3300050496 Bacteria 1659
211 nmdc:mga0sz30_441_c1 3300050516 Bacteria 15688
212 Ga0500644_0144388 3300053088 Bacteria 948
213 Ga0500646_0089307 3300053090 Bacteria 951
214 Ga0500651_0179821 3300053093 Bacteria 1257
215 Ga0500641_0002568 3300053096 Bacteria 6419
216 Ga0500641_0004314 3300053096 Bacteria 5017
217 Ga0500595_058338 3300053119 Bacteria 1173
218 Ga0500642_0014354 3300053130 Bacteria 2944
219 Ga0500568_0106737 3300053139 Bacteria 1048
220 Ga0500604_0000402 3300053151 Bacteria 11931
221 Ga0500616_0011902 3300053153 Bacteria 5113
222 Ga0500616_0012817 3300053153 Bacteria 4893
223 Ga0500620_022200 3300053155 Bacteria 1908
224 Ga0500637_0054290 3300053178 Bacteria 2287
225 Ga0500552_000048 3300053733 Bacteria 10039
226 Ga0501084_0061936 3300054114 Bacteria 3133
227 Ga0587091_017631 3300059511 Bacteria 1205
228 Ga0501082_0010772 3300060353 Bacteria 7873
229 2512033305 2511231221 Bacteria 6846400
230 2524610052 2524023250 Bacteria 5457705
231 2599105785 2597490356 Bacteria 7030811
232 2842335828 2842333319 Bacteria 8899485
233 2846954528 2846952575 Bacteria 6587527
234 2848859209 2848858292 Bacteria 7391279
235 2883292670 2883291878 Bacteria 5894118
236 2883355638 2883354860 Bacteria 5865246
237 2897805680 2897803580 Bacteria 7000062
238 8054005898 8054002106 Bacteria 7987183
239 Ga0265334_10003792
240 JGI25153J46596_10000140
241 JGI25153J46596_10000145
242 JGI25153J46596_10000325
243 Ga0055531_10022042
244 Ga0070658_10001958
245 Ga0070666_10423014
246 Ga0070660_100138993
247 Ga0070689_100176679
248 Ga0070691_10062610
249 Ga0070675_100033629
250 Ga0070671_100217183
251 Ga0070674_100134995
252 Ga0070659_100038307
253 Ga0070709_10221098
254 Ga0070714_100056465
255 Ga0070713_100017686
256 Ga0070713_100342372
257 Ga0070710_10001733
258 Ga0070711_100032130
259 Ga0070705_100064329
260 Ga0070694_100124967
261 Ga0070708_100064321
262 Ga0070681_10046214
263 Ga0070681_10131301
264 Ga0070681_10303627
265 Ga0070681_10335268
266 Ga0070685_10223638
267 Ga0070706_100047980
268 Ga0070707_100006192
269 Ga0070698_100002982
270 Ga0070698_100013890
271 Ga0070699_100467673
272 Ga0070679_100010546
273 Ga0070679_100550207
274 Ga0070684_100066312
275 Ga0070697_100033470
276 Ga0070697_100104804
277 Ga0068853_100255432
278 Ga0070695_100066138
279 Ga0068855_100002842
280 Ga0068855_100498561
281 Ga0068857_100040567
282 Ga0068856_100017407
283 Ga0068858_100159455
284 Ga0068858_100378049
285 Ga0068860_100257974
286 Ga0068860_100307288
287 Ga0068862_100024902
288 Ga0081455_10010719
289 Ga0081455_10109917
290 Ga0081538_10035253
291 Ga0081540_1007148
292 Ga0081539_10006279
293 Ga0081539_10023348
294 Ga0070717_10029108
295 Ga0070717_10058943
296 Ga0075365_10022659
297 Ga0075363_100019185
298 Ga0075364_10143216
299 Ga0070716_100205542
300 Ga0070712_100090831
301 Ga0075362_10006421
302 Ga0075362_10014372
303 Ga0075362_10075188
304 Ga0075367_10038542
305 Ga0075367_10099893
306 Ga0075369_10003429
307 Ga0075369_10003923
308 Ga0075366_10015954
309 Ga0075370_10168353
310 Ga0075428_100284561
311 Ga0105240_10014155
312 Ga0105240_10310404
313 Ga0105248_10220783
314 Ga0105238_10014986
315 Ga0099796_10033825
316 Ga0157370_10177711
317 Ga0157369_10092454
318 Ga0157374_10214711
319 Ga0157374_10500551
320 Ga0157372_10197817
321 Ga0163163_10314885
322 Ga0163163_10366628
323 Ga0157380_10205960
324 Ga0182008_10081686
325 Ga0157379_10171254
326 Ga0157379_10481992
327 Ga0157376_10280446
328 Ga0157376_10281930
329 Ga0213873_10067755
330 Ga0213872_10183193
331 Ga0213874_10013783
332 Ga0213875_10000586
333 Ga0213875_10000960
334 Ga0213871_10002166
335 Ga0209758_1000060
336 Ga0209050_1005125
337 Ga0207426_1022958
338 Ga0209257_1000749
339 Ga0207697_10080750
340 Ga0207692_10084382
341 Ga0207680_10269418
342 Ga0207699_10094599
343 Ga0207699_10128646
344 Ga0207705_10004064
345 Ga0207684_10007090
346 Ga0207707_10018964
347 Ga0207707_10120167
348 Ga0207707_10339481
349 Ga0207695_10052462
350 Ga0207693_10004129
351 Ga0207693_10093985
352 Ga0207663_10101546
353 Ga0207663_10389032
354 Ga0207660_10184377
355 Ga0207652_10138784
356 Ga0207646_10034213
357 Ga0207681_10171457
358 Ga0207681_10283202
359 Ga0207694_10039720
360 Ga0207694_10104908
361 Ga0207659_10088255
362 Ga0207664_10063936
363 Ga0207644_10110360
364 Ga0207669_10098945
365 Ga0207711_10379352
366 Ga0207689_10136702
367 Ga0207661_10308720
368 Ga0207679_10698313
369 Ga0207667_10102707
370 Ga0207703_10127514
371 Ga0207708_10253383
372 Ga0207683_10035287
373 Ga0268266_10008101
374 Ga0268266_10238550
375 Ga0268265_10006068
376 Ga0268265_10241747
377 Ga0268264_10462799
378 Ga0265338_10047287
379 Ga0265338_10077619
380 Ga0311001_1053265
381 Ga0265331_10003066
382 Ga0265327_10001035
383 Ga0265327_10004532
384 Ga0265313_10000138
385 Ga0316575_10076124
386 Ga0265314_10030593
387 Ga0265342_10003760
388 Ga0316578_10191910
389 Ga0373923_0186067
390 Ga0373932_0141761
391 Ga0373941_0074547
392 Ga0373955_0092911
393 Ga0373931_0025332
394 Ga0373935_0114386
395 Ga0373937_0012269
396 Ga0373937_0058633
397 Ga0373937_0228570
398 Ga0316582_0240655
399 Ga0395899_0082497
400 Ga0395900_0009931
401 Ga0395900_0201781
402 Ga0395900_0229337
403 Ga0395898_0029804
404 Ga0395898_0035958
405 Ga0436364_0690763
406 Ga0436364_1067516
407 Ga0436364_1246752
408 Ga0395901_0008225
409 Ga0395901_0016059
410 Ga0395901_0102686
411 Ga0395901_0138346
412 Ga0436360_0295059
413 Ga0436360_0498289
414 Ga0436361_0205284
415 Ga0436361_0214175
416 Ga0436361_0515506
417 Ga0436363_1052032
418 Ga0436362_0821541
419 Ga0436362_1011129
420 Ga0439455_0040546
421 Ga0466963_0313140
422 Ga0466967_0224738
423 Ga0495638_0256795
424 Ga0495625_0334878
425 Ga0496112_0639895
426 Ga0496126_0266977
427 Ga0501034_0005903
428 Ga0501046_0055666
429 Ga0501047_0029258
430 Ga0501047_0219558
431 Ga0501073_0022407
432 Ga0501080_0032528
433 Ga0501080_0086101
434 Ga0501083_0028543
435 Ga0501083_0237857
436 Ga0501035_0166052
437 Ga0501044_0032580
438 Ga0501044_0052135
439 nmdc:mga03683_109276_c1
440 nmdc:mga03683_18128_c1
441 nmdc:mga03683_4776_c1
442 nmdc:mga03n38_8180_c1
443 nmdc:mga0yw44_208308_c1
444 nmdc:mga0yw44_22415_c1
445 nmdc:mga0yw44_36014_c1
446 nmdc:mga0k408_15006_c1
447 nmdc:mga0k408_69744_c1
448 nmdc:mga07m45_100701_c1
449 nmdc:mga0sz30_441_c1
450 Ga0500644_0144388
451 Ga0500646_0089307
452 Ga0500651_0179821
453 Ga0500641_0002568
454 Ga0500641_0004314
455 Ga0500595_058338
456 Ga0500642_0014354
457 Ga0500568_0106737
458 Ga0500604_0000402
459 Ga0500616_0011902
460 Ga0500616_0012817
461 Ga0500620_022200
462 Ga0500637_0054290
463 Ga0500552_000048
464 Ga0501084_0061936
465 Ga0587091_017631
466 Ga0501082_0010772
467 2512033305
468 2524610052
469 2599105785
470 2842335828
471 2846954528
472 2848859209
473 2883292670
474 2883355638
475 2897805680
476 8054005898

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00510

COX3

Cytochrome c oxidase subunit III

10

289

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6e42-assembly1.cif.gz_A crystal structure of human indoleamine 2,3-dioxygenase 1 (ido1) in complex with ferric heme and 4-chlorophenyl imidazole 0.8273 143 190
6e42-assembly2.cif.gz_B crystal structure of human indoleamine 2,3-dioxygenase 1 (ido1) in complex with ferric heme and 4-chlorophenyl imidazole 0.8188 143 190
7z2l-assembly3.cif.gz_C crystal structure of l-kynurenine in the active site of human indoleamine-2,3-dioxygenase 1 (hido1) 0.8047 143 198
8i7l-assembly1.cif.gz_A crystal structure of indoleamine 2,3-dioxygenagse 1 (ido1) complexed with a novel inhibitor 0.7937 143 198
5whr-assembly1.cif.gz_A discovery of a novel and selective ido-1 inhibitor pf-06840003 and its characterization as a potential clinical candidate. 0.7931 143 198
ID Description Score Start End Superfamily
af_Q6ZQW0_157_417_1.20.58.480 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.8283 143 197 1.20.58.480
af_B0V1K8_132_411_1.20.58.480 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.8206 143 197 1.20.58.480
af_P28776_134_405_1.20.58.480 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.817 143 190 1.20.58.480
af_A0A1D6NW80_40_127_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.8003 143 238 1.20.58.80
af_O21049_302_434_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.7852 142 241 1.20.120.80
ID Description Score Start End GO Terms
AF-A0A6G7SEH2-F1-model_v4 Cytochrome c oxidase subunit 3 0.9666 144 236 GO:0004129
GO:0005739
GO:0006123
GO:0016020
AF-A0A172ESW9-F1-model_v4 Cytochrome c oxidase subunit 3 0.9578 152 246 GO:0004129
GO:0005739
GO:0006123
GO:0016020
AF-A0A2Z2HN46-F1-model_v4 Cytochrome c oxidase subunit 3 0.9527 149 246 GO:0004129
GO:0005739
GO:0006123
GO:0016020
AF-A0A6G7SEH2-F1-model_v4 Cytochrome c oxidase subunit 3 0.9469 144 236 GO:0004129
GO:0005739
GO:0006123
GO:0016020
AF-A0A4Q3F416-F1-model_v4 deleted 0.9429 142 252

Map