F350874

General Info

Members Datasets Scaffolds Average Seq Length
238 174 238 172

Family's Representative Sequence

Representative Sequence 3300007076|Ga0075435_100177867|Ga0075435_1001778672
Length 193
Sequence MAETPQAPAPKKGSLLKKILIGFVVVVLVFVGIVALQPNEFKVTRSATMGAPAATVFDQVNDFHKWEAWSPWEKLDPSMKRTFEGSSSGNGAIYSWVGNDKVGEGKMTLTESKPGELIKIRLDFVKPFEDTCNVEFAFKPEGDKTSVTWSMAGQNNFMKKAICMFMNMDKMVGGDFEKGLAQMKAVAEAPPKK

Samples

Sample ID Description Type Environment
1 2928963466 Dyella japonica 1073 Isolate Unclassified
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
11 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
78 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
83 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
85 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
86 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
88 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
89 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
119 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
120 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
121 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
122 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
123 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
124 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
125 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
126 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
127 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
132 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
133 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
134 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
135 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
136 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
137 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
138 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
139 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
140 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
141 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
142 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
143 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
144 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
150 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
151 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
152 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
153 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
156 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
157 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
158 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
159 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
160 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
161 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
162 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
163 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
164 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
165 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
166 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
169 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
170 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
171 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
172 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
173 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
174 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0
Isolates 0.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.18
Nodule 0
Rhizoplane 2.1
Rhizosphere 78.57
Stem 0
Stem Tuber 0
Unclassified 7.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10059762 3300002067 Bacteria 1096
2 JGI24735J21928_10068098 3300002067 Bacteria 1021
3 JGI25156J39149_1005189 3300002705 Bacteria 3818
4 JGI25162J39368_1002969 3300002737 Bacteria 5655
5 JGI25157J39369_1002089 3300002741 Bacteria 5662
6 JGI25157J39369_1012575 3300002741 Bacteria 1075
7 JGI25163J39215_1001557 3300002771 Bacteria 3517
8 JGI25164J39214_1001416 3300002772 Bacteria 5662
9 JGI25165J46597_1001360 3300003214 Bacteria 13586
10 rootH1_10001854 3300003316 Bacteria 36865
11 rootH1_10001854 3300003323 Bacteria 9155
12 rootH1_10024926 3300003323 Bacteria 30664
13 Ga0055538_1001925 3300003751 Bacteria 3430
14 Ga0055533_1002013 3300003756 Bacteria 4946
15 Ga0055535_1001285 3300003761 Bacteria 13586
16 Ga0055542_1000617 3300003762 Bacteria 30217
17 Ga0055542_1001276 3300003762 Bacteria 13586
18 Ga0055529_1001007 3300003763 Bacteria 13586
19 JGI25405J52794_10073438 3300003911 Bacteria 748
20 Ga0070689_100002103 3300005340 Bacteria 12935
21 Ga0070691_10500257 3300005341 Bacteria 702
22 Ga0070692_10092233 3300005345 Bacteria 1648
23 Ga0070688_100198169 3300005365 Bacteria 1403
24 Ga0070667_100292901 3300005367 Bacteria 1464
25 Ga0070703_10002159 3300005406 Bacteria 5722
26 Ga0070703_10066414 3300005406 Bacteria 1193
27 Ga0070705_101018308 3300005440 Bacteria 673
28 Ga0070700_100000857 3300005441 Bacteria 15010
29 Ga0070694_100014539 3300005444 Bacteria 4927
30 Ga0070708_100636240 3300005445 Unclassified 1005
31 Ga0070663_100027435 3300005455 Bacteria 3868
32 Ga0070663_100369829 3300005455 Bacteria 1165
33 Ga0070681_10045022 3300005458 Bacteria 4417
34 Ga0070681_11107278 3300005458 Unclassified 713
35 Ga0068867_100032948 3300005459 Bacteria 3749
36 Ga0070707_100078510 3300005468 Bacteria 3185
37 Ga0070699_100286977 3300005518 Bacteria 1475
38 Ga0070697_100144232 3300005536 Bacteria 2003
39 Ga0070697_100717521 3300005536 Bacteria 883
40 Ga0068853_100865908 3300005539 Bacteria 867
41 Ga0070686_100054924 3300005544 Unclassified 2549
42 Ga0070696_100422362 3300005546 Bacteria 1047
43 Ga0070704_100441771 3300005549 Bacteria 1118
44 Ga0068855_100105574 3300005563 Bacteria 3238
45 Ga0068857_100071793 3300005577 Bacteria 3085
46 Ga0068859_100191534 3300005617 Bacteria 2129
47 Ga0068858_100058365 3300005842 Unclassified 3568
48 Ga0068858_100385944 3300005842 Bacteria 1344
49 Ga0068860_100145826 3300005843 Bacteria 2278
50 Ga0068862_100088216 3300005844 Bacteria 2699
51 Ga0068862_100476052 3300005844 Unclassified 1181
52 Ga0081455_10003119 3300005937 Bacteria 19301
53 Ga0070717_10008953 3300006028 Bacteria 7503
54 Ga0075432_10221491 3300006058 Unclassified 757
55 Ga0075362_10112846 3300006177 Bacteria 1281
56 Ga0075430_100440156 3300006846 Unclassified 1076
57 Ga0075431_100000085 3300006847 Bacteria 56381
58 Ga0075431_100209028 3300006847 Bacteria 1994
59 Ga0075433_10040245 3300006852 Bacteria 4045
60 Ga0075433_10379298 3300006852 Bacteria 1248
61 Ga0075434_100006382 3300006871 Bacteria 10809
62 Ga0075434_100036222 3300006871 Bacteria 4881
63 Ga0075429_100021653 3300006880 Bacteria 5573
64 Ga0075429_100119996 3300006880 Bacteria 2298
65 Ga0075429_100156356 3300006880 Bacteria 1996
66 Ga0075429_100221541 3300006880 Bacteria 1657
67 Ga0075436_100000016 3300006914 Bacteria 167300
68 Ga0097620_100191530 3300006931 Bacteria 2129
69 Ga0075435_100000971 3300007076 Bacteria 18123
70 Ga0075435_100028232 3300007076 Bacteria 4399
71 Ga0075435_100177867 3300007076 Bacteria 1797
72 Ga0105250_10190195 3300009092 Unclassified 864
73 Ga0105240_10282788 3300009093 Bacteria 1905
74 Ga0105240_10299366 3300009093 Bacteria 1840
75 Ga0111539_10001828 3300009094 Bacteria 28325
76 Ga0111539_10024126 3300009094 Bacteria 7469
77 Ga0111539_10054153 3300009094 Bacteria 4774
78 Ga0111539_10103827 3300009094 Bacteria 3335
79 Ga0105247_10040419 3300009101 Bacteria 2851
80 Ga0114129_10003362 3300009147 Bacteria 22463
81 Ga0114129_10131752 3300009147 Bacteria 3433
82 Ga0114129_10140581 3300009147 Bacteria 3310
83 Ga0105243_10512938 3300009148 Bacteria 1138
84 Ga0105241_10078060 3300009174 Bacteria 2586
85 Ga0105242_11977456 3300009176 Bacteria 625
86 Ga0105237_11053838 3300009545 Bacteria 820
87 Ga0105238_10040403 3300009551 Bacteria 4727
88 Ga0105249_11238642 3300009553 Bacteria 817
89 Ga0105239_10387552 3300010375 Bacteria 1580
90 Ga0157371_10280797 3300013102 Bacteria 1203
91 Ga0157369_10091381 3300013105 Bacteria 3250
92 Ga0157378_10248504 3300013297 Bacteria 1702
93 Ga0163162_10036385 3300013306 Unclassified 4906
94 Ga0163162_10383922 3300013306 Bacteria 1538
95 Ga0157372_10202314 3300013307 Bacteria 2301
96 Ga0163163_10043989 3300014325 Bacteria 4380
97 Ga0182008_10062314 3300014497 Bacteria 1838
98 Ga0157379_10355350 3300014968 Unclassified 1342
99 Ga0157376_10360245 3300014969 Unclassified 1394
100 Ga0183368_1007 3300015687 Bacteria 405609
101 Ga0163161_10008648 3300017792 Bacteria 7039
102 Ga0209435_102013 3300025206 Bacteria 2445
103 Ga0209435_112604 3300025206 Bacteria 904
104 Ga0209760_100637 3300025207 Bacteria 5865
105 Ga0209784_100043 3300025224 Bacteria 217823
106 Ga0209674_100037 3300025226 Bacteria 404339
107 Ga0207427_100087 3300025231 Bacteria 140098
108 Ga0207427_102975 3300025231 Bacteria 3954
109 Ga0209437_100173 3300025233 Bacteria 140098
110 Ga0209437_100427 3300025233 Bacteria 37177
111 Ga0209258_100092 3300025242 Bacteria 226544
112 Ga0209258_100584 3300025242 Bacteria 30530
113 Ga0209258_107314 3300025242 Bacteria 1649
114 Ga0209646_1000681 3300025246 Bacteria 12341
115 Ga0209026_1000112 3300025250 Bacteria 140098
116 Ga0209026_1001781 3300025250 Bacteria 8907
117 Ga0209148_1000047 3300025254 Bacteria 434369
118 Ga0209148_1000055 3300025254 Bacteria 367500
119 Ga0209759_1001421 3300025256 Bacteria 13612
120 Ga0209233_1000179 3300025261 Bacteria 140518
121 Ga0209233_1025311 3300025261 Bacteria 1470
122 Ga0209455_1000056 3300025272 Bacteria 349821
123 Ga0207653_10000118 3300025885 Bacteria 55787
124 Ga0207710_10054726 3300025900 Bacteria 1798
125 Ga0207685_10155469 3300025905 Bacteria 1039
126 Ga0207707_10034495 3300025912 Bacteria 4427
127 Ga0207707_10585164 3300025912 Unclassified 946
128 Ga0207695_10234016 3300025913 Bacteria 1740
129 Ga0207657_10321510 3300025919 Unclassified 1223
130 Ga0207649_10128295 3300025920 Bacteria 1719
131 Ga0207646_10070585 3300025922 Bacteria 3120
132 Ga0207681_10325436 3300025923 Bacteria 1224
133 Ga0207709_10372388 3300025935 Bacteria 1084
134 Ga0207670_10004305 3300025936 Bacteria 7642
135 Ga0207667_10463981 3300025949 Bacteria 1286
136 Ga0207667_10811034 3300025949 Unclassified 932
137 Ga0207668_10288042 3300025972 Bacteria 1350
138 Ga0207668_11003768 3300025972 Unclassified 746
139 Ga0207658_10355192 3300025986 Bacteria 1277
140 Ga0207703_10358818 3300026035 Bacteria 1344
141 Ga0207678_10041589 3300026067 Bacteria 3985
142 Ga0207678_10088181 3300026067 Bacteria 2652
143 Ga0207708_10003751 3300026075 Bacteria 11198
144 Ga0207641_10678768 3300026088 Bacteria 1013
145 Ga0207648_10021618 3300026089 Bacteria 5782
146 Ga0207676_10262477 3300026095 Unclassified 1560
147 Ga0207674_10015550 3300026116 Bacteria 8358
148 Ga0207428_10000013 3300027907 Bacteria 346742
149 Ga0207428_10037194 3300027907 Bacteria 3962
150 Ga0207428_10262713 3300027907 Bacteria 1285
151 Ga0268265_10107122 3300028380 Bacteria 2272
152 Ga0268265_10406546 3300028380 Unclassified 1260
153 Ga0268265_11051780 3300028380 Bacteria 806
154 Ga0268264_10147380 3300028381 Bacteria 2106
155 Ga0268264_10384160 3300028381 Bacteria 1345
156 Ga0307513_10149539 3300031456 Bacteria 2247
157 Ga0265314_10006733 3300031711 Bacteria 10089
158 Ga0307413_10965696 3300031824 Bacteria 728
159 Ga0307416_100616474 3300032002 Bacteria 1167
160 Ga0307414_10201511 3300032004 Bacteria 1619
161 Ga0373950_0015680 3300034818 Bacteria 1288
162 Ga0373940_0003892 3300035088 Bacteria 3102
163 Ga0373940_0009228 3300035088 Bacteria 2288
164 Ga0373949_0043149 3300035090 Bacteria 1115
165 Ga0373951_0055977 3300035091 Bacteria 979
166 Ga0373932_0186596 3300035112 Unclassified 730
167 Ga0373939_0022456 3300035114 Bacteria 1739
168 Ga0373941_0046353 3300035115 Bacteria 1365
169 Ga0373962_0003263 3300035242 Bacteria 3904
170 Ga0373931_0008091 3300035691 Bacteria 4979
171 Ga0373931_0085199 3300035691 Bacteria 1751
172 Ga0395900_0116564 3300037418 Bacteria 2741
173 Ga0395905_0293822 3300037471 Bacteria 1512
174 Ga0451576_0023514 3300045051 Bacteria 6672
175 Ga0451576_0061086 3300045051 Bacteria 3930
176 Ga0495638_0001562 3300046460 Bacteria 20538
177 Ga0495638_0001917 3300046460 Bacteria 17910
178 Ga0495650_0000092 3300046471 Bacteria 224681
179 Ga0495580_0005148 3300046472 Bacteria 10877
180 Ga0495628_0026044 3300046516 Bacteria 4775
181 Ga0495645_0214461 3300046543 Bacteria 1298
182 Ga0495622_0001100 3300046557 Bacteria 14136
183 Ga0495667_0331240 3300046559 Unclassified 963
184 Ga0495625_0006558 3300046660 Bacteria 10335
185 Ga0495625_0015130 3300046660 Bacteria 6124
186 Ga0495613_0358759 3300046689 Unclassified 1000
187 Ga0495649_0237280 3300046694 Bacteria 939
188 Ga0495649_0298235 3300046694 Bacteria 821
189 Ga0495600_0163792 3300046809 Bacteria 1437
190 Ga0495636_0488891 3300047318 Bacteria 594
191 Ga0495674_0896160 3300047319 Unclassified 685
192 Ga0495680_0717406 3300047322 Unclassified 659
193 Ga0496104_0627693 3300048907 Bacteria 984
194 Ga0496113_0211433 3300048916 Bacteria 1544
195 Ga0496114_0268449 3300048917 Bacteria 1503
196 Ga0496115_0000194 3300048918 Bacteria 56623
197 Ga0496115_0001179 3300048918 Bacteria 18754
198 Ga0496121_0029638 3300048924 Bacteria 5052
199 Ga0496122_0196109 3300048925 Bacteria 1186
200 Ga0496126_0065149 3300048929 Bacteria 3261
201 Ga0496126_0068786 3300048929 Bacteria 3160
202 Ga0495678_041549 3300049459 Bacteria 1839
203 Ga0501039_0853189 3300049575 Unclassified 710
204 Ga0501046_0414144 3300049580 Bacteria 972
205 Ga0501072_0038664 3300049588 Bacteria 3745
206 Ga0501075_0615453 3300049591 Bacteria 828
207 Ga0501076_0074086 3300049592 Bacteria 2727
208 Ga0501077_0024138 3300049593 Bacteria 3860
209 Ga0501079_0561428 3300049741 Bacteria 898
210 Ga0501079_1213857 3300049741 Bacteria 594
211 Ga0501080_0828162 3300049742 Bacteria 810
212 Ga0501045_0052077 3300049824 Bacteria 2988
213 nmdc:mga05p37_1893_c1 3300050507 Bacteria 24382
214 nmdc:mga05p37_21004_c1 3300050507 Bacteria 7903
215 nmdc:mga05p37_537939_c1 3300050507 Bacteria 1333
216 nmdc:mga05p37_54023_c1 3300050507 Bacteria 4942
217 nmdc:mga09592_131996_c1 3300050508 Bacteria 2150
218 nmdc:mga09592_376384_c1 3300050508 Bacteria 1228
219 nmdc:mga09592_896486_c1 3300050508 Bacteria 746
220 nmdc:mga0qj67_295627_c1 3300050509 Bacteria 1312
221 nmdc:mga0qj67_563_c1 3300050509 Bacteria 25259
222 nmdc:mga06r32_166195_c1 3300050510 Bacteria 2190
223 nmdc:mga06r32_88506_c1 3300050510 Bacteria 3023
224 nmdc:mga08y16_14898_c1 3300050511 Bacteria 8179
225 nmdc:mga08y16_15153_c1 3300050511 Bacteria 8105
226 nmdc:mga08y16_33306_c1 3300050511 Bacteria 5411
227 nmdc:mga08y16_59895_c1 3300050511 Bacteria 3977
228 nmdc:mga0n895_3988_c1 3300050512 Bacteria 11999
229 nmdc:mga0n895_86197_c1 3300050512 Bacteria 3137
230 nmdc:mga0rr50_440_c1 3300050513 Bacteria 22331
231 nmdc:mga0rr50_588005_c1 3300050513 Bacteria 949
232 nmdc:mga08x19_8_c1 3300050514 Bacteria 427794
233 nmdc:mga0a205_130471_c1 3300050515 Bacteria 2414
234 nmdc:mga0a205_522634_c1 3300050515 Bacteria 1043
235 Ga0495612_0022155 3300053078 Unclassified 2547
236 Ga0500562_000057 3300053108 Bacteria 55897
237 Ga0500658_0227368 3300053134 Bacteria 856
238 Ga0500604_0254018 3300053151 Unclassified 608

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025972 Ga0207668_11003768 Ga0207668_110037682 154
2 3300034818 Ga0373950_0015680 Ga0373950_0015680_101_652 158
3 3300035088 Ga0373940_0003892 Ga0373940_0003892_614_1165 158
4 3300045051 Ga0451576_0061086 Ga0451576_0061086_1530_2081 158
5 3300006852 Ga0075433_10040245 Ga0075433_100402455 159
6 3300006871 Ga0075434_100036222 Ga0075434_1000362223 159
7 3300007076 Ga0075435_100028232 Ga0075435_1000282325 159
8 3300009176 Ga0105242_11977456 Ga0105242_119774561 159
9 3300009553 Ga0105249_11238642 Ga0105249_112386422 159
10 3300017792 Ga0163161_10008648 Ga0163161_100086489 159
11 3300049741 Ga0501079_0561428 Ga0501079_0561428_220_759 159
12 3300050512 nmdc:mga0n895_86197_c1 nmdc:mga0n895_86197_c1_1177_1728 159
13 3300050515 nmdc:mga0a205_130471_c1 nmdc:mga0a205_130471_c1_941_1492 159
14 3300002741 JGI25157J39369_1012575 JGI25157J39369_10125752 160
15 3300005518 Ga0070699_100286977 Ga0070699_1002869771 160
16 3300005536 Ga0070697_100144232 Ga0070697_1001442323 160
17 3300005563 Ga0068855_100105574 Ga0068855_1001055745 160
18 3300009148 Ga0105243_10512938 Ga0105243_105129381 160
19 3300025250 Ga0209026_1001781 Ga0209026_10017817 160
20 3300025935 Ga0207709_10372388 Ga0207709_103723881 160
21 3300025949 Ga0207667_10811034 Ga0207667_108110341 160
22 3300026067 Ga0207678_10088181 Ga0207678_100881812 160
23 3300046460 Ga0495638_0001562 Ga0495638_0001562_12760_13290 160
24 3300046460 Ga0495638_0001917 Ga0495638_0001917_10623_11153 160
25 3300046471 Ga0495650_0000092 Ga0495650_0000092_156321_156851 160
26 3300046660 Ga0495625_0015130 Ga0495625_0015130_1479_2009 160
27 3300046694 Ga0495649_0237280 Ga0495649_0237280_78_608 160
28 3300048918 Ga0496115_0001179 Ga0496115_0001179_7065_7595 160
29 3300048929 Ga0496126_0065149 Ga0496126_0065149_1570_2100 160
30 3300048929 Ga0496126_0068786 Ga0496126_0068786_1163_1693 160
31 3300049459 Ga0495678_041549 Ga0495678_041549_845_1375 160
32 3300003323 rootH1_10024926 rootH1_100249263 161
33 3300003762 Ga0055542_1000617 Ga0055542_100061715 161
34 3300005340 Ga0070689_100002103 Ga0070689_1000021036 161
35 3300005365 Ga0070688_100198169 Ga0070688_1001981691 161
36 3300005367 Ga0070667_100292901 Ga0070667_1002929012 161
37 3300005440 Ga0070705_101018308 Ga0070705_1010183081 161
38 3300005445 Ga0070708_100636240 Ga0070708_1006362402 161
39 3300005455 Ga0070663_100027435 Ga0070663_1000274352 161
40 3300005536 Ga0070697_100717521 Ga0070697_1007175211 161
41 3300005843 Ga0068860_100145826 Ga0068860_1001458261 161
42 3300005844 Ga0068862_100088216 Ga0068862_1000882162 161
43 3300009093 Ga0105240_10282788 Ga0105240_102827883 161
44 3300009551 Ga0105238_10040403 Ga0105238_100404033 161
45 3300013306 Ga0163162_10383922 Ga0163162_103839221 161
46 3300014497 Ga0182008_10062314 Ga0182008_100623142 161
47 3300014969 Ga0157376_10360245 Ga0157376_103602452 161
48 3300025231 Ga0207427_102975 Ga0207427_1029753 161
49 3300025233 Ga0209437_100427 Ga0209437_10042732 161
50 3300025242 Ga0209258_107314 Ga0209258_1073142 161
51 3300025254 Ga0209148_1000055 Ga0209148_1000055174 161
52 3300025261 Ga0209233_1025311 Ga0209233_10253111 161
53 3300025913 Ga0207695_10234016 Ga0207695_102340162 161
54 3300025920 Ga0207649_10128295 Ga0207649_101282951 161
55 3300025936 Ga0207670_10004305 Ga0207670_100043054 161
56 3300025972 Ga0207668_10288042 Ga0207668_102880422 161
57 3300025986 Ga0207658_10355192 Ga0207658_103551922 161
58 3300026067 Ga0207678_10041589 Ga0207678_100415892 161
59 3300028380 Ga0268265_11051780 Ga0268265_110517801 161
60 3300028381 Ga0268264_10384160 Ga0268264_103841602 161
61 3300046557 Ga0495622_0001100 Ga0495622_0001100_9714_10244 161
62 3300046660 Ga0495625_0006558 Ga0495625_0006558_6848_7378 161
63 3300046694 Ga0495649_0298235 Ga0495649_0298235_166_696 161
64 3300047322 Ga0495680_0717406 Ga0495680_0717406_20_568 161
65 3300048917 Ga0496114_0268449 Ga0496114_0268449_950_1480 161
66 3300050507 nmdc:mga05p37_54023_c1 nmdc:mga05p37_54023_c1_4208_4747 161
67 3300003911 JGI25405J52794_10073438 JGI25405J52794_100734381 162
68 3300005937 Ga0081455_10003119 Ga0081455_1000311917 162
69 3300009093 Ga0105240_10299366 Ga0105240_102993664 162
70 3300037471 Ga0395905_0293822 Ga0395905_0293822_600_1139 162
71 3300049575 Ga0501039_0853189 Ga0501039_0853189_58_606 162
72 3300049580 Ga0501046_0414144 Ga0501046_0414144_64_612 162
73 3300049588 Ga0501072_0038664 Ga0501072_0038664_974_1522 162
74 3300049591 Ga0501075_0615453 Ga0501075_0615453_129_677 162
75 3300005345 Ga0070692_10092233 Ga0070692_100922331 163
76 3300006880 Ga0075429_100221541 Ga0075429_1002215413 163
77 3300009147 Ga0114129_10131752 Ga0114129_101317525 163
78 3300025949 Ga0207667_10463981 Ga0207667_104639812 163
79 3300046472 Ga0495580_0005148 Ga0495580_0005148_587_1138 163
80 3300050508 nmdc:mga09592_376384_c1 nmdc:mga09592_376384_c1_140_679 163
81 3300037418 Ga0395900_0116564 Ga0395900_0116564_877_1416 164
82 3300002705 JGI25156J39149_1005189 JGI25156J39149_10051893 165
83 3300002737 JGI25162J39368_1002969 JGI25162J39368_10029693 165
84 3300002741 JGI25157J39369_1002089 JGI25157J39369_10020895 165
85 3300002771 JGI25163J39215_1001557 JGI25163J39215_10015572 165
86 3300002772 JGI25164J39214_1001416 JGI25164J39214_10014165 165
87 3300003214 JGI25165J46597_1001360 JGI25165J46597_10013605 165
88 3300003751 Ga0055538_1001925 Ga0055538_10019253 165
89 3300003761 Ga0055535_1001285 Ga0055535_10012855 165
90 3300003762 Ga0055542_1001276 Ga0055542_10012765 165
91 3300003763 Ga0055529_1001007 Ga0055529_10010075 165
92 3300005406 Ga0070703_10002159 Ga0070703_100021596 165
93 3300005441 Ga0070700_100000857 Ga0070700_10000085713 165
94 3300006177 Ga0075362_10112846 Ga0075362_101128462 165
95 3300025206 Ga0209435_102013 Ga0209435_1020133 165
96 3300025206 Ga0209435_112604 Ga0209435_1126042 165
97 3300025207 Ga0209760_100637 Ga0209760_1006373 165
98 3300025224 Ga0209784_100043 Ga0209784_1000434 165
99 3300025231 Ga0207427_100087 Ga0207427_1000874 165
100 3300025233 Ga0209437_100173 Ga0209437_1001734 165
101 3300025242 Ga0209258_100092 Ga0209258_10009275 165
102 3300025246 Ga0209646_1000681 Ga0209646_10006819 165
103 3300025250 Ga0209026_1000112 Ga0209026_10001124 165
104 3300025254 Ga0209148_1000047 Ga0209148_1000047272 165
105 3300025256 Ga0209759_1001421 Ga0209759_100142110 165
106 3300025261 Ga0209233_1000179 Ga0209233_10001795 165
107 3300025272 Ga0209455_1000056 Ga0209455_1000056196 165
108 3300025885 Ga0207653_10000118 Ga0207653_1000011828 165
109 3300026075 Ga0207708_10003751 Ga0207708_1000375115 165
110 3300048924 Ga0496121_0029638 Ga0496121_0029638_3638_4168 165
111 3300006852 Ga0075433_10379298 Ga0075433_103792981 166
112 3300006871 Ga0075434_100006382 Ga0075434_1000063822 166
113 3300009094 Ga0111539_10103827 Ga0111539_101038272 166
114 3300027907 Ga0207428_10262713 Ga0207428_102627132 166
115 3300047318 Ga0495636_0488891 Ga0495636_0488891_30_575 166
116 3300050511 nmdc:mga08y16_33306_c1 nmdc:mga08y16_33306_c1_2617_3159 166
117 3300050512 nmdc:mga0n895_3988_c1 nmdc:mga0n895_3988_c1_10906_11448 166
118 3300050513 nmdc:mga0rr50_588005_c1 nmdc:mga0rr50_588005_c1_110_652 166
119 3300050515 nmdc:mga0a205_522634_c1 nmdc:mga0a205_522634_c1_52_594 166
120 3300006914 Ga0075436_100000016 Ga0075436_10000001681 167
121 3300007076 Ga0075435_100000971 Ga0075435_1000009713 167
122 3300035091 Ga0373951_0055977 Ga0373951_0055977_396_938 167
123 3300048907 Ga0496104_0627693 Ga0496104_0627693_360_896 167
124 3300049742 Ga0501080_0828162 Ga0501080_0828162_160_744 167
125 3300050513 nmdc:mga0rr50_440_c1 nmdc:mga0rr50_440_c1_18978_19550 167
126 3300050514 nmdc:mga08x19_8_c1 nmdc:mga08x19_8_c1_184118_184690 167
127 3300053134 Ga0500658_0227368 Ga0500658_0227368_268_819 167
128 iso_pu_bacteria 2928963466 2928966523 167
129 3300005341 Ga0070691_10500257 Ga0070691_105002571 168
130 3300005459 Ga0068867_100032948 Ga0068867_1000329485 168
131 3300005546 Ga0070696_100422362 Ga0070696_1004223622 168
132 3300013297 Ga0157378_10248504 Ga0157378_102485043 168
133 3300026089 Ga0207648_10021618 Ga0207648_100216185 168
134 3300013102 Ga0157371_10280797 Ga0157371_102807972 170
135 3300013307 Ga0157372_10202314 Ga0157372_102023142 170
136 3300025919 Ga0207657_10321510 Ga0207657_103215101 170
137 3300005406 Ga0070703_10066414 Ga0070703_100664142 171
138 3300005444 Ga0070694_100014539 Ga0070694_1000145396 171
139 3300005544 Ga0070686_100054924 Ga0070686_1000549243 171
140 3300053108 Ga0500562_000057 Ga0500562_000057_48567_49091 172
141 3300053151 Ga0500604_0254018 Ga0500604_0254018_48_572 172
142 3300003323 rootH1_10001854 rootH1_100018548 173
143 3300005455 Ga0070663_100369829 Ga0070663_1003698292 173
144 3300006028 Ga0070717_10008953 Ga0070717_1000895313 173
145 3300031711 Ga0265314_10006733 Ga0265314_100067337 173
146 3300025905 Ga0207685_10155469 Ga0207685_101554692 175
147 3300031456 Ga0307513_10149539 Ga0307513_101495392 175
148 3300035691 Ga0373931_0085199 Ga0373931_0085199_912_1448 175
149 3300005458 Ga0070681_10045022 Ga0070681_100450227 176
150 3300005458 Ga0070681_11107278 Ga0070681_111072781 176
151 3300005468 Ga0070707_100078510 Ga0070707_1000785103 176
152 3300005539 Ga0068853_100865908 Ga0068853_1008659081 176
153 3300005549 Ga0070704_100441771 Ga0070704_1004417712 176
154 3300005577 Ga0068857_100071793 Ga0068857_1000717935 176
155 3300005617 Ga0068859_100191534 Ga0068859_1001915343 176
156 3300005842 Ga0068858_100058365 Ga0068858_1000583652 176
157 3300005842 Ga0068858_100385944 Ga0068858_1003859443 176
158 3300005844 Ga0068862_100476052 Ga0068862_1004760522 176
159 3300006058 Ga0075432_10221491 Ga0075432_102214912 176
160 3300006846 Ga0075430_100440156 Ga0075430_1004401562 176
161 3300006847 Ga0075431_100000085 Ga0075431_10000008552 176
162 3300006847 Ga0075431_100209028 Ga0075431_1002090282 176
163 3300006880 Ga0075429_100021653 Ga0075429_1000216538 176
164 3300006880 Ga0075429_100119996 Ga0075429_1001199963 176
165 3300006880 Ga0075429_100156356 Ga0075429_1001563562 176
166 3300006931 Ga0097620_100191530 Ga0097620_1001915302 176
167 3300007076 Ga0075435_100177867 Ga0075435_1001778672 176
168 3300009092 Ga0105250_10190195 Ga0105250_101901951 176
169 3300009094 Ga0111539_10001828 Ga0111539_1000182824 176
170 3300009094 Ga0111539_10024126 Ga0111539_100241266 176
171 3300009094 Ga0111539_10054153 Ga0111539_100541534 176
172 3300009101 Ga0105247_10040419 Ga0105247_100404193 176
173 3300009147 Ga0114129_10003362 Ga0114129_1000336219 176
174 3300009147 Ga0114129_10140581 Ga0114129_101405814 176
175 3300009174 Ga0105241_10078060 Ga0105241_100780602 176
176 3300009545 Ga0105237_11053838 Ga0105237_110538381 176
177 3300010375 Ga0105239_10387552 Ga0105239_103875523 176
178 3300013306 Ga0163162_10036385 Ga0163162_100363855 176
179 3300014325 Ga0163163_10043989 Ga0163163_100439891 176
180 3300014968 Ga0157379_10355350 Ga0157379_103553503 176
181 3300025900 Ga0207710_10054726 Ga0207710_100547263 176
182 3300025912 Ga0207707_10034495 Ga0207707_100344952 176
183 3300025912 Ga0207707_10585164 Ga0207707_105851641 176
184 3300025922 Ga0207646_10070585 Ga0207646_100705852 176
185 3300025923 Ga0207681_10325436 Ga0207681_103254362 176
186 3300026035 Ga0207703_10358818 Ga0207703_103588183 176
187 3300026088 Ga0207641_10678768 Ga0207641_106787682 176
188 3300026095 Ga0207676_10262477 Ga0207676_102624771 176
189 3300026116 Ga0207674_10015550 Ga0207674_100155505 176
190 3300027907 Ga0207428_10000013 Ga0207428_10000013271 176
191 3300027907 Ga0207428_10037194 Ga0207428_100371943 176
192 3300028380 Ga0268265_10107122 Ga0268265_101071222 176
193 3300028380 Ga0268265_10406546 Ga0268265_104065462 176
194 3300028381 Ga0268264_10147380 Ga0268264_101473802 176
195 3300031824 Ga0307413_10965696 Ga0307413_109656961 176
196 3300032002 Ga0307416_100616474 Ga0307416_1006164742 176
197 3300032004 Ga0307414_10201511 Ga0307414_102015113 176
198 3300035088 Ga0373940_0009228 Ga0373940_0009228_1692_2246 176
199 3300035090 Ga0373949_0043149 Ga0373949_0043149_474_1028 176
200 3300035112 Ga0373932_0186596 Ga0373932_0186596_84_638 176
201 3300035114 Ga0373939_0022456 Ga0373939_0022456_742_1296 176
202 3300035115 Ga0373941_0046353 Ga0373941_0046353_207_761 176
203 3300035242 Ga0373962_0003263 Ga0373962_0003263_2207_2761 176
204 3300035691 Ga0373931_0008091 Ga0373931_0008091_1932_2486 176
205 3300045051 Ga0451576_0023514 Ga0451576_0023514_649_1203 176
206 3300046516 Ga0495628_0026044 Ga0495628_0026044_322_861 176
207 3300046543 Ga0495645_0214461 Ga0495645_0214461_348_887 176
208 3300046559 Ga0495667_0331240 Ga0495667_0331240_187_735 176
209 3300046689 Ga0495613_0358759 Ga0495613_0358759_31_579 176
210 3300046809 Ga0495600_0163792 Ga0495600_0163792_682_1230 176
211 3300047319 Ga0495674_0896160 Ga0495674_0896160_59_607 176
212 3300049592 Ga0501076_0074086 Ga0501076_0074086_1411_1959 176
213 3300049593 Ga0501077_0024138 Ga0501077_0024138_2001_2540 176
214 3300049741 Ga0501079_1213857 Ga0501079_1213857_21_560 176
215 3300050507 nmdc:mga05p37_1893_c1 nmdc:mga05p37_1893_c1_3965_4510 176
216 3300050507 nmdc:mga05p37_21004_c1 nmdc:mga05p37_21004_c1_7015_7569 176
217 3300050507 nmdc:mga05p37_537939_c1 nmdc:mga05p37_537939_c1_500_1039 176
218 3300050508 nmdc:mga09592_131996_c1 nmdc:mga09592_131996_c1_977_1531 176
219 3300050508 nmdc:mga09592_896486_c1 nmdc:mga09592_896486_c1_129_674 176
220 3300050509 nmdc:mga0qj67_295627_c1 nmdc:mga0qj67_295627_c1_550_1098 176
221 3300050509 nmdc:mga0qj67_563_c1 nmdc:mga0qj67_563_c1_1190_1735 176
222 3300050510 nmdc:mga06r32_166195_c1 nmdc:mga06r32_166195_c1_460_1014 176
223 3300050510 nmdc:mga06r32_88506_c1 nmdc:mga06r32_88506_c1_652_1197 176
224 3300050511 nmdc:mga08y16_14898_c1 nmdc:mga08y16_14898_c1_3142_3693 176
225 3300050511 nmdc:mga08y16_15153_c1 nmdc:mga08y16_15153_c1_2562_3110 176
226 3300050511 nmdc:mga08y16_59895_c1 nmdc:mga08y16_59895_c1_267_806 176
227 3300053078 Ga0495612_0022155 Ga0495612_0022155_1752_2291 176
228 3300002067 JGI24735J21928_10059762 JGI24735J21928_100597622 178
229 3300002067 JGI24735J21928_10068098 JGI24735J21928_100680981 178
230 3300003756 Ga0055533_1002013 Ga0055533_10020133 178
231 3300013105 Ga0157369_10091381 Ga0157369_100913813 178
232 3300015687 Ga0183368_1007 Ga0183368_1007169 178
233 3300025226 Ga0209674_100037 Ga0209674_100037192 178
234 3300025242 Ga0209258_100584 Ga0209258_10058416 178
235 3300048916 Ga0496113_0211433 Ga0496113_0211433_33_569 178
236 3300048918 Ga0496115_0000194 Ga0496115_0000194_10378_10914 178
237 3300048925 Ga0496122_0196109 Ga0496122_0196109_92_628 178
238 3300049824 Ga0501045_0052077 Ga0501045_0052077_1104_1661 178

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

40

188

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
8es5-assembly1.cif.gz_B aha1 domain protein from pseudomonas aeruginosa 0.7886 25 173
4jda-assembly2.cif.gz_C complex structure of abscisic acid receptor pyl3 with (-)-aba 0.7848 22 174
3ijt-assembly1.cif.gz_A structural characterization of smu.440, a hypothetical protein from streptococcus mutans 0.7818 23 173
2le1-assembly1.cif.gz_A solution nmr structure of tfu_2981 from thermobifida fusca, northeast structural genomics consortium target tfr85a 0.7812 27 169
2m89-assembly1.cif.gz_B solution structure of the aha1 dimer from colwellia psychrerythraea 0.7803 26 173
ID Description Score Start End Superfamily
af_O53961_7_149_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8166 28 173 3.30.530.20
af_O53961_7_149_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8015 28 173 3.30.530.20
af_O07748_5_153_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8007 25 174 3.30.530.20
3ijtB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7995 22 173 3.30.530.20
af_I6X666_8_157_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7915 26 175 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A127F0A7-F1-model_v4 Polyketide cyclase/dehydrase 0.9874 1 175
AF-A0A4Q4XAQ7-F1-model_v4 PhnB-like domain-containing protein 0.9864 3 173 GO:0016020
AF-A0A317NE60-F1-model_v4 Polyketide cyclase/dehydrase/lipid transport protein 0.9851 25 176
AF-A0A0K1PMQ7-F1-model_v4 Polyketide cyclase 0.9833 3 177 GO:0016020
AF-A0A849TU10-F1-model_v4 SRPBCC family protein 0.9821 2 172 GO:0016020

Feature Viewer

pLDDT pTM Quality
90.14 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map