F350940

General Info

Members Datasets Scaffolds Average Seq Length
238 154 476 169

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10118720|Ga0157373_101187202
Length 192
Sequence MITYCTYQVQRNNFIKIYLFRMQNNPSLSIYDYNTWANTTILNHLKQLPNGTCNEIIKSVFPSIFDTLMHIYIIDRGWYSVLTKEYASDDYETIKKSVEKLIAQTKDNSLEEFEQKQNQLSKNFRNFIENNDMEIKDIFSSVSMKYVDIIQHIVNHGTYHRGNITAMLHQLGHPGVGTDYSLYLYHSNRIDS

Samples

Sample ID Description Type Environment
1 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
8 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
14 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
15 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
16 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
17 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
18 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
19 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
20 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
21 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
22 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
23 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
24 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
25 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
26 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
27 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
28 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
29 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
30 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
31 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
32 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
33 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
34 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
35 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
41 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
42 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
43 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
44 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
45 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
46 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
47 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
48 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
49 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
50 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
51 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
52 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
53 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
54 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
55 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
56 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
57 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
58 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
59 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
60 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
61 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
62 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
63 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
64 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
65 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
66 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
67 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
68 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
69 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
70 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
71 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
72 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
73 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
74 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
75 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
76 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
77 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
78 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
79 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
80 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
82 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
84 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
85 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
86 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
87 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
88 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
89 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
90 2643221731 Bacillus sp. Root147 Isolate Unclassified
91 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
92 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
93 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
94 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
95 2738541358 Bacillus sp. OV752 Isolate Unclassified
96 2738543006 Bacillus sp. OK077 Isolate Unclassified
97 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
98 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
99 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
100 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
101 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
102 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
103 2842682962 Bacillus sp. R-72492 Isolate Unclassified
104 2842882022 Bacillus sp. R-71893 Isolate Unclassified
105 2849139964 Bacillus sp. R-71875 Isolate Unclassified
106 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
107 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
108 2857581216 Bacillus sp. R-71922 Isolate Unclassified
109 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
110 2860837431 Bacillus sp. WR11 Isolate Unclassified
111 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
112 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
113 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
114 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
115 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
116 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
117 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
118 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
119 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
120 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
121 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
122 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
123 2919720352 Priestia megaterium 4340 Isolate Unclassified
124 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
125 2929004312 Priestia megaterium 1104 Isolate Unclassified
126 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
127 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
128 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
129 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
130 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
131 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
132 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
133 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
134 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
135 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
136 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
137 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
138 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
139 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
140 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
141 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
142 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
143 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
144 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
145 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
146 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
147 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
148 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
149 8022653035 Bacillus sp. Rc4 Isolate Unclassified
150 8022792930 Bacillus sp. Xin Isolate Rhizosphere
151 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
152 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
153 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
154 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 62.61
Metatranscriptomes 1.68
Isolates 35.71

Biome Distribution

Category Percentage (%)
Aerial Root 0.84
Bulb 0
Endosphere 11.34
Nodule 0
Rhizoplane 15.55
Rhizosphere 47.48
Stem 0
Stem Tuber 0
Unclassified 2.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157373_10118720 3300013100 Bacteria 1859
2 JGI25162J39368_1012178 3300002737 Bacteria 998
3 JGI25151J46595_10006579 3300003187 Bacteria 5818
4 JGI25151J46595_10017303 3300003187 Bacteria 3130
5 JGI25151J46595_10020431 3300003187 Bacteria 2792
6 JGI25151J46595_10028075 3300003187 Bacteria 2245
7 JGI25151J46595_10028153 3300003187 Bacteria 2241
8 rootL2_10022012 3300003322 Bacteria 6457
9 rootH1_10151921 3300003323 Bacteria 3365
10 Ga0006562J51391_1006219 3300003578 Bacteria 1111
11 Ga0006562J51391_1016826 3300003578 Bacteria 1150
12 Ga0055538_1000277 3300003751 Bacteria 26333
13 Ga0055538_1000823 3300003751 Bacteria 8204
14 Ga0055532_1007477 3300003758 Bacteria 1403
15 Ga0055528_1033205 3300003790 Bacteria 1298
16 Ga0065714_10003383 3300005288 Bacteria 24732
17 Ga0070687_100734747 3300005343 Unclassified 693
18 Ga0070665_100147027 3300005548 Bacteria 2360
19 Ga0070715_10679799 3300006163 Bacteria 612
20 Ga0075431_100194358 3300006847 Unclassified 2078
21 Ga0075429_100219174 3300006880 Unclassified 1667
22 Ga0105251_10007522 3300009011 Bacteria 6698
23 Ga0105251_10015232 3300009011 Bacteria 4214
24 Ga0105251_10081970 3300009011 Bacteria 1490
25 Ga0105244_10004560 3300009036 Bacteria 9487
26 Ga0105244_10017894 3300009036 Bacteria 3990
27 Ga0105244_10022940 3300009036 Bacteria 3430
28 Ga0105244_10034331 3300009036 Bacteria 2671
29 Ga0105244_10075171 3300009036 Bacteria 1679
30 Ga0105244_10214539 3300009036 Bacteria 904
31 Ga0105250_10001528 3300009092 Bacteria 12477
32 Ga0105250_10012060 3300009092 Bacteria 3578
33 Ga0105250_10026676 3300009092 Bacteria 2328
34 Ga0105250_10031115 3300009092 Bacteria 2143
35 Ga0105250_10080855 3300009092 Bacteria 1317
36 Ga0105243_10200617 3300009148 Bacteria 1749
37 Ga0105242_10689817 3300009176 Bacteria 998
38 Ga0105239_11213328 3300010375 Bacteria 869
39 Ga0105246_10085695 3300011119 Bacteria 2257
40 Ga0105246_10095551 3300011119 Bacteria 2152
41 Ga0105246_10382666 3300011119 Bacteria 1163
42 Ga0157374_10058941 3300013296 Bacteria 3588
43 Ga0157374_10136157 3300013296 Bacteria 2381
44 Ga0157378_10008748 3300013297 Bacteria 8814
45 Ga0157372_10672607 3300013307 Bacteria 1205
46 Ga0157377_10028848 3300014745 Bacteria 2990
47 Ga0209784_100220 3300025224 Bacteria 38974
48 Ga0209784_100329 3300025224 Bacteria 23985
49 Ga0209566_100336 3300025225 Bacteria 41560
50 Ga0209566_102521 3300025225 Bacteria 3337
51 Ga0209147_100501 3300025229 Bacteria 22867
52 Ga0209437_100630 3300025233 Bacteria 20910
53 Ga0209673_1025976 3300025273 Bacteria 1935
54 Ga0209673_1046788 3300025273 Bacteria 1178
55 Ga0209130_1025456 3300025284 Bacteria 1281
56 Ga0209025_1000634 3300025294 Bacteria 62166
57 Ga0209025_1000982 3300025294 Bacteria 42595
58 Ga0209025_1002379 3300025294 Bacteria 20123
59 Ga0209025_1019500 3300025294 Bacteria 3768
60 Ga0209025_1021594 3300025294 Bacteria 3460
61 Ga0209025_1023841 3300025294 Bacteria 3181
62 Ga0209025_1067533 3300025294 Bacteria 1291
63 Ga0207426_1028352 3300025302 Bacteria 1857
64 Ga0207696_1001788 3300025711 Bacteria 11099
65 Ga0207696_1004007 3300025711 Bacteria 6467
66 Ga0207696_1016057 3300025711 Bacteria 2517
67 Ga0207696_1018227 3300025711 Bacteria 2309
68 Ga0207655_1004429 3300025728 Bacteria 9961
69 Ga0207655_1023064 3300025728 Bacteria 3099
70 Ga0207655_1023691 3300025728 Bacteria 3035
71 Ga0207655_1037761 3300025728 Bacteria 2122
72 Ga0207713_1003678 3300025735 Bacteria 10315
73 Ga0207713_1006387 3300025735 Bacteria 7187
74 Ga0207713_1028125 3300025735 Bacteria 2541
75 Ga0207713_1046447 3300025735 Bacteria 1766
76 Ga0207713_1057967 3300025735 Bacteria 1494
77 Ga0207709_10335261 3300025935 Bacteria 1136
78 Ga0268266_10032901 3300028379 Unclassified 4407
79 Ga0307408_100050820 3300031548 Bacteria 2983
80 Ga0307410_10072991 3300031852 Bacteria 2385
81 Ga0307407_10000010 3300031903 Bacteria 186970
82 Ga0307412_11098411 3300031911 Unclassified 708
83 Ga0307409_100503870 3300031995 Bacteria 1180
84 Ga0307416_100000014 3300032002 Bacteria 249053
85 Ga0307414_10043134 3300032004 Bacteria 3070
86 Ga0307414_10609822 3300032004 Bacteria 980
87 Ga0307411_10333600 3300032005 Bacteria 1230
88 Ga0439445_0007694 3300042004 Bacteria 2506
89 Ga0439445_0109634 3300042004 Bacteria 787
90 Ga0495603_0004782 3300046455 Bacteria 8087
91 Ga0495603_0014508 3300046455 Bacteria 4766
92 Ga0495590_0040153 3300046457 Bacteria 1632
93 Ga0495585_0162441 3300046492 Bacteria 1158
94 Ga0495637_0124176 3300046520 Bacteria 991
95 Ga0495633_0192886 3300046558 Bacteria 936
96 Ga0495661_0147259 3300046665 Bacteria 1275
97 Ga0495683_0211895 3300047323 Bacteria 868
98 Ga0495681_0175088 3300047470 Bacteria 885
99 Ga0496100_0002622 3300048903 Bacteria 9168
100 Ga0496100_0008766 3300048903 Bacteria 5655
101 Ga0496101_0003123 3300048904 Bacteria 10241
102 Ga0496101_0023718 3300048904 Bacteria 4241
103 Ga0496101_0344880 3300048904 Bacteria 1170
104 Ga0496101_0470798 3300048904 Bacteria 992
105 Ga0496102_0004457 3300048905 Bacteria 11824
106 Ga0496102_0850315 3300048905 Bacteria 834
107 Ga0496102_0923976 3300048905 Bacteria 794
108 Ga0496103_0066400 3300048906 Bacteria 2251
109 Ga0496103_0654920 3300048906 Bacteria 667
110 Ga0496104_0026666 3300048907 Bacteria 5339
111 Ga0496104_0029280 3300048907 Bacteria 5107
112 Ga0496104_0150322 3300048907 Bacteria 2236
113 Ga0496104_0390017 3300048907 Bacteria 1305
114 Ga0496105_0031978 3300048908 Bacteria 4315
115 Ga0496105_0038626 3300048908 Bacteria 3933
116 Ga0496105_0076723 3300048908 Bacteria 2760
117 Ga0496106_0005283 3300048909 Bacteria 9569
118 Ga0496107_0129526 3300048910 Bacteria 1862
119 Ga0496107_0249545 3300048910 Bacteria 1320
120 Ga0496108_0027399 3300048911 Bacteria 4705
121 Ga0496108_0046566 3300048911 Bacteria 3623
122 Ga0496109_0017327 3300048912 Bacteria 6312
123 Ga0496109_0031308 3300048912 Bacteria 4773
124 Ga0496109_0379732 3300048912 Bacteria 1335
125 Ga0496110_0000067 3300048913 Bacteria 52165
126 Ga0496110_0001417 3300048913 Bacteria 17330
127 Ga0496110_0021372 3300048913 Bacteria 5477
128 Ga0496110_0081022 3300048913 Bacteria 2893
129 Ga0496111_0008811 3300048914 Bacteria 6701
130 Ga0496111_0012539 3300048914 Bacteria 5744
131 Ga0496111_0333930 3300048914 Bacteria 1122
132 Ga0496112_0021683 3300048915 Bacteria 6111
133 Ga0496112_0120310 3300048915 Bacteria 2596
134 Ga0496113_0740493 3300048916 Bacteria 783
135 Ga0496116_0086178 3300048919 Bacteria 1928
136 Ga0496117_0075699 3300048920 Bacteria 2235
137 Ga0496119_0012103 3300048922 Bacteria 7047
138 Ga0496119_0045306 3300048922 Bacteria 2759
139 Ga0496120_0084300 3300048923 Bacteria 1714
140 Ga0496120_0286748 3300048923 Bacteria 759
141 Ga0496121_0108072 3300048924 Bacteria 2129
142 Ga0496121_0130202 3300048924 Bacteria 1885
143 Ga0496121_0284792 3300048924 Bacteria 1129
144 Ga0496122_0008559 3300048925 Bacteria 11004
145 Ga0496122_0009829 3300048925 Bacteria 9983
146 Ga0496123_0183143 3300048926 Bacteria 1092
147 Ga0496125_0012915 3300048928 Bacteria 8246
148 Ga0496125_0013357 3300048928 Bacteria 8080
149 Ga0496126_0050835 3300048929 Bacteria 3776
150 Ga0496126_0150516 3300048929 Bacteria 1995
151 Ga0501305_058119 3300049161 Bacteria 661
152 nmdc:mga09592_264652_c1 3300050508 Unclassified 1491
153 Ga0587106_031767 3300059605 Bacteria 851
154 2524189615 2524023129 Bacteria 6762600
155 2540606220 2540341094 Bacteria 4061186
156 2571528891 2571042143 Bacteria 6986194
157 2587744305 2585428059 Bacteria 8696589
158 2601638694 2600255286 Bacteria 5390125
159 2643737044 2643221543 Bacteria 6628015
160 2644423728 2643221676 Bacteria 8119172
161 2644716585 2643221731 Bacteria 5623886
162 2672335504 2671180330 Bacteria 5521719
163 2672338029 2671180330 Bacteria 5521719
164 2698325734 2695420987 Bacteria 6152737
165 2705994230 2703719227 Bacteria 5631989
166 2728531851 2728368933 Bacteria 7044283
167 2739159092 2738541358 Bacteria 5932299
168 2739211751 2738543006 Bacteria 5904091
169 2745168332 2744054657 Bacteria 5016802
170 2809054426 2808606399 Bacteria 4021018
171 2816861704 2816332186 Bacteria 5331395
172 2816865123 2816332186 Bacteria 5331395
173 2817480334 2816332295 Bacteria 4352468
174 2819707672 2818991465 Bacteria 5388835
175 2821112949 2821111986 Bacteria 6894338
176 2842683991 2842682962 Bacteria 5589973
177 2842688326 2842682962 Bacteria 5589973
178 2842883645 2842882022 Bacteria 6158489
179 2849144443 2849139964 Bacteria 5613304
180 2849145250 2849139964 Bacteria 5613304
181 2852628694 2852627209 Bacteria 5896285
182 2857472300 2857465823 Bacteria 6772595
183 2857582033 2857581216 Bacteria 5522813
184 2857586648 2857581216 Bacteria 5522813
185 2857597736 2857591370 Bacteria 6569758
186 2860838599 2860837431 Bacteria 4202080
187 2881649655 2881644220 Bacteria 5302661
188 2885533038 2885526491 Bacteria 7164189
189 2889043730 2889042446 Bacteria 7618936
190 2898910896 2898907183 Bacteria 4067722
191 2904113808 2904113452 Bacteria 7796941
192 2904162430 2904162308 Bacteria 7086713
193 2904495074 2904490793 Bacteria 7046938
194 2904525334 2904524088 Bacteria 5887454
195 2904528966 2904524088 Bacteria 5887454
196 2919146085 2919143609 Bacteria 6219228
197 2919150104 2919143609 Bacteria 6219228
198 2919163725 2919160200 Bacteria 6929020
199 2919418872 2919414237 Bacteria 5429133
200 2919518009 2919517244 Bacteria 5858162
201 2919522345 2919517244 Bacteria 5858162
202 2919722379 2919720352 Bacteria 5986006
203 2919726386 2919720352 Bacteria 5986006
204 2928097075 2928093941 Bacteria 5965005
205 2928099659 2928093941 Bacteria 5965005
206 2929009738 2929004312 Bacteria 5678476
207 2929211749 2929206907 Bacteria 5918291
208 2931387192 2931384279 Bacteria 7299545
209 2936366579 2936361878 Bacteria 5632809
210 2938650547 2938649242 Bacteria 7118381
211 2939706300 2939702853 Bacteria 5139229
212 2945994220 2945991243 Bacteria 7008369
213 2946056983 2946053406 Bacteria 6978655
214 2960378803 2960375949 Bacteria 5361395
215 2962291961 2962290636 Bacteria 4072939
216 2968559896 2968558590 Bacteria 6956864
217 2969137474 2969136845 Bacteria 3923176
218 2969138004 2969136845 Bacteria 3923176
219 2969768211 2969765954 Bacteria 4216713
220 2969771788 2969770375 Bacteria 4271280
221 2971409191 2971403814 Bacteria 7370929
222 2979089739 2979083700 Bacteria 5894929
223 2980493781 2980492589 Bacteria 4072961
224 2984529656 2984527788 Bacteria 5288478
225 2984535763 2984532647 Bacteria 5288506
226 2988228154 2988225383 Bacteria 7221625
227 2996633858 2996632988 Bacteria 6921523
228 3006860679 3006858327 Bacteria 4317835
229 3006880241 3006879489 Bacteria 4064221
230 3006881169 3006879489 Bacteria 4064221
231 3006983536 3006978542 Bacteria 5328100
232 8022655171 8022653035 Bacteria 4035078
233 8022793303 8022792930 Bacteria 5693794
234 8022952235 8022948649 Bacteria 5366783
235 8022953589 8022948649 Bacteria 5366783
236 8055634236 8055632911 Bacteria 5283357
237 8057588107 8057582654 Bacteria 5218944
238 8057739259 8057733483 Bacteria 6578323
239 Ga0157373_10118720
240 JGI25162J39368_1012178
241 JGI25151J46595_10006579
242 JGI25151J46595_10017303
243 JGI25151J46595_10020431
244 JGI25151J46595_10028075
245 JGI25151J46595_10028153
246 rootL2_10022012
247 rootH1_10151921
248 Ga0006562J51391_1006219
249 Ga0006562J51391_1016826
250 Ga0055538_1000277
251 Ga0055538_1000823
252 Ga0055532_1007477
253 Ga0055528_1033205
254 Ga0065714_10003383
255 Ga0070687_100734747
256 Ga0070665_100147027
257 Ga0070715_10679799
258 Ga0075431_100194358
259 Ga0075429_100219174
260 Ga0105251_10007522
261 Ga0105251_10015232
262 Ga0105251_10081970
263 Ga0105244_10004560
264 Ga0105244_10017894
265 Ga0105244_10022940
266 Ga0105244_10034331
267 Ga0105244_10075171
268 Ga0105244_10214539
269 Ga0105250_10001528
270 Ga0105250_10012060
271 Ga0105250_10026676
272 Ga0105250_10031115
273 Ga0105250_10080855
274 Ga0105243_10200617
275 Ga0105242_10689817
276 Ga0105239_11213328
277 Ga0105246_10085695
278 Ga0105246_10095551
279 Ga0105246_10382666
280 Ga0157374_10058941
281 Ga0157374_10136157
282 Ga0157378_10008748
283 Ga0157372_10672607
284 Ga0157377_10028848
285 Ga0209784_100220
286 Ga0209784_100329
287 Ga0209566_100336
288 Ga0209566_102521
289 Ga0209147_100501
290 Ga0209437_100630
291 Ga0209673_1025976
292 Ga0209673_1046788
293 Ga0209130_1025456
294 Ga0209025_1000634
295 Ga0209025_1000982
296 Ga0209025_1002379
297 Ga0209025_1019500
298 Ga0209025_1021594
299 Ga0209025_1023841
300 Ga0209025_1067533
301 Ga0207426_1028352
302 Ga0207696_1001788
303 Ga0207696_1004007
304 Ga0207696_1016057
305 Ga0207696_1018227
306 Ga0207655_1004429
307 Ga0207655_1023064
308 Ga0207655_1023691
309 Ga0207655_1037761
310 Ga0207713_1003678
311 Ga0207713_1006387
312 Ga0207713_1028125
313 Ga0207713_1046447
314 Ga0207713_1057967
315 Ga0207709_10335261
316 Ga0268266_10032901
317 Ga0307408_100050820
318 Ga0307410_10072991
319 Ga0307407_10000010
320 Ga0307412_11098411
321 Ga0307409_100503870
322 Ga0307416_100000014
323 Ga0307414_10043134
324 Ga0307414_10609822
325 Ga0307411_10333600
326 Ga0439445_0007694
327 Ga0439445_0109634
328 Ga0495603_0004782
329 Ga0495603_0014508
330 Ga0495590_0040153
331 Ga0495585_0162441
332 Ga0495637_0124176
333 Ga0495633_0192886
334 Ga0495661_0147259
335 Ga0495683_0211895
336 Ga0495681_0175088
337 Ga0496100_0002622
338 Ga0496100_0008766
339 Ga0496101_0003123
340 Ga0496101_0023718
341 Ga0496101_0344880
342 Ga0496101_0470798
343 Ga0496102_0004457
344 Ga0496102_0850315
345 Ga0496102_0923976
346 Ga0496103_0066400
347 Ga0496103_0654920
348 Ga0496104_0026666
349 Ga0496104_0029280
350 Ga0496104_0150322
351 Ga0496104_0390017
352 Ga0496105_0031978
353 Ga0496105_0038626
354 Ga0496105_0076723
355 Ga0496106_0005283
356 Ga0496107_0129526
357 Ga0496107_0249545
358 Ga0496108_0027399
359 Ga0496108_0046566
360 Ga0496109_0017327
361 Ga0496109_0031308
362 Ga0496109_0379732
363 Ga0496110_0000067
364 Ga0496110_0001417
365 Ga0496110_0021372
366 Ga0496110_0081022
367 Ga0496111_0008811
368 Ga0496111_0012539
369 Ga0496111_0333930
370 Ga0496112_0021683
371 Ga0496112_0120310
372 Ga0496113_0740493
373 Ga0496116_0086178
374 Ga0496117_0075699
375 Ga0496119_0012103
376 Ga0496119_0045306
377 Ga0496120_0084300
378 Ga0496120_0286748
379 Ga0496121_0108072
380 Ga0496121_0130202
381 Ga0496121_0284792
382 Ga0496122_0008559
383 Ga0496122_0009829
384 Ga0496123_0183143
385 Ga0496125_0012915
386 Ga0496125_0013357
387 Ga0496126_0050835
388 Ga0496126_0150516
389 Ga0501305_058119
390 nmdc:mga09592_264652_c1
391 Ga0587106_031767
392 2524189615
393 2540606220
394 2571528891
395 2587744305
396 2601638694
397 2643737044
398 2644423728
399 2644716585
400 2672335504
401 2672338029
402 2698325734
403 2705994230
404 2728531851
405 2739159092
406 2739211751
407 2745168332
408 2809054426
409 2816861704
410 2816865123
411 2817480334
412 2819707672
413 2821112949
414 2842683991
415 2842688326
416 2842883645
417 2849144443
418 2849145250
419 2852628694
420 2857472300
421 2857582033
422 2857586648
423 2857597736
424 2860838599
425 2881649655
426 2885533038
427 2889043730
428 2898910896
429 2904113808
430 2904162430
431 2904495074
432 2904525334
433 2904528966
434 2919146085
435 2919150104
436 2919163725
437 2919418872
438 2919518009
439 2919522345
440 2919722379
441 2919726386
442 2928097075
443 2928099659
444 2929009738
445 2929211749
446 2931387192
447 2936366579
448 2938650547
449 2939706300
450 2945994220
451 2946056983
452 2960378803
453 2962291961
454 2968559896
455 2969137474
456 2969138004
457 2969768211
458 2969771788
459 2971409191
460 2979089739
461 2980493781
462 2984529656
463 2984535763
464 2988228154
465 2996633858
466 3006860679
467 3006880241
468 3006881169
469 3006983536
470 8022655171
471 8022793303
472 8022952235
473 8022953589
474 8055634236
475 8057588107
476 8057739259

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05163

DinB

DinB family

22

190

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qe9-assembly1.cif.gz_A crystal structure of a putative metal-dependent hydrolase (yiza, bsu10800) from bacillus subtilis at 1.90 a resolution 0.8006 3 157
2qe9-assembly1.cif.gz_B crystal structure of a putative metal-dependent hydrolase (yiza, bsu10800) from bacillus subtilis at 1.90 a resolution 0.7995 3 157
3di5-assembly1.cif.gz_A crystal structure of a dinb-like protein (bce_4655) from bacillus cereus atcc 10987 at 2.01 a resolution 0.7957 4 155
2hkv-assembly1.cif.gz_A-2 crystal structure of a putative member of the dinb family (exig_1237) from exiguobacterium sibiricum 255-15 at 1.70 a resolution 0.7942 1 155
2p1a-assembly1.cif.gz_A crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution 0.7806 5 146
ID Description Score Start End Superfamily
2qe9B01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.786 1 157 1.20.120.450
2yqyB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7697 5 141 1.20.120.450
2qe9B01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7596 1 157 1.20.120.450
3di5A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7583 1 155 1.20.120.450
af_Q54LV3_100_235_3.30.479.20 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Elongation factor Ts, dimerisation domain 0.7505 106 134 3.30.479.20
ID Description Score Start End GO Terms
AF-A0A268I046-F1-model_v4 deleted 0.9787 1 164
AF-A0A7X4YMZ5-F1-model_v4 DUF664 domain-containing protein 0.9678 1 165
AF-A0A268I046-F1-model_v4 deleted 0.967 1 164
AF-A0A1H9CB03-F1-model_v4 Uncharacterized damage-inducible protein DinB (Forms a four-helix bundle) 0.9609 1 163
AF-A0A3E0JJ08-F1-model_v4 deleted 0.9587 3 165

Map