F350859

General Info

Members Datasets Scaffolds Average Seq Length
238 173 476 125

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100102137|Ga0075430_1001021372
Length 150
Sequence MTVLSRWRAGVWPGIGRRRVTSLVMADEKPHVYVPAGTTPPPELEIEDMVVGDGPEASTGQDVEVHYVGVAWSTRKQFDASWDRGETFRFGLGRGQVIKGWDQGVAGMKVGGRRRITIPPRLGYGAAGAGGGLIKGGETLVFVVDLLGVG

Samples

Sample ID Description Type Environment
1 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
83 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
84 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
85 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
86 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
87 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
90 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
91 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
92 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
93 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
94 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
95 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
98 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
99 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
100 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
101 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
102 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
103 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
104 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
105 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
106 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
107 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
108 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
111 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
112 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
113 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
114 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
115 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
116 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
117 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
118 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
119 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
122 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
123 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
124 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
125 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
126 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
127 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
128 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
129 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
134 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
135 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
136 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
137 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
138 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
139 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
140 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
142 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
143 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
144 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
145 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
146 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
147 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
148 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
149 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
150 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
151 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
152 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
153 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
154 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
155 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
156 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
157 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
158 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
159 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
160 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
161 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
162 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
163 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
164 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
165 2858882152 Micromonospora noduli MED15 Isolate Nodule
166 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
167 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
168 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
169 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
170 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
171 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
172 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
173 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.12
Metatranscriptomes 0
Isolates 5.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.14
Nodule 0.84
Rhizoplane 5.46
Rhizosphere 79.83
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075430_100102137 3300006846 Bacteria 2394
2 Ga0070676_10255650 3300005328 Bacteria 1171
3 Ga0070676_10570856 3300005328 Bacteria 812
4 Ga0070683_100212091 3300005329 Bacteria 1840
5 Ga0070670_101874094 3300005331 Bacteria 552
6 Ga0070682_100161466 3300005337 Bacteria 1548
7 Ga0068868_100415239 3300005338 Bacteria 1164
8 Ga0070671_100010081 3300005355 Bacteria 7588
9 Ga0070674_100501806 3300005356 Bacteria 1011
10 Ga0070674_101148599 3300005356 Bacteria 688
11 Ga0070688_100637059 3300005365 Bacteria 820
12 Ga0070667_100012826 3300005367 Bacteria 6925
13 Ga0070714_100106059 3300005435 Bacteria 2482
14 Ga0070700_100946188 3300005441 Bacteria 705
15 Ga0070678_100089203 3300005456 Bacteria 2360
16 Ga0068867_100651534 3300005459 Bacteria 924
17 Ga0068867_101153809 3300005459 Bacteria 710
18 Ga0070685_10423516 3300005466 Bacteria 927
19 Ga0070684_100358225 3300005535 Bacteria 1342
20 Ga0070684_101724743 3300005535 Bacteria 591
21 Ga0070672_100712818 3300005543 Bacteria 879
22 Ga0070672_101893648 3300005543 Bacteria 537
23 Ga0070686_101857050 3300005544 Bacteria 514
24 Ga0070696_100003785 3300005546 Bacteria 10105
25 Ga0070664_102279551 3300005564 Bacteria 514
26 Ga0068854_101250749 3300005578 Bacteria 667
27 Ga0068854_101405369 3300005578 Bacteria 631
28 Ga0068854_101488764 3300005578 Bacteria 614
29 Ga0068852_100158535 3300005616 Bacteria 2111
30 Ga0068859_102692564 3300005617 Bacteria 547
31 Ga0068870_10218720 3300005840 Bacteria 1165
32 Ga0068858_100010395 3300005842 Bacteria 8819
33 Ga0068858_101656253 3300005842 Bacteria 632
34 Ga0081455_10059466 3300005937 Bacteria 3227
35 Ga0081538_10069457 3300005981 Bacteria 1951
36 Ga0070717_10130910 3300006028 Bacteria 2157
37 Ga0075365_10080931 3300006038 Bacteria 2200
38 Ga0075364_10018881 3300006051 Bacteria 4324
39 Ga0075364_11231593 3300006051 Bacteria 507
40 Ga0075432_10354430 3300006058 Bacteria 623
41 Ga0075367_10521011 3300006178 Bacteria 754
42 Ga0075370_10000602 3300006353 Bacteria 13888
43 Ga0075428_100001095 3300006844 Bacteria 28841
44 Ga0075428_100607745 3300006844 Bacteria 1168
45 Ga0075428_101082627 3300006844 Bacteria 847
46 Ga0075430_100002287 3300006846 Bacteria 15872
47 Ga0075430_100174853 3300006846 Bacteria 1786
48 Ga0075431_100003671 3300006847 Bacteria 14896
49 Ga0075431_100031106 3300006847 Bacteria 5498
50 Ga0075429_100000709 3300006880 Bacteria 26067
51 Ga0068865_100143889 3300006881 Bacteria 1801
52 Ga0068865_102033130 3300006881 Bacteria 522
53 Ga0097620_102692496 3300006931 Bacteria 547
54 Ga0105240_11780176 3300009093 Bacteria 642
55 Ga0111539_10005499 3300009094 Bacteria 16396
56 Ga0111539_10461204 3300009094 Bacteria 1480
57 Ga0111539_11366317 3300009094 Bacteria 822
58 Ga0105245_10332641 3300009098 Bacteria 1500
59 Ga0114129_10002606 3300009147 Bacteria 25080
60 Ga0114129_10154015 3300009147 Bacteria 3145
61 Ga0114129_10977540 3300009147 Bacteria 1067
62 Ga0114129_12032201 3300009147 Bacteria 694
63 Ga0105243_10121170 3300009148 Bacteria 2205
64 Ga0105243_10878642 3300009148 Bacteria 890
65 Ga0105241_11427975 3300009174 Bacteria 663
66 Ga0105242_10297170 3300009176 Bacteria 1472
67 Ga0105248_10270376 3300009177 Bacteria 1914
68 Ga0105237_12593025 3300009545 Bacteria 518
69 Ga0105238_10021602 3300009551 Bacteria 6555
70 Ga0105238_10192951 3300009551 Bacteria 2013
71 Ga0105239_10258173 3300010375 Bacteria 1958
72 Ga0105239_10372793 3300010375 Bacteria 1613
73 Ga0157374_10273149 3300013296 Bacteria 1667
74 Ga0163162_10166395 3300013306 Bacteria 2329
75 Ga0163162_10961674 3300013306 Bacteria 965
76 Ga0157375_10064547 3300013308 Bacteria 3646
77 Ga0157375_11737755 3300013308 Bacteria 739
78 Ga0163163_10015879 3300014325 Bacteria 6974
79 Ga0157380_10727116 3300014326 Bacteria 1001
80 Ga0157380_11995671 3300014326 Bacteria 642
81 Ga0157379_10346926 3300014968 Bacteria 1358
82 Ga0207688_10133978 3300025901 Bacteria 1454
83 Ga0207645_10156520 3300025907 Bacteria 1489
84 Ga0207643_10216419 3300025908 Bacteria 1171
85 Ga0207657_11122500 3300025919 Bacteria 600
86 Ga0207694_10228175 3300025924 Bacteria 1520
87 Ga0207650_10350213 3300025925 Bacteria 1215
88 Ga0207650_11507688 3300025925 Bacteria 571
89 Ga0207687_10200309 3300025927 Bacteria 1560
90 Ga0207664_10018420 3300025929 Bacteria 5141
91 Ga0207644_10037427 3300025931 Bacteria 3413
92 Ga0207686_10400181 3300025934 Bacteria 1046
93 Ga0207669_10337001 3300025937 Bacteria 1160
94 Ga0207669_11303474 3300025937 Bacteria 617
95 Ga0207704_10055038 3300025938 Bacteria 2429
96 Ga0207704_11282130 3300025938 Bacteria 626
97 Ga0207661_10873305 3300025944 Bacteria 828
98 Ga0207679_10787905 3300025945 Bacteria 866
99 Ga0207679_11409312 3300025945 Bacteria 639
100 Ga0207640_10574765 3300025981 Bacteria 950
101 Ga0207658_10003816 3300025986 Bacteria 10609
102 Ga0207677_10105259 3300026023 Bacteria 2087
103 Ga0207677_11561496 3300026023 Bacteria 610
104 Ga0207703_10006830 3300026035 Bacteria 9087
105 Ga0207703_10295466 3300026035 Bacteria 1476
106 Ga0207639_10308250 3300026041 Bacteria 1401
107 Ga0207708_10015137 3300026075 Bacteria 5779
108 Ga0207708_10997785 3300026075 Bacteria 727
109 Ga0207648_10050810 3300026089 Bacteria 3624
110 Ga0207648_10632032 3300026089 Bacteria 988
111 Ga0207675_100011109 3300026118 Bacteria 8437
112 Ga0207683_10148073 3300026121 Bacteria 2118
113 Ga0207698_10536616 3300026142 Bacteria 1144
114 Ga0207698_10736100 3300026142 Bacteria 984
115 Ga0207428_10201274 3300027907 Bacteria 1498
116 Ga0207428_10247263 3300027907 Bacteria 1331
117 Ga0268266_10177957 3300028379 Bacteria 1935
118 Ga0265338_10218758 3300028800 Bacteria 1424
119 Ga0265328_10239915 3300031239 Bacteria 693
120 Ga0265327_10082232 3300031251 Bacteria 1588
121 Ga0307406_10495148 3300031901 Bacteria 990
122 Ga0307406_10683953 3300031901 Bacteria 855
123 Ga0307407_10793642 3300031903 Bacteria 720
124 Ga0307409_100105889 3300031995 Bacteria 2346
125 Ga0307409_100349982 3300031995 Bacteria 1394
126 Ga0307409_100467029 3300031995 Bacteria 1221
127 Ga0307409_102891684 3300031995 Bacteria 507
128 Ga0307416_103780276 3300032002 Bacteria 507
129 Ga0307415_100099726 3300032126 Bacteria 2127
130 Ga0307415_100722816 3300032126 Bacteria 901
131 Ga0373948_0000659 3300034817 Bacteria 4474
132 Ga0373928_0084591 3300035084 Bacteria 805
133 Ga0316574_0097195 3300035398 Bacteria 1882
134 Ga0373931_0000171 3300035691 Bacteria 28305
135 Ga0373931_0435645 3300035691 Bacteria 836
136 Ga0316584_0504365 3300036712 Bacteria 850
137 Ga0373925_0000672 3300037068 Bacteria 32120
138 Ga0395900_0821183 3300037418 Bacteria 857
139 Ga0400483_092228 3300039062 Bacteria 38837
140 Ga0400483_223101 3300039062 Bacteria 36642
141 Ga0451797_0493533 3300041453 Bacteria 801
142 Ga0451797_1203526 3300041453 Bacteria 637
143 Ga0451837_0239184 3300041494 Bacteria 676
144 Ga0451843_0554049 3300041509 Bacteria 1088
145 Ga0439450_026241 3300042008 Bacteria 1283
146 Ga0439450_172418 3300042008 Bacteria 573
147 Ga0439444_0074112 3300042437 Bacteria 734
148 Ga0439440_0057657 3300042993 Bacteria 985
149 Ga0466969_0007433 3300044656 Bacteria 5818
150 Ga0466966_0005783 3300044684 Bacteria 8149
151 Ga0466961_0014400 3300044693 Bacteria 5076
152 Ga0466970_0064991 3300044765 Bacteria 1957
153 Ga0466959_0001909 3300045049 Bacteria 13109
154 Ga0466967_2021331 3300045976 Bacteria 573
155 Ga0495664_0317178 3300046477 Bacteria 940
156 Ga0495630_0066675 3300046517 Bacteria 2706
157 Ga0495631_0214431 3300046518 Bacteria 822
158 Ga0495645_0696168 3300046543 Bacteria 617
159 Ga0495623_0702465 3300046679 Bacteria 518
160 Ga0495658_0261749 3300046683 Bacteria 1089
161 Ga0495604_0087098 3300047317 Bacteria 2327
162 Ga0495674_0193811 3300047319 Bacteria 1688
163 Ga0495672_0004435 3300047320 Bacteria 11497
164 Ga0496101_0490067 3300048904 Bacteria 971
165 Ga0496102_0048707 3300048905 Bacteria 3853
166 Ga0496104_0251751 3300048907 Bacteria 1679
167 Ga0496108_0188443 3300048911 Bacteria 1787
168 Ga0496108_0737895 3300048911 Bacteria 852
169 Ga0496109_0878414 3300048912 Bacteria 834
170 Ga0496110_0028978 3300048913 Bacteria 4759
171 Ga0496111_0032774 3300048914 Bacteria 3704
172 Ga0496112_0106456 3300048915 Bacteria 2774
173 Ga0496113_0039508 3300048916 Bacteria 3473
174 Ga0496114_0025364 3300048917 Bacteria 4845
175 Ga0501032_0314289 3300049569 Bacteria 1012
176 Ga0501036_0310734 3300049572 Bacteria 1318
177 Ga0501039_0004624 3300049575 Bacteria 10404
178 Ga0501048_0203047 3300049582 Bacteria 1405
179 Ga0501068_0088593 3300049584 Bacteria 1907
180 Ga0501069_0000038 3300049585 Bacteria 82519
181 Ga0501069_0052855 3300049585 Bacteria 2263
182 Ga0501070_0000008 3300049586 Bacteria 199963
183 Ga0501072_0090498 3300049588 Bacteria 2429
184 Ga0501076_0137192 3300049592 Bacteria 1986
185 Ga0501079_0698197 3300049741 Bacteria 799
186 Ga0501080_0002698 3300049742 Bacteria 15552
187 Ga0501080_0910680 3300049742 Bacteria 766
188 Ga0501035_0808523 3300049822 Bacteria 748
189 Ga0501044_0006430 3300049823 Bacteria 12981
190 nmdc:mga00v17_163808_c1 3300050491 Bacteria 1432
191 nmdc:mga00v17_379623_c1 3300050491 Bacteria 919
192 nmdc:mga0yw44_156749_c1 3300050492 Bacteria 1488
193 nmdc:mga0yw44_675191_c1 3300050492 Bacteria 702
194 nmdc:mga0yw44_71790_c1 3300050492 Bacteria 2150
195 nmdc:mga0yw44_84322_c1 3300050492 Bacteria 1997
196 nmdc:mga0yw44_8542_c1 3300050492 Bacteria 5111
197 nmdc:mga06z11_275084_c1 3300050494 Bacteria 996
198 nmdc:mga06z11_584561_c1 3300050494 Bacteria 679
199 nmdc:mga07m45_3859_c1 3300050496 Bacteria 7266
200 nmdc:mga05p37_11935_c1 3300050507 Bacteria 10360
201 nmdc:mga05p37_14383_c1 3300050507 Bacteria 9502
202 nmdc:mga05p37_783832_c1 3300050507 Bacteria 1046
203 nmdc:mga09592_421073_c1 3300050508 Bacteria 1154
204 nmdc:mga09592_688471_c1 3300050508 Bacteria 871
205 nmdc:mga09592_93689_c1 3300050508 Bacteria 2568
206 nmdc:mga0qj67_242046_c1 3300050509 Bacteria 1464
207 nmdc:mga0qj67_2582_c1 3300050509 Bacteria 12951
208 nmdc:mga06r32_43860_c1 3300050510 Bacteria 4257
209 nmdc:mga06r32_847528_c1 3300050510 Bacteria 873
210 nmdc:mga06r32_8989_c1 3300050510 Bacteria 9001
211 nmdc:mga06r32_951378_c1 3300050510 Bacteria 813
212 nmdc:mga08y16_1194789_c1 3300050511 Bacteria 731
213 nmdc:mga08y16_1310823_c1 3300050511 Bacteria 690
214 nmdc:mga08y16_558662_c1 3300050511 Bacteria 1158
215 nmdc:mga0n895_1738572_c1 3300050512 Bacteria 585
216 nmdc:mga0n895_574042_c1 3300050512 Bacteria 1132
217 Ga0495595_0101722 3300053084 Bacteria 1388
218 Ga0495619_0078394 3300053085 Bacteria 2221
219 Ga0500566_0002558 3300053094 Bacteria 10822
220 Ga0500568_0000022 3300053139 Bacteria 184816
221 Ga0501084_0286991 3300054114 Bacteria 1390
222 Ga0501082_0258228 3300060353 Bacteria 1516
223 Ga0466962_0112314 3300061719 Bacteria 1312
224 Ga0530510_0334541 3300061734 Bacteria 1136
225 2832010841 2832004796 Bacteria 6538017
226 2855670265 2855670206 Bacteria 7120389
227 2855680376 2855676851 Bacteria 7063653
228 2857292644 2857288857 Bacteria 7189066
229 2858853696 2858848962 Bacteria 6963058
230 2858886751 2858882152 Bacteria 7230291
231 2858890177 2858888857 Bacteria 7060307
232 2858896134 2858895516 Bacteria 7378898
233 2866068249 2866065130 Bacteria 6518152
234 2869049112 2869048445 Bacteria 6875584
235 2869063788 2869061728 Bacteria 7112407
236 2869075322 2869068681 Bacteria 7205615
237 2880491411 2880489317 Bacteria 7096270
238 2880501047 2880495981 Bacteria 7340502
239 Ga0075430_100102137
240 Ga0070676_10255650
241 Ga0070676_10570856
242 Ga0070683_100212091
243 Ga0070670_101874094
244 Ga0070682_100161466
245 Ga0068868_100415239
246 Ga0070671_100010081
247 Ga0070674_100501806
248 Ga0070674_101148599
249 Ga0070688_100637059
250 Ga0070667_100012826
251 Ga0070714_100106059
252 Ga0070700_100946188
253 Ga0070678_100089203
254 Ga0068867_100651534
255 Ga0068867_101153809
256 Ga0070685_10423516
257 Ga0070684_100358225
258 Ga0070684_101724743
259 Ga0070672_100712818
260 Ga0070672_101893648
261 Ga0070686_101857050
262 Ga0070696_100003785
263 Ga0070664_102279551
264 Ga0068854_101250749
265 Ga0068854_101405369
266 Ga0068854_101488764
267 Ga0068852_100158535
268 Ga0068859_102692564
269 Ga0068870_10218720
270 Ga0068858_100010395
271 Ga0068858_101656253
272 Ga0081455_10059466
273 Ga0081538_10069457
274 Ga0070717_10130910
275 Ga0075365_10080931
276 Ga0075364_10018881
277 Ga0075364_11231593
278 Ga0075432_10354430
279 Ga0075367_10521011
280 Ga0075370_10000602
281 Ga0075428_100001095
282 Ga0075428_100607745
283 Ga0075428_101082627
284 Ga0075430_100002287
285 Ga0075430_100174853
286 Ga0075431_100003671
287 Ga0075431_100031106
288 Ga0075429_100000709
289 Ga0068865_100143889
290 Ga0068865_102033130
291 Ga0097620_102692496
292 Ga0105240_11780176
293 Ga0111539_10005499
294 Ga0111539_10461204
295 Ga0111539_11366317
296 Ga0105245_10332641
297 Ga0114129_10002606
298 Ga0114129_10154015
299 Ga0114129_10977540
300 Ga0114129_12032201
301 Ga0105243_10121170
302 Ga0105243_10878642
303 Ga0105241_11427975
304 Ga0105242_10297170
305 Ga0105248_10270376
306 Ga0105237_12593025
307 Ga0105238_10021602
308 Ga0105238_10192951
309 Ga0105239_10258173
310 Ga0105239_10372793
311 Ga0157374_10273149
312 Ga0163162_10166395
313 Ga0163162_10961674
314 Ga0157375_10064547
315 Ga0157375_11737755
316 Ga0163163_10015879
317 Ga0157380_10727116
318 Ga0157380_11995671
319 Ga0157379_10346926
320 Ga0207688_10133978
321 Ga0207645_10156520
322 Ga0207643_10216419
323 Ga0207657_11122500
324 Ga0207694_10228175
325 Ga0207650_10350213
326 Ga0207650_11507688
327 Ga0207687_10200309
328 Ga0207664_10018420
329 Ga0207644_10037427
330 Ga0207686_10400181
331 Ga0207669_10337001
332 Ga0207669_11303474
333 Ga0207704_10055038
334 Ga0207704_11282130
335 Ga0207661_10873305
336 Ga0207679_10787905
337 Ga0207679_11409312
338 Ga0207640_10574765
339 Ga0207658_10003816
340 Ga0207677_10105259
341 Ga0207677_11561496
342 Ga0207703_10006830
343 Ga0207703_10295466
344 Ga0207639_10308250
345 Ga0207708_10015137
346 Ga0207708_10997785
347 Ga0207648_10050810
348 Ga0207648_10632032
349 Ga0207675_100011109
350 Ga0207683_10148073
351 Ga0207698_10536616
352 Ga0207698_10736100
353 Ga0207428_10201274
354 Ga0207428_10247263
355 Ga0268266_10177957
356 Ga0265338_10218758
357 Ga0265328_10239915
358 Ga0265327_10082232
359 Ga0307406_10495148
360 Ga0307406_10683953
361 Ga0307407_10793642
362 Ga0307409_100105889
363 Ga0307409_100349982
364 Ga0307409_100467029
365 Ga0307409_102891684
366 Ga0307416_103780276
367 Ga0307415_100099726
368 Ga0307415_100722816
369 Ga0373948_0000659
370 Ga0373928_0084591
371 Ga0316574_0097195
372 Ga0373931_0000171
373 Ga0373931_0435645
374 Ga0316584_0504365
375 Ga0373925_0000672
376 Ga0395900_0821183
377 Ga0400483_092228
378 Ga0400483_223101
379 Ga0451797_0493533
380 Ga0451797_1203526
381 Ga0451837_0239184
382 Ga0451843_0554049
383 Ga0439450_026241
384 Ga0439450_172418
385 Ga0439444_0074112
386 Ga0439440_0057657
387 Ga0466969_0007433
388 Ga0466966_0005783
389 Ga0466961_0014400
390 Ga0466970_0064991
391 Ga0466959_0001909
392 Ga0466967_2021331
393 Ga0495664_0317178
394 Ga0495630_0066675
395 Ga0495631_0214431
396 Ga0495645_0696168
397 Ga0495623_0702465
398 Ga0495658_0261749
399 Ga0495604_0087098
400 Ga0495674_0193811
401 Ga0495672_0004435
402 Ga0496101_0490067
403 Ga0496102_0048707
404 Ga0496104_0251751
405 Ga0496108_0188443
406 Ga0496108_0737895
407 Ga0496109_0878414
408 Ga0496110_0028978
409 Ga0496111_0032774
410 Ga0496112_0106456
411 Ga0496113_0039508
412 Ga0496114_0025364
413 Ga0501032_0314289
414 Ga0501036_0310734
415 Ga0501039_0004624
416 Ga0501048_0203047
417 Ga0501068_0088593
418 Ga0501069_0000038
419 Ga0501069_0052855
420 Ga0501070_0000008
421 Ga0501072_0090498
422 Ga0501076_0137192
423 Ga0501079_0698197
424 Ga0501080_0002698
425 Ga0501080_0910680
426 Ga0501035_0808523
427 Ga0501044_0006430
428 nmdc:mga00v17_163808_c1
429 nmdc:mga00v17_379623_c1
430 nmdc:mga0yw44_156749_c1
431 nmdc:mga0yw44_675191_c1
432 nmdc:mga0yw44_71790_c1
433 nmdc:mga0yw44_84322_c1
434 nmdc:mga0yw44_8542_c1
435 nmdc:mga06z11_275084_c1
436 nmdc:mga06z11_584561_c1
437 nmdc:mga07m45_3859_c1
438 nmdc:mga05p37_11935_c1
439 nmdc:mga05p37_14383_c1
440 nmdc:mga05p37_783832_c1
441 nmdc:mga09592_421073_c1
442 nmdc:mga09592_688471_c1
443 nmdc:mga09592_93689_c1
444 nmdc:mga0qj67_242046_c1
445 nmdc:mga0qj67_2582_c1
446 nmdc:mga06r32_43860_c1
447 nmdc:mga06r32_847528_c1
448 nmdc:mga06r32_8989_c1
449 nmdc:mga06r32_951378_c1
450 nmdc:mga08y16_1194789_c1
451 nmdc:mga08y16_1310823_c1
452 nmdc:mga08y16_558662_c1
453 nmdc:mga0n895_1738572_c1
454 nmdc:mga0n895_574042_c1
455 Ga0495595_0101722
456 Ga0495619_0078394
457 Ga0500566_0002558
458 Ga0500568_0000022
459 Ga0501084_0286991
460 Ga0501082_0258228
461 Ga0466962_0112314
462 Ga0530510_0334541
463 2832010841
464 2855670265
465 2855680376
466 2857292644
467 2858853696
468 2858886751
469 2858890177
470 2858896134
471 2866068249
472 2869049112
473 2869063788
474 2869075322
475 2880491411
476 2880501047

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00254

FKBP_C

FKBP-type peptidyl-prolyl cis-trans isomerase

54

147

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5klx-assembly2.cif.gz_B crystal structure of smt fusion peptidyl-prolyl cis-trans isomerase from burkholderia pseudomallei complexed with sf110 0.9876 20 122
5klx-assembly1.cif.gz_A crystal structure of smt fusion peptidyl-prolyl cis-trans isomerase from burkholderia pseudomallei complexed with sf110 0.9867 20 122
4ggq-assembly1.cif.gz_C crystal structure of a smt fusion peptidyl-prolyl cis-trans isomerase from burkholderia pseudomallei complexed with cj40 0.9865 20 122
6o4a-assembly3.cif.gz_C crystal structure of smt fusion peptidyl-prolyl cis-trans isomerase from burkholderia pseudomallei complexed with sf355 0.9863 20 122
2y78-assembly1.cif.gz_A-2 crystal structure of bpss1823, a mip-like chaperone from burkholderia pseudomallei 0.9863 20 122
ID Description Score Start End Superfamily
af_B0G119_2_111_3.10.50.40 Alpha Beta;Roll;Chitinase A; domain 3; 0.9759 20 125 3.10.50.40
3ni6A01 Alpha Beta;Roll;Chitinase A; domain 3; 0.9624 20 125 3.10.50.40
4odpA00 Alpha Beta;Roll;Chitinase A; domain 3; 0.9611 31 125 3.10.50.40
af_Q54Y27_80_210_3.10.50.40 Alpha Beta;Roll;Chitinase A; domain 3; 0.9611 20 123 3.10.50.40
1n1aB00 Alpha Beta;Roll;Chitinase A; domain 3; 0.9608 20 125 3.10.50.40
ID Description Score Start End GO Terms
AF-A0A0M9YNY9-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) 0.9971 21 123 GO:0140839
GO:0140840
AF-A0A7W0A5Y5-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) 0.9956 29 125 GO:0003755
AF-A0A4P5RXP7-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) 0.9952 5 125 GO:0140839
GO:0140840
AF-A0A248YND7-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) 0.995 22 125 GO:0140839
GO:0140840
AF-A0A2N5JVW0-F1-model_v4 deleted 0.9946 6 125

Map