F350987

General Info

Members Datasets Scaffolds Average Seq Length
238 156 476 290

Family's Representative Sequence

Representative Sequence 3300025297|Ga0209758_1003029|Ga0209758_10030293
Length 305
Sequence MAPGVPSVACMNASRIALVTGANQGLGRALVEGLAARMNPDDLVLLTGRHERRVADAADEVTGLRGTRARVEGRVLDVTDADAVARLADELGARYGGVDIVVSNAVARLLPGESQAERADEFIDVSNTATHAILRSFGPVLRPGGRLLVVASSLGTLGHLDPRLHRLFDGADLDQVEYAVESWRSAVHNGTAVEAGWPVWLNVPSKVAQVAAVRAVAAARREHDLAAGILIASVCPGMVDTDTSRPWFSDFSQAQSPSEAARAVLDLVLAEHADPALYGELVRFGKALPWHDGTPLVEQDGLVTP

Samples

Sample ID Description Type Environment
1 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
12 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
13 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
14 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
15 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
16 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
17 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
18 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
19 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
20 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
25 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
26 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
27 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
28 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
29 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
30 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
31 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
32 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
33 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
34 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
35 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
36 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
37 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
38 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
39 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
40 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
41 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
42 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
43 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
44 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
45 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
46 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
47 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
48 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
49 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
50 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
51 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
52 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
53 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
54 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
55 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
56 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
57 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
58 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
59 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
60 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
61 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
62 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
63 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
64 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
65 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
66 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
67 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
68 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
69 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
70 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
71 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
72 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
73 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
74 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
75 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
76 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
77 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
78 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
79 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
80 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
81 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
82 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
83 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
84 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
85 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
86 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
87 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
88 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
89 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
90 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
91 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
92 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
93 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
94 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
95 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
96 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
97 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
98 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
99 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
100 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
101 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
102 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
103 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
104 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
105 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
106 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
107 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
108 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
109 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
110 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
111 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
112 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
113 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
114 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
115 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
116 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
117 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
118 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
119 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
120 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
132 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
133 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
134 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
135 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
136 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
137 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
138 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
139 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
140 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
141 2643221647 Streptomyces sp. Root369 Isolate Unclassified
142 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
143 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
144 2862574272 Streptomyces sp. AcE210 Isolate Nodule
145 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
146 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
147 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
148 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
149 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
150 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
151 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
152 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
153 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
154 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
155 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
156 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.44
Metatranscriptomes 0
Isolates 7.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.1
Nodule 0.42
Rhizoplane 0.42
Rhizosphere 86.13
Stem 0
Stem Tuber 0.42
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209758_1003029 3300025297 Bacteria 16021
2 rootH2_10022985 3300003320 Bacteria 5430
3 Ga0070714_100060701 3300005435 Bacteria 3245
4 Ga0070713_100114456 3300005436 Bacteria 2357
5 Ga0070710_10105647 3300005437 Bacteria 1684
6 Ga0070711_100022925 3300005439 Bacteria 4053
7 Ga0070663_100238931 3300005455 Bacteria 1433
8 Ga0070706_100257596 3300005467 Bacteria 1629
9 Ga0068853_100385168 3300005539 Bacteria 1310
10 Ga0068855_100570390 3300005563 Bacteria 1223
11 Ga0068854_100175116 3300005578 Bacteria 1672
12 Ga0081539_10003624 3300005985 Bacteria 18628
13 Ga0070717_10287736 3300006028 Bacteria 1458
14 Ga0070715_10114658 3300006163 Bacteria 1276
15 Ga0075431_100002312 3300006847 Bacteria 18308
16 Ga0105239_10322559 3300010375 Bacteria 1742
17 Ga0157372_10074263 3300013307 Bacteria 3834
18 Ga0183367_1004 3300015688 Bacteria 716880
19 Ga0207426_1011027 3300025302 Bacteria 3470
20 Ga0207699_10029924 3300025906 Bacteria 3042
21 Ga0207693_10028827 3300025915 Bacteria 4387
22 Ga0207667_10499546 3300025949 Bacteria 1234
23 Ga0207639_10368784 3300026041 Bacteria 1287
24 Ga0307517_10073200 3300028786 Bacteria 3040
25 Ga0307515_10000106 3300028794 Bacteria 197218
26 Ga0307511_10000047 3300030521 Bacteria 98863
27 Ga0307512_10017821 3300030522 Bacteria 6501
28 Ga0307513_10090613 3300031456 Bacteria 3118
29 Ga0307513_10143698 3300031456 Bacteria 2308
30 Ga0307509_10023804 3300031507 Bacteria 6865
31 Ga0307509_10028295 3300031507 Bacteria 6233
32 Ga0307509_10033570 3300031507 Bacteria 5648
33 Ga0307508_10050741 3300031616 Bacteria 3690
34 Ga0307508_10095360 3300031616 Bacteria 2566
35 Ga0307516_10019055 3300031730 Bacteria 7118
36 Ga0307516_10179751 3300031730 Bacteria 1850
37 Ga0307518_10013726 3300031838 Bacteria 5786
38 Ga0307518_10099536 3300031838 Bacteria 2083
39 Ga0307518_10115701 3300031838 Bacteria 1905
40 Ga0307507_10006514 3300033179 Bacteria 17857
41 Ga0307507_10025613 3300033179 Bacteria 6393
42 Ga0307510_10012184 3300033180 Bacteria 10196
43 Ga0373923_0064080 3300035111 Bacteria 1567
44 Ga0373936_0132925 3300035113 Bacteria 1070
45 Ga0373935_0057554 3300035692 Bacteria 2480
46 Ga0373933_0095488 3300035724 Bacteria 1839
47 Ga0373933_0333985 3300035724 Bacteria 983
48 Ga0373947_0084143 3300035725 Bacteria 1974
49 Ga0373937_0324008 3300036401 Bacteria 1458
50 Ga0373937_0490216 3300036401 Bacteria 1167
51 Ga0373925_0050259 3300037068 Bacteria 3110
52 Ga0395899_0207656 3300037312 Bacteria 1362
53 Ga0395900_0004598 3300037418 Bacteria 14562
54 Ga0395898_0000549 3300037466 Bacteria 70801
55 Ga0395898_0111484 3300037466 Bacteria 2622
56 Ga0395905_0000650 3300037471 Bacteria 46216
57 Ga0395901_0000238 3300038443 Bacteria 69147
58 Ga0439442_001342 3300042002 Bacteria 4872
59 Ga0439432_023960 3300042006 Bacteria 2007
60 Ga0439449_0018257 3300042007 Bacteria 2632
61 Ga0439455_0012836 3300042012 Bacteria 1887
62 Ga0450903_000592 3300042138 Bacteria 7406
63 Ga0439458_0001007 3300042157 Bacteria 7208
64 Ga0466961_0103941 3300044693 Bacteria 1789
65 Ga0466963_0074420 3300044694 Bacteria 2291
66 Ga0466970_0001569 3300044765 Bacteria 11032
67 Ga0466970_0120425 3300044765 Bacteria 1437
68 Ga0466967_0033235 3300045976 Bacteria 4365
69 Ga0495617_027098 3300046452 Bacteria 1929
70 Ga0495592_0029989 3300046454 Bacteria 4114
71 Ga0495592_0061271 3300046454 Bacteria 2765
72 Ga0495592_0068572 3300046454 Bacteria 2589
73 Ga0495603_0020257 3300046455 Bacteria 4031
74 Ga0495629_0006033 3300046459 Bacteria 9007
75 Ga0495629_0010308 3300046459 Bacteria 6809
76 Ga0495629_0056545 3300046459 Bacteria 2743
77 Ga0495629_0184267 3300046459 Bacteria 1446
78 Ga0495629_0332321 3300046459 Bacteria 1038
79 Ga0495629_0357408 3300046459 Bacteria 996
80 Ga0495651_0005701 3300046462 Bacteria 9489
81 Ga0495651_0047527 3300046462 Bacteria 3318
82 Ga0495653_0073209 3300046463 Bacteria 2557
83 Ga0495582_0052661 3300046473 Bacteria 2244
84 Ga0495605_0006020 3300046474 Bacteria 7011
85 Ga0495662_0000548 3300046476 Bacteria 17200
86 Ga0495662_0011269 3300046476 Bacteria 4371
87 Ga0495664_0036873 3300046477 Bacteria 2883
88 Ga0495664_0042168 3300046477 Bacteria 2702
89 Ga0495664_0138882 3300046477 Bacteria 1473
90 Ga0495664_0157444 3300046477 Bacteria 1378
91 Ga0495585_0021325 3300046492 Bacteria 3720
92 Ga0495594_0015272 3300046499 Bacteria 4031
93 Ga0495607_0064117 3300046501 Bacteria 2076
94 Ga0495583_0004527 3300046506 Bacteria 9901
95 Ga0495583_0078677 3300046506 Bacteria 1436
96 Ga0495606_0019767 3300046507 Bacteria 4992
97 Ga0495608_0120922 3300046511 Bacteria 1679
98 Ga0495616_0004229 3300046513 Bacteria 9084
99 Ga0495618_0021842 3300046514 Bacteria 3948
100 Ga0495618_0196842 3300046514 Bacteria 1276
101 Ga0495620_0002363 3300046515 Bacteria 10936
102 Ga0495620_0040757 3300046515 Bacteria 2041
103 Ga0495628_0010747 3300046516 Bacteria 7754
104 Ga0495628_0024672 3300046516 Bacteria 4919
105 Ga0495628_0156831 3300046516 Bacteria 1731
106 Ga0495630_0216723 3300046517 Bacteria 1461
107 Ga0495643_0006164 3300046522 Bacteria 7962
108 Ga0495648_0030021 3300046524 Bacteria 3601
109 Ga0495648_0107103 3300046524 Bacteria 1529
110 Ga0495648_0123909 3300046524 Bacteria 1384
111 Ga0495642_0187404 3300046528 Bacteria 901
112 Ga0495640_0002973 3300046533 Bacteria 13649
113 Ga0495640_0008725 3300046533 Bacteria 7943
114 Ga0495640_0319826 3300046533 Bacteria 961
115 Ga0495587_0000343 3300046536 Bacteria 33185
116 Ga0495597_0037336 3300046542 Bacteria 2182
117 Ga0495597_0040544 3300046542 Bacteria 2081
118 Ga0495645_0024044 3300046543 Bacteria 4417
119 Ga0495645_0057570 3300046543 Bacteria 2821
120 Ga0495622_0011968 3300046557 Bacteria 4013
121 Ga0495622_0059668 3300046557 Bacteria 1766
122 Ga0495633_0028016 3300046558 Bacteria 2748
123 Ga0495667_0264257 3300046559 Bacteria 1094
124 Ga0495668_0015147 3300046616 Bacteria 4508
125 Ga0495668_0026694 3300046616 Bacteria 3275
126 Ga0495634_0001032 3300046642 Bacteria 26114
127 Ga0495634_0096388 3300046642 Bacteria 1915
128 Ga0495611_0099850 3300046648 Bacteria 1347
129 Ga0495625_0011354 3300046660 Bacteria 7271
130 Ga0495625_0029033 3300046660 Bacteria 4141
131 Ga0495625_0161139 3300046660 Bacteria 1503
132 Ga0495625_0254698 3300046660 Bacteria 1138
133 Ga0495635_0057016 3300046663 Bacteria 2689
134 Ga0495635_0064330 3300046663 Bacteria 2518
135 Ga0495635_0155527 3300046663 Bacteria 1556
136 Ga0495588_0076758 3300046674 Bacteria 1741
137 Ga0495588_0189212 3300046674 Bacteria 1087
138 Ga0495657_0003581 3300046675 Bacteria 12636
139 Ga0495657_0005098 3300046675 Bacteria 10431
140 Ga0495657_0014226 3300046675 Bacteria 5846
141 Ga0495657_0051318 3300046675 Bacteria 2770
142 Ga0495599_0145314 3300046678 Bacteria 1470
143 Ga0495646_0040858 3300046680 Bacteria 2853
144 Ga0495658_0096196 3300046683 Bacteria 1761
145 Ga0495613_0004807 3300046689 Bacteria 10135
146 Ga0495613_0006281 3300046689 Bacteria 8887
147 Ga0495613_0011050 3300046689 Bacteria 6702
148 Ga0495613_0020061 3300046689 Bacteria 4980
149 Ga0495613_0045359 3300046689 Bacteria 3251
150 Ga0495624_0038955 3300046690 Bacteria 3050
151 Ga0495671_0005049 3300046692 Bacteria 7775
152 Ga0495649_0061671 3300046694 Bacteria 2016
153 Ga0495649_0096350 3300046694 Bacteria 1574
154 Ga0495589_0003034 3300046794 Bacteria 9221
155 Ga0495589_0032293 3300046794 Bacteria 2632
156 Ga0495589_0044529 3300046794 Bacteria 2207
157 Ga0495589_0176492 3300046794 Bacteria 1014
158 Ga0495600_0025808 3300046809 Bacteria 3787
159 Ga0495660_0098450 3300046810 Bacteria 1508
160 Ga0495581_0007188 3300047315 Bacteria 6446
161 Ga0495581_0078365 3300047315 Bacteria 1912
162 Ga0495581_0115618 3300047315 Bacteria 1560
163 Ga0495604_0000271 3300047317 Bacteria 46263
164 Ga0495636_0046963 3300047318 Bacteria 1802
165 Ga0495636_0054842 3300047318 Bacteria 1675
166 Ga0495636_0181566 3300047318 Bacteria 955
167 Ga0495674_0142333 3300047319 Bacteria 2015
168 Ga0495676_0005627 3300047321 Bacteria 11489
169 Ga0495676_0023088 3300047321 Bacteria 5403
170 Ga0495676_0050106 3300047321 Bacteria 3351
171 Ga0495680_0324652 3300047322 Bacteria 1077
172 Ga0495687_001075 3300047443 Bacteria 26898
173 Ga0495687_004322 3300047443 Bacteria 9673
174 Ga0495687_009468 3300047443 Bacteria 5440
175 Ga0495687_014479 3300047443 Bacteria 4058
176 Ga0495687_028503 3300047443 Bacteria 2597
177 Ga0495675_0093018 3300047444 Bacteria 1892
178 Ga0495685_000488 3300047447 Bacteria 12266
179 Ga0495685_005913 3300047447 Bacteria 3996
180 Ga0495685_012221 3300047447 Bacteria 2907
181 Ga0495685_016081 3300047447 Bacteria 2556
182 Ga0495685_020682 3300047447 Bacteria 2262
183 Ga0495681_0000719 3300047470 Bacteria 25382
184 Ga0495686_0037133 3300047472 Bacteria 3123
185 Ga0495686_0105770 3300047472 Bacteria 1693
186 Ga0495686_0109081 3300047472 Bacteria 1662
187 Ga0495593_0001017 3300047673 Bacteria 16446
188 Ga0495593_0010857 3300047673 Bacteria 5251
189 Ga0495593_0054170 3300047673 Bacteria 2115
190 Ga0495602_0107242 3300048088 Bacteria 2277
191 Ga0495614_0006801 3300048089 Bacteria 5118
192 Ga0495614_0014987 3300048089 Bacteria 3384
193 Ga0495614_0023093 3300048089 Bacteria 2682
194 Ga0496112_0011624 3300048915 Bacteria 8051
195 Ga0501033_0033950 3300049570 Bacteria 3829
196 Ga0501033_0059783 3300049570 Bacteria 2814
197 Ga0501034_0026654 3300049571 Bacteria 5882
198 Ga0501036_0044985 3300049572 Bacteria 3740
199 Ga0501036_0178644 3300049572 Bacteria 1787
200 Ga0501038_0033016 3300049574 Bacteria 4560
201 Ga0501039_0199172 3300049575 Bacteria 1575
202 Ga0501043_0116944 3300049579 Bacteria 2092
203 Ga0501043_0181359 3300049579 Bacteria 1640
204 Ga0501047_0267400 3300049581 Bacteria 1556
205 Ga0501070_0251058 3300049586 Bacteria 1447
206 Ga0501080_0055862 3300049742 Bacteria 3677
207 Ga0501035_0016367 3300049822 Bacteria 6839
208 Ga0501035_0067945 3300049822 Bacteria 3161
209 Ga0501044_0026126 3300049823 Bacteria 6183
210 Ga0501044_0035150 3300049823 Bacteria 5249
211 Ga0501044_0667588 3300049823 Bacteria 927
212 Ga0501045_0364367 3300049824 Bacteria 1076
213 nmdc:mga09592_31454_c1 3300050508 Bacteria 4423
214 nmdc:mga0qj67_26663_c1 3300050509 Bacteria 4474
215 nmdc:mga06r32_114938_c1 3300050510 Bacteria 2650
216 Ga0500610_0056269 3300053079 Bacteria 2053
217 Ga0495655_0021197 3300053083 Bacteria 1468
218 Ga0495655_0065405 3300053083 Bacteria 1003
219 Ga0500640_004757 3300053095 Bacteria 4969
220 Ga0500624_003355 3300053157 Bacteria 2106
221 2552112262 2551306166 Bacteria 9731570
222 2616699687 2616644814 Bacteria 11555299
223 2644267239 2643221647 Bacteria 10741251
224 2786675832 2786546132 Bacteria 10419719
225 2808917246 2808606375 Bacteria 9466072
226 2862582029 2862574272 Bacteria 10567477
227 2899375739 2899370129 Bacteria 6781179
228 2954691351 2954682443 Bacteria 9862841
229 2954706544 2954701450 Bacteria 10834262
230 2954719448 2954711539 Bacteria 10867210
231 2954729426 2954721474 Bacteria 10456478
232 2954732382 2954731030 Bacteria 10243860
233 2954748329 2954740390 Bacteria 10229294
234 2954751267 2954749733 Bacteria 10366972
235 2954767458 2954759201 Bacteria 9358192
236 8047716701 8047710418 Bacteria 11023148
237 8055180093 8055172936 Bacteria 9305943
238 8057571167 8057568493 Bacteria 7221719
239 Ga0209758_1003029
240 rootH2_10022985
241 Ga0070714_100060701
242 Ga0070713_100114456
243 Ga0070710_10105647
244 Ga0070711_100022925
245 Ga0070663_100238931
246 Ga0070706_100257596
247 Ga0068853_100385168
248 Ga0068855_100570390
249 Ga0068854_100175116
250 Ga0081539_10003624
251 Ga0070717_10287736
252 Ga0070715_10114658
253 Ga0075431_100002312
254 Ga0105239_10322559
255 Ga0157372_10074263
256 Ga0183367_1004
257 Ga0207426_1011027
258 Ga0207699_10029924
259 Ga0207693_10028827
260 Ga0207667_10499546
261 Ga0207639_10368784
262 Ga0307517_10073200
263 Ga0307515_10000106
264 Ga0307511_10000047
265 Ga0307512_10017821
266 Ga0307513_10090613
267 Ga0307513_10143698
268 Ga0307509_10023804
269 Ga0307509_10028295
270 Ga0307509_10033570
271 Ga0307508_10050741
272 Ga0307508_10095360
273 Ga0307516_10019055
274 Ga0307516_10179751
275 Ga0307518_10013726
276 Ga0307518_10099536
277 Ga0307518_10115701
278 Ga0307507_10006514
279 Ga0307507_10025613
280 Ga0307510_10012184
281 Ga0373923_0064080
282 Ga0373936_0132925
283 Ga0373935_0057554
284 Ga0373933_0095488
285 Ga0373933_0333985
286 Ga0373947_0084143
287 Ga0373937_0324008
288 Ga0373937_0490216
289 Ga0373925_0050259
290 Ga0395899_0207656
291 Ga0395900_0004598
292 Ga0395898_0000549
293 Ga0395898_0111484
294 Ga0395905_0000650
295 Ga0395901_0000238
296 Ga0439442_001342
297 Ga0439432_023960
298 Ga0439449_0018257
299 Ga0439455_0012836
300 Ga0450903_000592
301 Ga0439458_0001007
302 Ga0466961_0103941
303 Ga0466963_0074420
304 Ga0466970_0001569
305 Ga0466970_0120425
306 Ga0466967_0033235
307 Ga0495617_027098
308 Ga0495592_0029989
309 Ga0495592_0061271
310 Ga0495592_0068572
311 Ga0495603_0020257
312 Ga0495629_0006033
313 Ga0495629_0010308
314 Ga0495629_0056545
315 Ga0495629_0184267
316 Ga0495629_0332321
317 Ga0495629_0357408
318 Ga0495651_0005701
319 Ga0495651_0047527
320 Ga0495653_0073209
321 Ga0495582_0052661
322 Ga0495605_0006020
323 Ga0495662_0000548
324 Ga0495662_0011269
325 Ga0495664_0036873
326 Ga0495664_0042168
327 Ga0495664_0138882
328 Ga0495664_0157444
329 Ga0495585_0021325
330 Ga0495594_0015272
331 Ga0495607_0064117
332 Ga0495583_0004527
333 Ga0495583_0078677
334 Ga0495606_0019767
335 Ga0495608_0120922
336 Ga0495616_0004229
337 Ga0495618_0021842
338 Ga0495618_0196842
339 Ga0495620_0002363
340 Ga0495620_0040757
341 Ga0495628_0010747
342 Ga0495628_0024672
343 Ga0495628_0156831
344 Ga0495630_0216723
345 Ga0495643_0006164
346 Ga0495648_0030021
347 Ga0495648_0107103
348 Ga0495648_0123909
349 Ga0495642_0187404
350 Ga0495640_0002973
351 Ga0495640_0008725
352 Ga0495640_0319826
353 Ga0495587_0000343
354 Ga0495597_0037336
355 Ga0495597_0040544
356 Ga0495645_0024044
357 Ga0495645_0057570
358 Ga0495622_0011968
359 Ga0495622_0059668
360 Ga0495633_0028016
361 Ga0495667_0264257
362 Ga0495668_0015147
363 Ga0495668_0026694
364 Ga0495634_0001032
365 Ga0495634_0096388
366 Ga0495611_0099850
367 Ga0495625_0011354
368 Ga0495625_0029033
369 Ga0495625_0161139
370 Ga0495625_0254698
371 Ga0495635_0057016
372 Ga0495635_0064330
373 Ga0495635_0155527
374 Ga0495588_0076758
375 Ga0495588_0189212
376 Ga0495657_0003581
377 Ga0495657_0005098
378 Ga0495657_0014226
379 Ga0495657_0051318
380 Ga0495599_0145314
381 Ga0495646_0040858
382 Ga0495658_0096196
383 Ga0495613_0004807
384 Ga0495613_0006281
385 Ga0495613_0011050
386 Ga0495613_0020061
387 Ga0495613_0045359
388 Ga0495624_0038955
389 Ga0495671_0005049
390 Ga0495649_0061671
391 Ga0495649_0096350
392 Ga0495589_0003034
393 Ga0495589_0032293
394 Ga0495589_0044529
395 Ga0495589_0176492
396 Ga0495600_0025808
397 Ga0495660_0098450
398 Ga0495581_0007188
399 Ga0495581_0078365
400 Ga0495581_0115618
401 Ga0495604_0000271
402 Ga0495636_0046963
403 Ga0495636_0054842
404 Ga0495636_0181566
405 Ga0495674_0142333
406 Ga0495676_0005627
407 Ga0495676_0023088
408 Ga0495676_0050106
409 Ga0495680_0324652
410 Ga0495687_001075
411 Ga0495687_004322
412 Ga0495687_009468
413 Ga0495687_014479
414 Ga0495687_028503
415 Ga0495675_0093018
416 Ga0495685_000488
417 Ga0495685_005913
418 Ga0495685_012221
419 Ga0495685_016081
420 Ga0495685_020682
421 Ga0495681_0000719
422 Ga0495686_0037133
423 Ga0495686_0105770
424 Ga0495686_0109081
425 Ga0495593_0001017
426 Ga0495593_0010857
427 Ga0495593_0054170
428 Ga0495602_0107242
429 Ga0495614_0006801
430 Ga0495614_0014987
431 Ga0495614_0023093
432 Ga0496112_0011624
433 Ga0501033_0033950
434 Ga0501033_0059783
435 Ga0501034_0026654
436 Ga0501036_0044985
437 Ga0501036_0178644
438 Ga0501038_0033016
439 Ga0501039_0199172
440 Ga0501043_0116944
441 Ga0501043_0181359
442 Ga0501047_0267400
443 Ga0501070_0251058
444 Ga0501080_0055862
445 Ga0501035_0016367
446 Ga0501035_0067945
447 Ga0501044_0026126
448 Ga0501044_0035150
449 Ga0501044_0667588
450 Ga0501045_0364367
451 nmdc:mga09592_31454_c1
452 nmdc:mga0qj67_26663_c1
453 nmdc:mga06r32_114938_c1
454 Ga0500610_0056269
455 Ga0495655_0021197
456 Ga0495655_0065405
457 Ga0500640_004757
458 Ga0500624_003355
459 2552112262
460 2616699687
461 2644267239
462 2786675832
463 2808917246
464 2862582029
465 2899375739
466 2954691351
467 2954706544
468 2954719448
469 2954729426
470 2954732382
471 2954748329
472 2954751267
473 2954767458
474 8047716701
475 8055180093
476 8057571167

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

15

160

0.88

PF08659

KR

KR domain

16

160

0.87

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

21

161

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1n5d-assembly1.cif.gz_A crystal structure of porcine testicular carbonyl reductase/ 20beta-hydroxysteroid dehydrogenase 0.854 4 276
4z3d-assembly2.cif.gz_C human carbonyl reductase 1 with glutathione in a protective configuration 0.8525 5 270
5o98-assembly1.cif.gz_A binary complex of catharanthus roseus vitrosamine synthase with nadp+ 0.8347 4 270
5o98-assembly2.cif.gz_B binary complex of catharanthus roseus vitrosamine synthase with nadp+ 0.8273 4 270
4z3d-assembly2.cif.gz_C human carbonyl reductase 1 with glutathione in a protective configuration 0.8262 5 270
ID Description Score Start End Superfamily
af_Q0JBH4_12_100_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8914 5 91 3.40.50.720
af_A0A0P0WC51_15_133_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8638 1 93 3.40.50.720
1hu4A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8539 4 276 3.40.50.720
af_A0A0R0K1M2_5_134_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8523 3 125 3.40.50.720
af_Q0JBH4_12_100_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8366 5 91 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A550HCZ5-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9792 1 121 GO:0016491
AF-A0A6B1PCG6-F1-model_v4 deleted 0.9775 1 194
AF-A0A7K2MAF8-F1-model_v4 Carbonyl reductase 0.9741 1 70
AF-A0A4D4JR65-F1-model_v4 Oxidoreductase 0.9715 1 276 GO:0016491
AF-D7BWM9-F1-model_v4 Short-chain dehydrogenase/reductase SDR 0.9663 28 285 GO:0016491

Map