F350847

General Info

Members Datasets Scaffolds Average Seq Length
238 149 476 237

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100006646|Ga0075428_10000664613
Length 250
Sequence MELRGRVALVTGAGRRLGRALAAALAERGLTLALHHHASAEGAESLRDQIRGAGGQADCFAADLTDAHAALELPQRVERAFGRLDVLINSAAVMERLTLEETTIEQWDRILNLNLRSVFFCTQGAAPALRRRRGRVVNVADLAGLEPWPAFAAHSVSKAGVVMLTKVLALSLAPEVTVNAIAPGAVLVPEHYDESARSFLERTTPLRRIGAPTDVIGAVLYLLEAGDYVTGTVLVVDGGRLIRAGGGADV

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
58 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
59 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
60 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
61 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
62 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
63 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
64 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
65 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
66 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
67 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
68 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
69 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
70 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
71 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
72 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
73 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
74 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
75 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
76 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
77 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
78 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
79 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
80 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
81 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
82 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
83 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
84 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
85 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
86 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
87 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
88 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
89 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
90 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
91 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
92 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
93 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
94 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
95 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
96 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
97 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
98 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
99 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
100 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
101 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
102 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
103 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
104 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
105 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
106 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
107 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
108 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
109 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
110 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
111 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
112 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
113 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
114 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
115 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
116 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
117 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
118 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
119 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
120 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
121 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
122 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
123 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
124 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
125 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
126 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
127 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
130 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
131 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
132 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
135 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
136 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
137 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
138 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
139 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
140 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
141 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
142 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
143 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
144 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
145 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
146 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
147 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
148 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
149 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.94
Rhizosphere 97.06
Stem 0
Stem Tuber 0
Unclassified 9.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100006646 3300006844 Bacteria 12861
2 Ga0070670_100045848 3300005331 Bacteria 3758
3 Ga0070670_100714228 3300005331 Bacteria 902
4 Ga0070680_100346350 3300005336 Unclassified 1263
5 Ga0070687_100025326 3300005343 Bacteria 2845
6 Ga0070692_10001912 3300005345 Bacteria 7861
7 Ga0070709_10149183 3300005434 Unclassified 1614
8 Ga0070714_100011355 3300005435 Bacteria 7065
9 Ga0070701_10021443 3300005438 Bacteria 3084
10 Ga0070711_100001308 3300005439 Bacteria 13541
11 Ga0070705_100010233 3300005440 Bacteria 4688
12 Ga0070705_100061326 3300005440 Bacteria 2235
13 Ga0070705_100251894 3300005440 Unclassified 1240
14 Ga0070694_100001893 3300005444 Bacteria 12397
15 Ga0070694_100013353 3300005444 Bacteria 5130
16 Ga0070694_100075524 3300005444 Bacteria 2331
17 Ga0070694_100333357 3300005444 Bacteria 1171
18 Ga0070708_100000511 3300005445 Bacteria 29095
19 Ga0070708_100237771 3300005445 Bacteria 1710
20 Ga0070681_10005356 3300005458 Bacteria 12383
21 Ga0070681_10377129 3300005458 Bacteria 1329
22 Ga0070706_100003657 3300005467 Bacteria 15049
23 Ga0070706_100105543 3300005467 Bacteria 2621
24 Ga0070707_100001574 3300005468 Bacteria 22107
25 Ga0070707_100259299 3300005468 Bacteria 1691
26 Ga0070699_100004841 3300005518 Bacteria 11878
27 Ga0070699_100232630 3300005518 Bacteria 1644
28 Ga0070679_100008180 3300005530 Bacteria 9832
29 Ga0070679_100230343 3300005530 Unclassified 1812
30 Ga0070679_100780950 3300005530 Bacteria 898
31 Ga0070697_100001750 3300005536 Bacteria 16566
32 Ga0070697_100218805 3300005536 Bacteria 1623
33 Ga0070695_100012394 3300005545 Bacteria 5115
34 Ga0070695_100023689 3300005545 Bacteria 3778
35 Ga0070696_100190638 3300005546 Bacteria 1526
36 Ga0070693_100027663 3300005547 Unclassified 3076
37 Ga0070693_100113563 3300005547 Bacteria 1670
38 Ga0070665_100037741 3300005548 Bacteria 4857
39 Ga0070704_100006214 3300005549 Bacteria 7021
40 Ga0070704_100007572 3300005549 Bacteria 6470
41 Ga0068859_100384524 3300005617 Bacteria 1499
42 Ga0068861_100124341 3300005719 Bacteria 2085
43 Ga0070717_10188903 3300006028 Unclassified 1799
44 Ga0070712_100211612 3300006175 Bacteria 1529
45 Ga0075428_100092154 3300006844 Bacteria 3304
46 Ga0075428_100109013 3300006844 Bacteria 3018
47 Ga0075430_100008528 3300006846 Bacteria 8657
48 Ga0075430_100045813 3300006846 Bacteria 3694
49 Ga0075431_100332071 3300006847 Bacteria 1531
50 Ga0075434_100027226 3300006871 Bacteria 5610
51 Ga0075434_100449915 3300006871 Unclassified 1309
52 Ga0075434_100630894 3300006871 Bacteria 1090
53 Ga0075429_100022763 3300006880 Bacteria 5432
54 Ga0075429_100122714 3300006880 Bacteria 2271
55 Ga0097620_100384521 3300006931 Bacteria 1499
56 Ga0075435_100079067 3300007076 Bacteria 2698
57 Ga0075435_100145450 3300007076 Bacteria 1991
58 Ga0075435_100160145 3300007076 Bacteria 1895
59 Ga0099794_10000114 3300007265 Bacteria 29466
60 Ga0114129_10000442 3300009147 Bacteria 49250
61 Ga0114129_10570619 3300009147 Bacteria 1469
62 Ga0114129_10603921 3300009147 Bacteria 1421
63 Ga0105237_10087741 3300009545 Bacteria 3100
64 Ga0105238_10023014 3300009551 Bacteria 6353
65 Ga0105238_10195250 3300009551 Unclassified 2000
66 Ga0157369_10511712 3300013105 Unclassified 1242
67 Ga0157374_10060563 3300013296 Unclassified 3543
68 Ga0157372_10135147 3300013307 Bacteria 2839
69 Ga0163163_10210474 3300014325 Unclassified 1994
70 Ga0207684_10008479 3300025910 Bacteria 9143
71 Ga0207707_10008059 3300025912 Bacteria 9149
72 Ga0207707_10025801 3300025912 Bacteria 5139
73 Ga0207707_10297057 3300025912 Bacteria 1397
74 Ga0207707_10617592 3300025912 Unclassified 916
75 Ga0207671_10079862 3300025914 Bacteria 2451
76 Ga0207693_10006364 3300025915 Bacteria 9784
77 Ga0207663_10004868 3300025916 Bacteria 6720
78 Ga0207660_10014498 3300025917 Bacteria 5185
79 Ga0207660_10026294 3300025917 Bacteria 3962
80 Ga0207660_10391529 3300025917 Unclassified 1118
81 Ga0207662_10080120 3300025918 Bacteria 1991
82 Ga0207652_10116060 3300025921 Bacteria 2378
83 Ga0207652_10180938 3300025921 Unclassified 1895
84 Ga0207646_10679257 3300025922 Bacteria 922
85 Ga0207694_10012671 3300025924 Bacteria 6353
86 Ga0207687_10302207 3300025927 Bacteria 1289
87 Ga0207689_10386879 3300025942 Bacteria 1165
88 Ga0207708_10135777 3300026075 Bacteria 1926
89 Ga0209588_1002137 3300027671 Bacteria 5331
90 Ga0268266_10037419 3300028379 Bacteria 4134
91 Ga0307408_100131102 3300031548 Bacteria 1956
92 Ga0307408_100520161 3300031548 Bacteria 1045
93 Ga0307413_10040223 3300031824 Bacteria 2726
94 Ga0307413_10108877 3300031824 Bacteria 1850
95 Ga0307410_10006094 3300031852 Bacteria 6467
96 Ga0307410_10140858 3300031852 Bacteria 1784
97 Ga0307407_10007873 3300031903 Bacteria 4855
98 Ga0307407_10047955 3300031903 Bacteria 2428
99 Ga0307407_10197956 3300031903 Bacteria 1344
100 Ga0307407_10501661 3300031903 Bacteria 890
101 Ga0307412_10025079 3300031911 Bacteria 3688
102 Ga0307412_10482056 3300031911 Bacteria 1029
103 Ga0307409_100022428 3300031995 Bacteria 4354
104 Ga0307409_100096574 3300031995 Bacteria 2438
105 Ga0307409_100166705 3300031995 Bacteria 1934
106 Ga0307416_100051555 3300032002 Bacteria 3288
107 Ga0307416_100110624 3300032002 Bacteria 2419
108 Ga0307416_100218414 3300032002 Bacteria 1826
109 Ga0307414_10201238 3300032004 Bacteria 1620
110 Ga0307414_10246810 3300032004 Bacteria 1481
111 Ga0307411_10065071 3300032005 Bacteria 2444
112 Ga0307411_10120737 3300032005 Bacteria 1895
113 Ga0307411_10121456 3300032005 Bacteria 1891
114 Ga0307415_100019459 3300032126 Bacteria 4122
115 Ga0307415_100050595 3300032126 Bacteria 2816
116 Ga0307415_100551299 3300032126 Bacteria 1017
117 Ga0307415_100867155 3300032126 Unclassified 830
118 Ga0373926_0001102 3300035083 Bacteria 7978
119 Ga0373934_0000462 3300035086 Bacteria 14216
120 Ga0373944_0004374 3300035089 Unclassified 3676
121 Ga0373923_0007126 3300035111 Bacteria 3915
122 Ga0373945_0001976 3300035116 Bacteria 6371
123 Ga0373953_0009543 3300035117 Unclassified 3346
124 Ga0373954_0052815 3300035118 Bacteria 1910
125 Ga0373954_0062551 3300035118 Bacteria 1758
126 Ga0373957_0034702 3300035120 Bacteria 1870
127 Ga0373943_0023721 3300035170 Unclassified 2854
128 Ga0373946_0003385 3300035171 Bacteria 5659
129 Ga0373935_0041611 3300035692 Bacteria 2887
130 Ga0373927_0000762 3300035695 Bacteria 24625
131 Ga0373933_0000613 3300035724 Bacteria 22271
132 Ga0373947_0000019 3300035725 Bacteria 101479
133 Ga0373937_0000142 3300036401 Bacteria 69511
134 Ga0316584_0167176 3300036712 Unclassified 1633
135 Ga0373925_0000303 3300037068 Bacteria 51655
136 Ga0373925_0115750 3300037068 Bacteria 2076
137 Ga0451807_1938167 3300041486 Bacteria 2334
138 Ga0451576_0003242 3300045051 Bacteria 22618
139 Ga0466967_0242589 3300045976 Unclassified 1719
140 Ga0495592_0001570 3300046454 Bacteria 15958
141 Ga0495592_0162296 3300046454 Bacteria 1536
142 Ga0495603_0008077 3300046455 Bacteria 6359
143 Ga0495629_0009545 3300046459 Bacteria 7093
144 Ga0495629_0051808 3300046459 Bacteria 2872
145 Ga0495651_0000714 3300046462 Bacteria 25773
146 Ga0495651_0009911 3300046462 Bacteria 7327
147 Ga0495653_0000814 3300046463 Bacteria 23936
148 Ga0495653_0002139 3300046463 Bacteria 15584
149 Ga0495580_0000268 3300046472 Bacteria 41849
150 Ga0495580_0005901 3300046472 Bacteria 10048
151 Ga0495582_0000045 3300046473 Bacteria 62705
152 Ga0495582_0069398 3300046473 Bacteria 1949
153 Ga0495639_0002047 3300046475 Bacteria 8925
154 Ga0495639_0012394 3300046475 Bacteria 3677
155 Ga0495662_0140246 3300046476 Bacteria 1190
156 Ga0495664_0040889 3300046477 Bacteria 2742
157 Ga0495594_0014896 3300046499 Bacteria 4081
158 Ga0495608_0000447 3300046511 Bacteria 28746
159 Ga0495608_0004032 3300046511 Bacteria 10542
160 Ga0495618_0087751 3300046514 Bacteria 1989
161 Ga0495628_0000674 3300046516 Bacteria 31380
162 Ga0495628_0031707 3300046516 Bacteria 4274
163 Ga0495630_0000984 3300046517 Bacteria 19802
164 Ga0495630_0098067 3300046517 Bacteria 2217
165 Ga0495652_0001899 3300046529 Bacteria 22213
166 Ga0495652_0064453 3300046529 Bacteria 3081
167 Ga0495665_0000014 3300046531 Bacteria 67903
168 Ga0495665_0250125 3300046531 Bacteria 912
169 Ga0495640_0060597 3300046533 Bacteria 2573
170 Ga0495587_0000260 3300046536 Bacteria 37943
171 Ga0495587_0000908 3300046536 Bacteria 19559
172 Ga0495645_0000095 3300046543 Bacteria 61733
173 Ga0495645_0068660 3300046543 Unclassified 2558
174 Ga0495667_0139831 3300046559 Bacteria 1560
175 Ga0495667_0268800 3300046559 Bacteria 1083
176 Ga0495635_0009109 3300046663 Bacteria 6930
177 Ga0495635_0028466 3300046663 Bacteria 3884
178 Ga0495659_0188625 3300046664 Bacteria 842
179 Ga0495588_0001705 3300046674 Bacteria 9352
180 Ga0495657_0001516 3300046675 Bacteria 20003
181 Ga0495599_0000524 3300046678 Bacteria 22058
182 Ga0495599_0005254 3300046678 Bacteria 7725
183 Ga0495623_0015703 3300046679 Bacteria 4893
184 Ga0495623_0046025 3300046679 Bacteria 2769
185 Ga0495646_0031109 3300046680 Bacteria 3329
186 Ga0495646_0152308 3300046680 Bacteria 1285
187 Ga0495658_0000038 3300046683 Bacteria 65836
188 Ga0495658_0041701 3300046683 Bacteria 2559
189 Ga0495613_0012775 3300046689 Bacteria 6244
190 Ga0495613_0090726 3300046689 Bacteria 2213
191 Ga0495600_0000452 3300046809 Bacteria 21257
192 Ga0495600_0087881 3300046809 Bacteria 2028
193 Ga0495581_0001095 3300047315 Bacteria 14771
194 Ga0495581_0090810 3300047315 Bacteria 1772
195 Ga0495604_0001358 3300047317 Bacteria 20008
196 Ga0495604_0003664 3300047317 Bacteria 12245
197 Ga0495674_0040829 3300047319 Bacteria 4147
198 Ga0495680_0001760 3300047322 Bacteria 22952
199 Ga0495680_0102165 3300047322 Bacteria 2135
200 Ga0495675_0008401 3300047444 Bacteria 6393
201 Ga0495684_0007377 3300047471 Bacteria 8523
202 Ga0495684_0010377 3300047471 Bacteria 7202
203 Ga0495684_0039066 3300047471 Bacteria 3638
204 Ga0495593_0000188 3300047673 Bacteria 32373
205 Ga0495602_0001539 3300048088 Bacteria 22950
206 Ga0495614_0000013 3300048089 Bacteria 57032
207 Ga0496102_0062725 3300048905 Bacteria 3404
208 Ga0496104_0122364 3300048907 Bacteria 2498
209 Ga0496104_0926461 3300048907 Bacteria 776
210 Ga0496105_0323138 3300048908 Unclassified 1236
211 Ga0496114_0158393 3300048917 Bacteria 1967
212 Ga0496115_0281701 3300048918 Bacteria 1365
213 Ga0501034_0203686 3300049571 Bacteria 1936
214 Ga0501034_0649223 3300049571 Unclassified 957
215 Ga0501034_0873901 3300049571 Bacteria 788
216 Ga0501048_0648412 3300049582 Bacteria 758
217 Ga0501067_0091936 3300049583 Bacteria 1684
218 Ga0501069_0042969 3300049585 Bacteria 2501
219 Ga0501209_027108 3300049656 Bacteria 1420
220 Ga0501225_0012414 3300049705 Bacteria 2394
221 Ga0501273_008354 3300049770 Bacteria 1239
222 Ga0501212_015755 3300049851 Bacteria 1130
223 nmdc:mga05p37_302902_c1 3300050507 Bacteria 1898
224 nmdc:mga05p37_558_c1 3300050507 Bacteria 40956
225 nmdc:mga05p37_859603_c1 3300050507 Bacteria 984
226 nmdc:mga09592_116677_c1 3300050508 Bacteria 2291
227 nmdc:mga09592_616934_c1 3300050508 Bacteria 928
228 nmdc:mga0qj67_22064_c1 3300050509 Bacteria 4887
229 nmdc:mga06r32_89855_c1 3300050510 Bacteria 3000
230 nmdc:mga0n895_25277_c1 3300050512 Bacteria 5609
231 nmdc:mga0n895_596735_c1 3300050512 Bacteria 1107
232 nmdc:mga0rr50_152732_c1 3300050513 Bacteria 1867
233 nmdc:mga0rr50_36337_c1 3300050513 Bacteria 3547
234 nmdc:mga0a205_151016_c1 3300050515 Bacteria 2222
235 Ga0495601_0006950 3300053077 Bacteria 6628
236 Ga0495612_0000583 3300053078 Bacteria 14687
237 Ga0495619_0003561 3300053085 Bacteria 10046
238 Ga0495619_0035966 3300053085 Bacteria 3223
239 Ga0075428_100006646
240 Ga0070670_100045848
241 Ga0070670_100714228
242 Ga0070680_100346350
243 Ga0070687_100025326
244 Ga0070692_10001912
245 Ga0070709_10149183
246 Ga0070714_100011355
247 Ga0070701_10021443
248 Ga0070711_100001308
249 Ga0070705_100010233
250 Ga0070705_100061326
251 Ga0070705_100251894
252 Ga0070694_100001893
253 Ga0070694_100013353
254 Ga0070694_100075524
255 Ga0070694_100333357
256 Ga0070708_100000511
257 Ga0070708_100237771
258 Ga0070681_10005356
259 Ga0070681_10377129
260 Ga0070706_100003657
261 Ga0070706_100105543
262 Ga0070707_100001574
263 Ga0070707_100259299
264 Ga0070699_100004841
265 Ga0070699_100232630
266 Ga0070679_100008180
267 Ga0070679_100230343
268 Ga0070679_100780950
269 Ga0070697_100001750
270 Ga0070697_100218805
271 Ga0070695_100012394
272 Ga0070695_100023689
273 Ga0070696_100190638
274 Ga0070693_100027663
275 Ga0070693_100113563
276 Ga0070665_100037741
277 Ga0070704_100006214
278 Ga0070704_100007572
279 Ga0068859_100384524
280 Ga0068861_100124341
281 Ga0070717_10188903
282 Ga0070712_100211612
283 Ga0075428_100092154
284 Ga0075428_100109013
285 Ga0075430_100008528
286 Ga0075430_100045813
287 Ga0075431_100332071
288 Ga0075434_100027226
289 Ga0075434_100449915
290 Ga0075434_100630894
291 Ga0075429_100022763
292 Ga0075429_100122714
293 Ga0097620_100384521
294 Ga0075435_100079067
295 Ga0075435_100145450
296 Ga0075435_100160145
297 Ga0099794_10000114
298 Ga0114129_10000442
299 Ga0114129_10570619
300 Ga0114129_10603921
301 Ga0105237_10087741
302 Ga0105238_10023014
303 Ga0105238_10195250
304 Ga0157369_10511712
305 Ga0157374_10060563
306 Ga0157372_10135147
307 Ga0163163_10210474
308 Ga0207684_10008479
309 Ga0207707_10008059
310 Ga0207707_10025801
311 Ga0207707_10297057
312 Ga0207707_10617592
313 Ga0207671_10079862
314 Ga0207693_10006364
315 Ga0207663_10004868
316 Ga0207660_10014498
317 Ga0207660_10026294
318 Ga0207660_10391529
319 Ga0207662_10080120
320 Ga0207652_10116060
321 Ga0207652_10180938
322 Ga0207646_10679257
323 Ga0207694_10012671
324 Ga0207687_10302207
325 Ga0207689_10386879
326 Ga0207708_10135777
327 Ga0209588_1002137
328 Ga0268266_10037419
329 Ga0307408_100131102
330 Ga0307408_100520161
331 Ga0307413_10040223
332 Ga0307413_10108877
333 Ga0307410_10006094
334 Ga0307410_10140858
335 Ga0307407_10007873
336 Ga0307407_10047955
337 Ga0307407_10197956
338 Ga0307407_10501661
339 Ga0307412_10025079
340 Ga0307412_10482056
341 Ga0307409_100022428
342 Ga0307409_100096574
343 Ga0307409_100166705
344 Ga0307416_100051555
345 Ga0307416_100110624
346 Ga0307416_100218414
347 Ga0307414_10201238
348 Ga0307414_10246810
349 Ga0307411_10065071
350 Ga0307411_10120737
351 Ga0307411_10121456
352 Ga0307415_100019459
353 Ga0307415_100050595
354 Ga0307415_100551299
355 Ga0307415_100867155
356 Ga0373926_0001102
357 Ga0373934_0000462
358 Ga0373944_0004374
359 Ga0373923_0007126
360 Ga0373945_0001976
361 Ga0373953_0009543
362 Ga0373954_0052815
363 Ga0373954_0062551
364 Ga0373957_0034702
365 Ga0373943_0023721
366 Ga0373946_0003385
367 Ga0373935_0041611
368 Ga0373927_0000762
369 Ga0373933_0000613
370 Ga0373947_0000019
371 Ga0373937_0000142
372 Ga0316584_0167176
373 Ga0373925_0000303
374 Ga0373925_0115750
375 Ga0451807_1938167
376 Ga0451576_0003242
377 Ga0466967_0242589
378 Ga0495592_0001570
379 Ga0495592_0162296
380 Ga0495603_0008077
381 Ga0495629_0009545
382 Ga0495629_0051808
383 Ga0495651_0000714
384 Ga0495651_0009911
385 Ga0495653_0000814
386 Ga0495653_0002139
387 Ga0495580_0000268
388 Ga0495580_0005901
389 Ga0495582_0000045
390 Ga0495582_0069398
391 Ga0495639_0002047
392 Ga0495639_0012394
393 Ga0495662_0140246
394 Ga0495664_0040889
395 Ga0495594_0014896
396 Ga0495608_0000447
397 Ga0495608_0004032
398 Ga0495618_0087751
399 Ga0495628_0000674
400 Ga0495628_0031707
401 Ga0495630_0000984
402 Ga0495630_0098067
403 Ga0495652_0001899
404 Ga0495652_0064453
405 Ga0495665_0000014
406 Ga0495665_0250125
407 Ga0495640_0060597
408 Ga0495587_0000260
409 Ga0495587_0000908
410 Ga0495645_0000095
411 Ga0495645_0068660
412 Ga0495667_0139831
413 Ga0495667_0268800
414 Ga0495635_0009109
415 Ga0495635_0028466
416 Ga0495659_0188625
417 Ga0495588_0001705
418 Ga0495657_0001516
419 Ga0495599_0000524
420 Ga0495599_0005254
421 Ga0495623_0015703
422 Ga0495623_0046025
423 Ga0495646_0031109
424 Ga0495646_0152308
425 Ga0495658_0000038
426 Ga0495658_0041701
427 Ga0495613_0012775
428 Ga0495613_0090726
429 Ga0495600_0000452
430 Ga0495600_0087881
431 Ga0495581_0001095
432 Ga0495581_0090810
433 Ga0495604_0001358
434 Ga0495604_0003664
435 Ga0495674_0040829
436 Ga0495680_0001760
437 Ga0495680_0102165
438 Ga0495675_0008401
439 Ga0495684_0007377
440 Ga0495684_0010377
441 Ga0495684_0039066
442 Ga0495593_0000188
443 Ga0495602_0001539
444 Ga0495614_0000013
445 Ga0496102_0062725
446 Ga0496104_0122364
447 Ga0496104_0926461
448 Ga0496105_0323138
449 Ga0496114_0158393
450 Ga0496115_0281701
451 Ga0501034_0203686
452 Ga0501034_0649223
453 Ga0501034_0873901
454 Ga0501048_0648412
455 Ga0501067_0091936
456 Ga0501069_0042969
457 Ga0501209_027108
458 Ga0501225_0012414
459 Ga0501273_008354
460 Ga0501212_015755
461 nmdc:mga05p37_302902_c1
462 nmdc:mga05p37_558_c1
463 nmdc:mga05p37_859603_c1
464 nmdc:mga09592_116677_c1
465 nmdc:mga09592_616934_c1
466 nmdc:mga0qj67_22064_c1
467 nmdc:mga06r32_89855_c1
468 nmdc:mga0n895_25277_c1
469 nmdc:mga0n895_596735_c1
470 nmdc:mga0rr50_152732_c1
471 nmdc:mga0rr50_36337_c1
472 nmdc:mga0a205_151016_c1
473 Ga0495601_0006950
474 Ga0495612_0000583
475 Ga0495619_0003561
476 Ga0495619_0035966

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

6

197

0.97

PF08659

KR

KR domain

7

117

0.93

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

12

240

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3sj7-assembly1.cif.gz_B-2 structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with nadph 0.9536 6 238
3osu-assembly1.cif.gz_A crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus 0.9531 6 238
4jro-assembly1.cif.gz_C crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg)from listeria monocytogenes in complex with nadp+ 0.9476 1 238
2uvd-assembly1.cif.gz_C the crystal structure of a 3-oxoacyl-(acyl carrier protein) reductase from bacillus anthracis (ba3989) 0.9475 3 238
2ph3-assembly1.cif.gz_A-2 crystal structure of 3-oxoacyl-[acyl carrier protein] reductase ttha0415 from thermus thermophilus 0.9447 6 238
ID Description Score Start End Superfamily
af_B7FAC8_69_312_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9468 5 238 3.40.50.720
4cqmK00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9406 6 241 3.40.50.720
4nbwD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9401 6 238 3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9393 3 184 3.40.50.720
3ay6A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9388 3 238 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A524HHS5-F1-model_v4 SDR family oxidoreductase 0.9855 1 242
AF-A0A1Q7XW50-F1-model_v4 Short-chain dehydrogenase 0.984 1 161
AF-A0A524PG83-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9792 1 184
AF-A0A524HHS5-F1-model_v4 SDR family oxidoreductase 0.9775 1 242
AF-A0A2V7WDN7-F1-model_v4 Dehydrogenase 0.9761 2 241

Map