F350857

General Info

Members Datasets Scaffolds Average Seq Length
238 156 476 274

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100000462|Ga0075430_10000046227
Length 286
Sequence MWPVTATGRMTSESMPRLAVIIATYNSAGDIDRCLASLHAAPAHVPHEITIVDNASSDGTVATVRRRFPNVRVIVAPRNIGFASANNLGIVQTSSDLVLLLNPDTIVRPGAIDTLVHALDSRPDAAACGPRLVDGQGRAELSFGAMMNPLTELRQKCLVRGHARGWPFVAAHVESMTRRPGEPDWVSGACLCVRRTDAEAAGLLDERYFLYAEDVDFCAALRARGRKILFVPAAEVVHARGQSRSSAPQASEQAYRSSQLAFYAKHHPAWLPILRVYLRLRGRHPA

Samples

Sample ID Description Type Environment
1 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
71 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
107 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
112 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
113 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
116 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
117 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
118 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
119 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
120 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
121 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
122 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
123 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
124 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
125 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
126 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
127 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
128 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
129 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
136 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
137 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
138 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
139 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
140 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
141 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
142 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
143 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
144 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
145 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
146 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
147 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
148 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
149 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
150 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
151 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
152 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
153 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
154 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
155 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
156 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.36
Nodule 0
Rhizoplane 5.46
Rhizosphere 90.34
Stem 0
Stem Tuber 0
Unclassified 17.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075430_100000462 3300006846 Bacteria 30314
2 SwRhRL2b_contig_3350027 2162886007 Bacteria 2179
3 Ga0065704_10004668 3300005289 Bacteria 6255
4 Ga0065712_10187153 3300005290 Unclassified 1165
5 Ga0065715_10146598 3300005293 Bacteria 1781
6 Ga0065707_10003294 3300005295 Bacteria 4441
7 Ga0070676_10036127 3300005328 Bacteria 2845
8 Ga0070690_100099225 3300005330 Bacteria 1929
9 Ga0070670_100028496 3300005331 Bacteria 4807
10 Ga0070670_100029013 3300005331 Bacteria 4762
11 Ga0070670_100370062 3300005331 Bacteria 1261
12 Ga0068869_100158196 3300005334 Bacteria 1762
13 Ga0068869_100272656 3300005334 Unclassified 1358
14 Ga0070666_10173866 3300005335 Bacteria 1509
15 Ga0068868_100126203 3300005338 Unclassified 2091
16 Ga0070689_100002984 3300005340 Bacteria 11126
17 Ga0070687_100007223 3300005343 Bacteria 4612
18 Ga0070687_100034484 3300005343 Bacteria 2506
19 Ga0070669_100017720 3300005353 Bacteria 5081
20 Ga0070675_100001754 3300005354 Bacteria 15998
21 Ga0070675_100018145 3300005354 Bacteria 5600
22 Ga0070675_100065254 3300005354 Bacteria 3010
23 Ga0070671_100234464 3300005355 Bacteria 1557
24 Ga0070674_100065480 3300005356 Bacteria 2551
25 Ga0070673_100161695 3300005364 Bacteria 1905
26 Ga0070673_100195808 3300005364 Bacteria 1738
27 Ga0070673_100203672 3300005364 Bacteria 1705
28 Ga0070673_100342105 3300005364 Bacteria 1326
29 Ga0070688_100415083 3300005365 Bacteria 999
30 Ga0070701_10004551 3300005438 Bacteria 5638
31 Ga0070701_10188882 3300005438 Bacteria 1211
32 Ga0070705_100024852 3300005440 Bacteria 3239
33 Ga0070705_100238943 3300005440 Unclassified 1268
34 Ga0070694_100418414 3300005444 Bacteria 1052
35 Ga0070708_100535445 3300005445 Bacteria 1105
36 Ga0070678_100004402 3300005456 Bacteria 7980
37 Ga0070678_100189090 3300005456 Bacteria 1691
38 Ga0068867_100004599 3300005459 Bacteria 9706
39 Ga0070707_100158434 3300005468 Bacteria 2205
40 Ga0070698_100205971 3300005471 Bacteria 1902
41 Ga0070699_100227597 3300005518 Bacteria 1662
42 Ga0070672_100024453 3300005543 Bacteria 4465
43 Ga0070672_100535071 3300005543 Bacteria 1016
44 Ga0070686_100102466 3300005544 Unclassified 1936
45 Ga0070686_100330056 3300005544 Unclassified 1140
46 Ga0070665_100013605 3300005548 Bacteria 8183
47 Ga0070704_100000381 3300005549 Bacteria 20202
48 Ga0070704_100132673 3300005549 Unclassified 1933
49 Ga0070664_100033622 3300005564 Bacteria 4296
50 Ga0070664_100054360 3300005564 Bacteria 3397
51 Ga0068857_100048838 3300005577 Bacteria 3755
52 Ga0068859_100028045 3300005617 Bacteria 5646
53 Ga0068859_100357205 3300005617 Unclassified 1556
54 Ga0068864_100035992 3300005618 Bacteria 4217
55 Ga0068864_100115751 3300005618 Bacteria 2392
56 Ga0068864_100140417 3300005618 Bacteria 2178
57 Ga0068864_100190429 3300005618 Unclassified 1880
58 Ga0068866_10139209 3300005718 Unclassified 1391
59 Ga0068861_100059668 3300005719 Bacteria 2922
60 Ga0068870_10020947 3300005840 Bacteria 3192
61 Ga0068870_10053694 3300005840 Bacteria 2141
62 Ga0068863_100108219 3300005841 Bacteria 2646
63 Ga0068863_100149476 3300005841 Bacteria 2235
64 Ga0068858_100005424 3300005842 Bacteria 12496
65 Ga0068858_100143503 3300005842 Bacteria 2242
66 Ga0068860_100026156 3300005843 Bacteria 5629
67 Ga0068860_100149452 3300005843 Bacteria 2249
68 Ga0068860_100255831 3300005843 Bacteria 1706
69 Ga0081539_10141208 3300005985 Bacteria 1170
70 Ga0075365_10449318 3300006038 Bacteria 910
71 Ga0075368_10014761 3300006042 Bacteria 2889
72 Ga0075366_10179009 3300006195 Bacteria 1288
73 Ga0097621_100017255 3300006237 Bacteria 5477
74 Ga0068871_100011143 3300006358 Bacteria 6592
75 Ga0068871_100061199 3300006358 Bacteria 3074
76 Ga0075428_100001863 3300006844 Bacteria 22584
77 Ga0075428_100054128 3300006844 Bacteria 4397
78 Ga0075428_100366128 3300006844 Unclassified 1546
79 Ga0075433_10150953 3300006852 Unclassified 2067
80 Ga0075433_10356439 3300006852 Bacteria 1292
81 Ga0075434_100010560 3300006871 Bacteria 8664
82 Ga0097620_100028046 3300006931 Bacteria 5646
83 Ga0097620_100357200 3300006931 Unclassified 1556
84 Ga0075435_100083031 3300007076 Bacteria 2634
85 Ga0111539_10032258 3300009094 Bacteria 6362
86 Ga0111539_10206352 3300009094 Bacteria 2290
87 Ga0111539_10501342 3300009094 Bacteria 1414
88 Ga0105247_10073695 3300009101 Unclassified 2140
89 Ga0114129_10001486 3300009147 Bacteria 31745
90 Ga0114129_10005999 3300009147 Bacteria 17217
91 Ga0114129_10017938 3300009147 Bacteria 10076
92 Ga0114129_10018933 3300009147 Bacteria 9809
93 Ga0114129_10050810 3300009147 Bacteria 5822
94 Ga0114129_10188196 3300009147 Bacteria 2805
95 Ga0114129_10637823 3300009147 Bacteria 1376
96 Ga0105243_10049210 3300009148 Bacteria 3324
97 Ga0105242_10008317 3300009176 Bacteria 7971
98 Ga0105248_10028746 3300009177 Bacteria 6196
99 Ga0105248_10063427 3300009177 Bacteria 4148
100 Ga0105248_10240878 3300009177 Bacteria 2036
101 Ga0105238_10562175 3300009551 Unclassified 1146
102 Ga0105249_10122802 3300009553 Bacteria 2470
103 Ga0157374_10187090 3300013296 Bacteria 2025
104 Ga0163162_10213194 3300013306 Unclassified 2061
105 Ga0163162_10496678 3300013306 Bacteria 1351
106 Ga0157375_10002758 3300013308 Bacteria 15192
107 Ga0157375_10099069 3300013308 Bacteria 2993
108 Ga0157375_10379079 3300013308 Unclassified 1581
109 Ga0157375_10799843 3300013308 Bacteria 1092
110 Ga0157380_10185750 3300014326 Bacteria 1830
111 Ga0157377_10107803 3300014745 Bacteria 1670
112 Ga0157379_10067830 3300014968 Bacteria 3189
113 Ga0157379_10420826 3300014968 Unclassified 1230
114 Ga0157376_10199849 3300014969 Bacteria 1838
115 Ga0213876_10055168 3300021384 Bacteria 2098
116 Ga0207682_10146441 3300025893 Unclassified 1063
117 Ga0207710_10046825 3300025900 Unclassified 1931
118 Ga0207680_10137296 3300025903 Unclassified 1618
119 Ga0207643_10006744 3300025908 Bacteria 6159
120 Ga0207662_10007893 3300025918 Bacteria 5797
121 Ga0207662_10138464 3300025918 Bacteria 1540
122 Ga0207649_10353404 3300025920 Bacteria 1088
123 Ga0207681_10000916 3300025923 Bacteria 19261
124 Ga0207694_10230982 3300025924 Unclassified 1511
125 Ga0207650_10009390 3300025925 Bacteria 6684
126 Ga0207659_10002945 3300025926 Bacteria 10138
127 Ga0207659_10018399 3300025926 Bacteria 4581
128 Ga0207659_10098165 3300025926 Bacteria 2202
129 Ga0207659_10201358 3300025926 Bacteria 1590
130 Ga0207690_10291148 3300025932 Bacteria 1275
131 Ga0207686_10194150 3300025934 Unclassified 1449
132 Ga0207686_10234805 3300025934 Bacteria 1332
133 Ga0207709_10101355 3300025935 Bacteria 1904
134 Ga0207670_10002255 3300025936 Bacteria 10090
135 Ga0207669_10037467 3300025937 Bacteria 2783
136 Ga0207669_10214034 3300025937 Unclassified 1409
137 Ga0207669_10263303 3300025937 Bacteria 1291
138 Ga0207704_10016064 3300025938 Bacteria 3836
139 Ga0207711_10026369 3300025941 Bacteria 4875
140 Ga0207711_10238903 3300025941 Bacteria 1665
141 Ga0207689_10045952 3300025942 Bacteria 3610
142 Ga0207689_10092079 3300025942 Unclassified 2490
143 Ga0207679_10390713 3300025945 Unclassified 1222
144 Ga0207651_10032947 3300025960 Bacteria 3335
145 Ga0207651_10099812 3300025960 Bacteria 2151
146 Ga0207712_10255789 3300025961 Bacteria 1418
147 Ga0207677_10056395 3300026023 Unclassified 2692
148 Ga0207703_10027128 3300026035 Bacteria 4510
149 Ga0207641_10099635 3300026088 Unclassified 2557
150 Ga0207641_10377278 3300026088 Unclassified 1357
151 Ga0207648_10004366 3300026089 Bacteria 14544
152 Ga0207648_10456912 3300026089 Bacteria 1164
153 Ga0207676_10034605 3300026095 Bacteria 3826
154 Ga0207676_10053541 3300026095 Bacteria 3159
155 Ga0207676_10174899 3300026095 Bacteria 1874
156 Ga0207674_10027348 3300026116 Bacteria 6036
157 Ga0207674_10194758 3300026116 Unclassified 1976
158 Ga0207675_100011241 3300026118 Bacteria 8385
159 Ga0207675_100056246 3300026118 Bacteria 3669
160 Ga0207675_100515824 3300026118 Bacteria 1191
161 Ga0207683_10090486 3300026121 Bacteria 2725
162 Ga0207683_10133002 3300026121 Bacteria 2238
163 Ga0207428_10322511 3300027907 Bacteria 1141
164 Ga0268266_10018585 3300028379 Bacteria 5923
165 Ga0268266_10228062 3300028379 Unclassified 1715
166 Ga0268265_10000511 3300028380 Bacteria 39803
167 Ga0268264_10001648 3300028381 Bacteria 20626
168 Ga0268264_10084149 3300028381 Bacteria 2727
169 Ga0268264_10297219 3300028381 Unclassified 1519
170 Ga0268264_10312967 3300028381 Bacteria 1482
171 Ga0307408_100153907 3300031548 Bacteria 1818
172 Ga0307412_10360090 3300031911 Bacteria 1171
173 Ga0307415_100430608 3300032126 Bacteria 1135
174 Ga0373931_0093419 3300035691 Bacteria 1680
175 Ga0373937_0018641 3300036401 Bacteria 6200
176 Ga0373937_0446634 3300036401 Unclassified 1228
177 Ga0395905_0405211 3300037471 Bacteria 1259
178 Ga0436365_1149854 3300039437 Bacteria 2126
179 Ga0439439_0040479 3300041406 Unclassified 1206
180 Ga0439435_0002594 3300042436 Bacteria 3618
181 Ga0453684_0035037 3300044712 Bacteria 6949
182 Ga0451576_0064504 3300045051 Bacteria 3815
183 Ga0495629_0286352 3300046459 Bacteria 1130
184 Ga0495580_0078570 3300046472 Bacteria 2302
185 Ga0495659_0013252 3300046664 Unclassified 2683
186 Ga0495588_0066849 3300046674 Bacteria 1866
187 Ga0495669_0007824 3300046684 Bacteria 4485
188 Ga0495670_0058608 3300046691 Bacteria 1933
189 Ga0495636_0020154 3300047318 Bacteria 2686
190 Ga0495672_0067024 3300047320 Bacteria 2046
191 Ga0496100_0073687 3300048903 Bacteria 2286
192 Ga0496101_0008981 3300048904 Bacteria 6550
193 Ga0496101_0076871 3300048904 Bacteria 2460
194 Ga0496104_0409448 3300048907 Bacteria 1268
195 Ga0496104_0519641 3300048907 Bacteria 1102
196 Ga0496104_0527795 3300048907 Bacteria 1091
197 Ga0496105_0164945 3300048908 Bacteria 1818
198 Ga0496106_0305847 3300048909 Bacteria 1275
199 Ga0496107_0204745 3300048910 Bacteria 1467
200 Ga0496108_0079872 3300048911 Bacteria 2770
201 Ga0496109_0199272 3300048912 Bacteria 1882
202 Ga0496110_0081712 3300048913 Bacteria 2881
203 Ga0496112_0055135 3300048915 Bacteria 3907
204 Ga0501039_0578585 3300049575 Unclassified 881
205 Ga0501040_0177780 3300049576 Bacteria 1508
206 Ga0501040_0270578 3300049576 Bacteria 1213
207 Ga0501067_0203108 3300049583 Bacteria 1104
208 Ga0501071_0182062 3300049587 Bacteria 1574
209 Ga0501075_0234820 3300049591 Bacteria 1398
210 Ga0501076_0183019 3300049592 Unclassified 1708
211 Ga0501081_0371684 3300049743 Unclassified 1056
212 nmdc:mga00v17_81326_c1 3300050491 Bacteria 2023
213 nmdc:mga0k408_106367_c1 3300050493 Bacteria 1657
214 nmdc:mga05p37_13950_c1 3300050507 Bacteria 9634
215 nmdc:mga05p37_40873_c1 3300050507 Unclassified 2795
216 nmdc:mga05p37_4724_c1 3300050507 Bacteria 15918
217 nmdc:mga05p37_791949_c1 3300050507 Bacteria 1038
218 nmdc:mga05p37_92453_c1 3300050507 Bacteria 3727
219 nmdc:mga0qj67_9011_c1 3300050509 Bacteria 7402
220 nmdc:mga08y16_12057_c1 3300050511 Bacteria 9083
221 nmdc:mga08y16_368754_c1 3300050511 Bacteria 1473
222 nmdc:mga0n895_11596_c1 3300050512 Bacteria 7874
223 nmdc:mga0rr50_188646_c1 3300050513 Bacteria 1688
224 nmdc:mga0rr50_401022_c1 3300050513 Unclassified 1158
225 nmdc:mga0a205_166320_c1 3300050515 Unclassified 2101
226 nmdc:mga0a205_317868_c1 3300050515 Bacteria 1428
227 Ga0500568_0002711 3300053139 Bacteria 10275
228 Ga0500645_000010 3300053730 Bacteria 186517
229 Ga0500599_009686 3300053736 Bacteria 1265
230 Ga0590071_000022 3300059421 Bacteria 39680
231 Ga0590071_014151 3300059421 Unclassified 1870
232 Ga0590074_000699 3300059423 Bacteria 5111
233 Ga0590075_000084 3300059424 Bacteria 24119
234 Ga0590075_000645 3300059424 Bacteria 9270
235 Ga0590077_000137 3300059426 Bacteria 19920
236 Ga0590077_001045 3300059426 Bacteria 6870
237 Ga0501082_0263256 3300060353 Bacteria 1500
238 Ga0530510_0162558 3300061734 Bacteria 1652
239 Ga0075430_100000462
240 SwRhRL2b_contig_3350027
241 Ga0065704_10004668
242 Ga0065712_10187153
243 Ga0065715_10146598
244 Ga0065707_10003294
245 Ga0070676_10036127
246 Ga0070690_100099225
247 Ga0070670_100028496
248 Ga0070670_100029013
249 Ga0070670_100370062
250 Ga0068869_100158196
251 Ga0068869_100272656
252 Ga0070666_10173866
253 Ga0068868_100126203
254 Ga0070689_100002984
255 Ga0070687_100007223
256 Ga0070687_100034484
257 Ga0070669_100017720
258 Ga0070675_100001754
259 Ga0070675_100018145
260 Ga0070675_100065254
261 Ga0070671_100234464
262 Ga0070674_100065480
263 Ga0070673_100161695
264 Ga0070673_100195808
265 Ga0070673_100203672
266 Ga0070673_100342105
267 Ga0070688_100415083
268 Ga0070701_10004551
269 Ga0070701_10188882
270 Ga0070705_100024852
271 Ga0070705_100238943
272 Ga0070694_100418414
273 Ga0070708_100535445
274 Ga0070678_100004402
275 Ga0070678_100189090
276 Ga0068867_100004599
277 Ga0070707_100158434
278 Ga0070698_100205971
279 Ga0070699_100227597
280 Ga0070672_100024453
281 Ga0070672_100535071
282 Ga0070686_100102466
283 Ga0070686_100330056
284 Ga0070665_100013605
285 Ga0070704_100000381
286 Ga0070704_100132673
287 Ga0070664_100033622
288 Ga0070664_100054360
289 Ga0068857_100048838
290 Ga0068859_100028045
291 Ga0068859_100357205
292 Ga0068864_100035992
293 Ga0068864_100115751
294 Ga0068864_100140417
295 Ga0068864_100190429
296 Ga0068866_10139209
297 Ga0068861_100059668
298 Ga0068870_10020947
299 Ga0068870_10053694
300 Ga0068863_100108219
301 Ga0068863_100149476
302 Ga0068858_100005424
303 Ga0068858_100143503
304 Ga0068860_100026156
305 Ga0068860_100149452
306 Ga0068860_100255831
307 Ga0081539_10141208
308 Ga0075365_10449318
309 Ga0075368_10014761
310 Ga0075366_10179009
311 Ga0097621_100017255
312 Ga0068871_100011143
313 Ga0068871_100061199
314 Ga0075428_100001863
315 Ga0075428_100054128
316 Ga0075428_100366128
317 Ga0075433_10150953
318 Ga0075433_10356439
319 Ga0075434_100010560
320 Ga0097620_100028046
321 Ga0097620_100357200
322 Ga0075435_100083031
323 Ga0111539_10032258
324 Ga0111539_10206352
325 Ga0111539_10501342
326 Ga0105247_10073695
327 Ga0114129_10001486
328 Ga0114129_10005999
329 Ga0114129_10017938
330 Ga0114129_10018933
331 Ga0114129_10050810
332 Ga0114129_10188196
333 Ga0114129_10637823
334 Ga0105243_10049210
335 Ga0105242_10008317
336 Ga0105248_10028746
337 Ga0105248_10063427
338 Ga0105248_10240878
339 Ga0105238_10562175
340 Ga0105249_10122802
341 Ga0157374_10187090
342 Ga0163162_10213194
343 Ga0163162_10496678
344 Ga0157375_10002758
345 Ga0157375_10099069
346 Ga0157375_10379079
347 Ga0157375_10799843
348 Ga0157380_10185750
349 Ga0157377_10107803
350 Ga0157379_10067830
351 Ga0157379_10420826
352 Ga0157376_10199849
353 Ga0213876_10055168
354 Ga0207682_10146441
355 Ga0207710_10046825
356 Ga0207680_10137296
357 Ga0207643_10006744
358 Ga0207662_10007893
359 Ga0207662_10138464
360 Ga0207649_10353404
361 Ga0207681_10000916
362 Ga0207694_10230982
363 Ga0207650_10009390
364 Ga0207659_10002945
365 Ga0207659_10018399
366 Ga0207659_10098165
367 Ga0207659_10201358
368 Ga0207690_10291148
369 Ga0207686_10194150
370 Ga0207686_10234805
371 Ga0207709_10101355
372 Ga0207670_10002255
373 Ga0207669_10037467
374 Ga0207669_10214034
375 Ga0207669_10263303
376 Ga0207704_10016064
377 Ga0207711_10026369
378 Ga0207711_10238903
379 Ga0207689_10045952
380 Ga0207689_10092079
381 Ga0207679_10390713
382 Ga0207651_10032947
383 Ga0207651_10099812
384 Ga0207712_10255789
385 Ga0207677_10056395
386 Ga0207703_10027128
387 Ga0207641_10099635
388 Ga0207641_10377278
389 Ga0207648_10004366
390 Ga0207648_10456912
391 Ga0207676_10034605
392 Ga0207676_10053541
393 Ga0207676_10174899
394 Ga0207674_10027348
395 Ga0207674_10194758
396 Ga0207675_100011241
397 Ga0207675_100056246
398 Ga0207675_100515824
399 Ga0207683_10090486
400 Ga0207683_10133002
401 Ga0207428_10322511
402 Ga0268266_10018585
403 Ga0268266_10228062
404 Ga0268265_10000511
405 Ga0268264_10001648
406 Ga0268264_10084149
407 Ga0268264_10297219
408 Ga0268264_10312967
409 Ga0307408_100153907
410 Ga0307412_10360090
411 Ga0307415_100430608
412 Ga0373931_0093419
413 Ga0373937_0018641
414 Ga0373937_0446634
415 Ga0395905_0405211
416 Ga0436365_1149854
417 Ga0439439_0040479
418 Ga0439435_0002594
419 Ga0453684_0035037
420 Ga0451576_0064504
421 Ga0495629_0286352
422 Ga0495580_0078570
423 Ga0495659_0013252
424 Ga0495588_0066849
425 Ga0495669_0007824
426 Ga0495670_0058608
427 Ga0495636_0020154
428 Ga0495672_0067024
429 Ga0496100_0073687
430 Ga0496101_0008981
431 Ga0496101_0076871
432 Ga0496104_0409448
433 Ga0496104_0519641
434 Ga0496104_0527795
435 Ga0496105_0164945
436 Ga0496106_0305847
437 Ga0496107_0204745
438 Ga0496108_0079872
439 Ga0496109_0199272
440 Ga0496110_0081712
441 Ga0496112_0055135
442 Ga0501039_0578585
443 Ga0501040_0177780
444 Ga0501040_0270578
445 Ga0501067_0203108
446 Ga0501071_0182062
447 Ga0501075_0234820
448 Ga0501076_0183019
449 Ga0501081_0371684
450 nmdc:mga00v17_81326_c1
451 nmdc:mga0k408_106367_c1
452 nmdc:mga05p37_13950_c1
453 nmdc:mga05p37_40873_c1
454 nmdc:mga05p37_4724_c1
455 nmdc:mga05p37_791949_c1
456 nmdc:mga05p37_92453_c1
457 nmdc:mga0qj67_9011_c1
458 nmdc:mga08y16_12057_c1
459 nmdc:mga08y16_368754_c1
460 nmdc:mga0n895_11596_c1
461 nmdc:mga0rr50_188646_c1
462 nmdc:mga0rr50_401022_c1
463 nmdc:mga0a205_166320_c1
464 nmdc:mga0a205_317868_c1
465 Ga0500568_0002711
466 Ga0500645_000010
467 Ga0500599_009686
468 Ga0590071_000022
469 Ga0590071_014151
470 Ga0590074_000699
471 Ga0590075_000084
472 Ga0590075_000645
473 Ga0590077_000137
474 Ga0590077_001045
475 Ga0501082_0263256
476 Ga0530510_0162558

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

19

175

0.91

PF13641

Glyco_tranf_2_3

Glycosyltransferase like family 2

16

270

0.81

PF13632

Glyco_trans_2_3

Glycosyl transferase family group 2

97

282

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
6p61-assembly3.cif.gz_C structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.8318 6 231
6p61-assembly2.cif.gz_B structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.831 6 230
6p61-assembly3.cif.gz_C structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.8237 6 231
6p61-assembly2.cif.gz_B structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.8229 6 230
4d11-assembly4.cif.gz_F galnac-t2 crystal soaked with udp-5sgalnac, mea2 peptide and manganese (lower resolution dataset) 0.7605 4 229
ID Description Score Start End Superfamily
af_P9WMY3_4_248_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8748 9 236 3.90.550.10
af_A0A2R8QCE8_89_340_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8444 4 114 3.90.550.10
af_P9WMY3_4_248_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8151 9 236 3.90.550.10
af_P36667_1_231_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8042 9 232 3.90.550.10
af_P9WMX1_74_289_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8028 8 233 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A832JEQ0-F1-model_v4 Glycosyltransferase 0.9917 6 86 GO:0016740
AF-A0A3N9N933-F1-model_v4 Glycosyltransferase 0.9654 6 133 GO:0016757
AF-A0A7C1YUR3-F1-model_v4 Glycosyltransferase 0.9577 9 101
AF-A0A2V8C7B5-F1-model_v4 Glycosyltransferase family 2 protein 0.9474 42 273 GO:0016740
AF-A0A800AZC7-F1-model_v4 Glycosyltransferase family 2 protein 0.941 7 148 GO:0016740

Map