F350780

General Info

Members Datasets Scaffolds Average Seq Length
238 165 476 481

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100007679|Ga0070665_1000076797
Length 519
Sequence MVQRAKSGKLWLENVALPFRGAFARKGWSSLIAAALLAGTAAVYAAPRANHVSGGQEKEAARNVQSDQATSLSDQTDLSVTVYNSNIALIRDVRNLSLPAGNFRLKLMDIAATVNPATVHFRSLNEPDKLGILEQNYEYDLLEPAKLLHKYVGKEVTLVRSYMDNGTTKREEIKATLLSDNNGPVWKIGNDIVTGGYAESYRFPEVPPNLFDRPTLLMSLENSGSRKQQVETSYLANSLSWNSDYVLTVGRDDKAADLDGWVTLSNNSGTAFHNARLQLVAGDLNRVQPAAVGGVARDMVMAKAERAIQFAQENFSEYHLYTLGRKTSVEDKETKQISLLQGSNIPVEKHFVVNGQNFYYHNQQNPGTPIKDNVMVFYKFRNEEKSSLGMPMPAGTVRVYQKDSKGNVLFVGEDRIDHTPKDEALNIHIGNAFDVISERKQTDYKRIDTHVWEMEFEITLRNHKDTPVTIEVNEPIGGDWEMINSTYKYTKTAAWAAQFNVPVAANGTSVLKYRIRARW

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
88 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
94 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
95 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
99 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
100 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
101 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
102 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
103 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
104 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
105 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
106 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
107 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
108 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
118 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
121 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
122 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
123 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
124 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
125 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
126 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
127 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
128 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
129 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
130 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
131 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
132 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
133 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
134 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
135 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
136 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
137 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
138 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
139 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
140 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
141 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
142 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
143 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
144 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
145 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
146 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
147 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
148 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
149 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
150 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
151 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
152 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
153 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
157 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
158 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
161 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
162 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
163 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
164 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
165 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.32
Metatranscriptomes 1.68
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.26
Nodule 0
Rhizoplane 1.68
Rhizosphere 96.64
Stem 0
Stem Tuber 0
Unclassified 13.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100007679 3300005548 Bacteria 10957
2 JGI24740J21852_10004249 3300001979 Bacteria 6170
3 JGI24740J21852_10024641 3300001979 Bacteria 2039
4 JGI24738J21930_10002480 3300002075 Bacteria 4820
5 Ga0070670_100005395 3300005331 Bacteria 10790
6 Ga0070670_100014280 3300005331 Bacteria 6814
7 Ga0070666_10007627 3300005335 Bacteria 6677
8 Ga0068868_100113482 3300005338 Bacteria 2203
9 Ga0070660_100010193 3300005339 Bacteria 6634
10 Ga0070661_100027520 3300005344 Bacteria 4095
11 Ga0070661_100041205 3300005344 Bacteria 3370
12 Ga0070668_100008319 3300005347 Bacteria 7702
13 Ga0070674_100042213 3300005356 Unclassified 3096
14 Ga0070673_100015260 3300005364 Bacteria 5389
15 Ga0070659_100146744 3300005366 Bacteria 1922
16 Ga0070667_100006043 3300005367 Bacteria 10059
17 Ga0070709_10007697 3300005434 Bacteria 5913
18 Ga0070709_10019948 3300005434 Unclassified 3884
19 Ga0070713_100064056 3300005436 Bacteria 3084
20 Ga0070711_100007822 3300005439 Bacteria 6514
21 Ga0070711_100049523 3300005439 Unclassified 2877
22 Ga0070711_100081262 3300005439 Unclassified 2310
23 Ga0070694_100005301 3300005444 Bacteria 7799
24 Ga0070708_100004956 3300005445 Bacteria 10524
25 Ga0070708_100147896 3300005445 Bacteria 2183
26 Ga0070663_100006715 3300005455 Bacteria 6942
27 Ga0070678_100131490 3300005456 Bacteria 1989
28 Ga0070662_100007194 3300005457 Bacteria 7209
29 Ga0070681_10166780 3300005458 Bacteria 2125
30 Ga0070706_100041019 3300005467 Bacteria 4273
31 Ga0070707_100001114 3300005468 Bacteria 26522
32 Ga0070698_100055957 3300005471 Unclassified 3998
33 Ga0070698_100068174 3300005471 Unclassified 3576
34 Ga0070698_100116509 3300005471 Bacteria 2635
35 Ga0070679_100016349 3300005530 Bacteria 7154
36 Ga0070697_100001294 3300005536 Bacteria 18842
37 Ga0070697_100003365 3300005536 Bacteria 12291
38 Ga0070697_100219117 3300005536 Bacteria 1622
39 Ga0068853_100020145 3300005539 Bacteria 5544
40 Ga0068853_100098247 3300005539 Bacteria 2585
41 Ga0068853_100211625 3300005539 Bacteria 1767
42 Ga0070695_100006120 3300005545 Bacteria 7109
43 Ga0070696_100059850 3300005546 Unclassified 2662
44 Ga0070696_100109905 3300005546 Bacteria 1984
45 Ga0070665_100012313 3300005548 Bacteria 8621
46 Ga0070704_100022371 3300005549 Unclassified 4112
47 Ga0068855_100055551 3300005563 Bacteria 4650
48 Ga0068855_100067227 3300005563 Bacteria 4176
49 Ga0070664_100009732 3300005564 Bacteria 7791
50 Ga0068857_100015473 3300005577 Bacteria 6664
51 Ga0068854_100049878 3300005578 Bacteria 2993
52 Ga0068863_100005791 3300005841 Bacteria 12117
53 Ga0068860_100006993 3300005843 Bacteria 11304
54 Ga0081539_10038954 3300005985 Bacteria 2810
55 Ga0075368_10007473 3300006042 Bacteria 3854
56 Ga0070716_100012950 3300006173 Unclassified 4240
57 Ga0075367_10029551 3300006178 Bacteria 3136
58 Ga0075366_10002028 3300006195 Bacteria 10278
59 Ga0097621_100012271 3300006237 Bacteria 6341
60 Ga0097621_100014034 3300006237 Bacteria 5986
61 Ga0068871_100000644 3300006358 Bacteria 24010
62 Ga0075431_100169089 3300006847 Bacteria 2247
63 Ga0075434_100018243 3300006871 Bacteria 6777
64 Ga0075436_100002382 3300006914 Bacteria 12963
65 Ga0075435_100016345 3300007076 Bacteria 5595
66 Ga0099794_10021855 3300007265 Bacteria 2911
67 Ga0105242_10195144 3300009176 Unclassified 1795
68 Ga0105248_10049674 3300009177 Bacteria 4704
69 Ga0105248_10128796 3300009177 Bacteria 2855
70 Ga0105237_10083303 3300009545 Bacteria 3189
71 Ga0105237_10139474 3300009545 Bacteria 2419
72 Ga0099796_10014681 3300010159 Unclassified 2269
73 Ga0105239_10129724 3300010375 Bacteria 2803
74 Ga0157374_10014089 3300013296 Bacteria 6990
75 Ga0157374_10189530 3300013296 Bacteria 2011
76 Ga0157378_10000044 3300013297 Bacteria 106822
77 Ga0157378_10090933 3300013297 Bacteria 2774
78 Ga0157372_10042719 3300013307 Bacteria 5016
79 Ga0157376_10000017 3300014969 Bacteria 268501
80 Ga0157376_10047590 3300014969 Bacteria 3541
81 Ga0207653_10027028 3300025885 Bacteria 1841
82 Ga0207688_10026911 3300025901 Bacteria 3164
83 Ga0207647_10011782 3300025904 Bacteria 6115
84 Ga0207699_10118594 3300025906 Unclassified 1708
85 Ga0207705_10118243 3300025909 Bacteria 1964
86 Ga0207705_10131868 3300025909 Bacteria 1860
87 Ga0207707_10058978 3300025912 Bacteria 3339
88 Ga0207693_10033202 3300025915 Bacteria 4073
89 Ga0207663_10019546 3300025916 Bacteria 3819
90 Ga0207663_10100536 3300025916 Unclassified 1941
91 Ga0207657_10012562 3300025919 Bacteria 8350
92 Ga0207657_10019107 3300025919 Bacteria 6518
93 Ga0207649_10083623 3300025920 Bacteria 2072
94 Ga0207652_10011415 3300025921 Bacteria 7162
95 Ga0207652_10185141 3300025921 Bacteria 1872
96 Ga0207646_10000152 3300025922 Bacteria 95335
97 Ga0207646_10000572 3300025922 Bacteria 48197
98 Ga0207690_10080704 3300025932 Bacteria 2270
99 Ga0207706_10011739 3300025933 Bacteria 7981
100 Ga0207706_10012837 3300025933 Bacteria 7626
101 Ga0207706_10018110 3300025933 Bacteria 6337
102 Ga0207706_10048394 3300025933 Bacteria 3760
103 Ga0207686_10135619 3300025934 Unclassified 1694
104 Ga0207665_10000023 3300025939 Bacteria 104745
105 Ga0207665_10025352 3300025939 Unclassified 3911
106 Ga0207665_10038161 3300025939 Bacteria 3198
107 Ga0207665_10116764 3300025939 Unclassified 1881
108 Ga0207711_10028552 3300025941 Bacteria 4696
109 Ga0207679_10005348 3300025945 Bacteria 8048
110 Ga0207667_10117843 3300025949 Bacteria 2736
111 Ga0207658_10014018 3300025986 Bacteria 5486
112 Ga0207678_10000487 3300026067 Bacteria 35968
113 Ga0207678_10016987 3300026067 Bacteria 6388
114 Ga0207678_10017026 3300026067 Bacteria 6383
115 Ga0207678_10022098 3300026067 Bacteria 5574
116 Ga0207641_10005287 3300026088 Bacteria 11030
117 Ga0207674_10002967 3300026116 Bacteria 21070
118 Ga0207674_10023732 3300026116 Bacteria 6564
119 Ga0207698_10104224 3300026142 Bacteria 2359
120 Ga0209588_1008716 3300027671 Bacteria 3014
121 Ga0265354_1000134 3300028016 Bacteria 13215
122 Ga0268266_10000444 3300028379 Bacteria 61604
123 Ga0268266_10005597 3300028379 Bacteria 11667
124 Ga0268266_10007113 3300028379 Bacteria 10153
125 Ga0268264_10004923 3300028381 Bacteria 11317
126 Ga0265338_10063796 3300028800 Unclassified 3210
127 Ga0265770_1000434 3300030878 Bacteria 5738
128 Ga0265760_10001273 3300031090 Bacteria 7373
129 Ga0265760_10005106 3300031090 Bacteria 3759
130 Ga0265760_10019779 3300031090 Bacteria 1941
131 Ga0307408_100009450 3300031548 Bacteria 6432
132 Ga0307408_100017267 3300031548 Bacteria 4827
133 Ga0316576_10107538 3300031727 Bacteria 2089
134 Ga0307405_10014570 3300031731 Bacteria 4231
135 Ga0307405_10087652 3300031731 Unclassified 2052
136 Ga0307413_10034484 3300031824 Bacteria 2893
137 Ga0307413_10074614 3300031824 Bacteria 2149
138 Ga0307410_10018997 3300031852 Bacteria 4169
139 Ga0307410_10058204 3300031852 Bacteria 2634
140 Ga0307406_10014893 3300031901 Bacteria 4484
141 Ga0307412_10025940 3300031911 Unclassified 3637
142 Ga0307416_100043335 3300032002 Bacteria 3522
143 Ga0307416_100054318 3300032002 Bacteria 3219
144 Ga0307416_100055851 3300032002 Bacteria 3182
145 Ga0307414_10017980 3300032004 Unclassified 4338
146 Ga0307411_10067062 3300032005 Bacteria 2413
147 Ga0307411_10142034 3300032005 Bacteria 1772
148 Ga0307415_100054324 3300032126 Bacteria 2733
149 Ga0307415_100082194 3300032126 Bacteria 2304
150 Ga0316212_1004168 3300033547 Bacteria 2096
151 Ga0373926_0009383 3300035083 Unclassified 3270
152 Ga0373934_0001183 3300035086 Bacteria 9477
153 Ga0373953_0002566 3300035117 Bacteria 5492
154 Ga0373955_0000159 3300035172 Bacteria 27173
155 Ga0373927_0000264 3300035695 Bacteria 41466
156 Ga0373933_0001856 3300035724 Bacteria 12223
157 Ga0373933_0041049 3300035724 Unclassified 2729
158 Ga0373947_0000931 3300035725 Bacteria 17783
159 Ga0373937_0000214 3300036401 Bacteria 55908
160 Ga0373937_0002092 3300036401 Bacteria 16701
161 Ga0316584_0030779 3300036712 Bacteria 3966
162 Ga0373925_0000415 3300037068 Bacteria 43312
163 Ga0373925_0168585 3300037068 Unclassified 1728
164 Ga0395899_0102389 3300037312 Bacteria 2066
165 Ga0395900_0011270 3300037418 Bacteria 9144
166 Ga0395900_0030220 3300037418 Bacteria 5562
167 Ga0395900_0172586 3300037418 Bacteria 2200
168 Ga0395898_0061392 3300037466 Bacteria 3651
169 Ga0395905_0252675 3300037471 Bacteria 1647
170 Ga0395901_0000131 3300038443 Bacteria 96504
171 Ga0395901_0259066 3300038443 Bacteria 1810
172 Ga0439449_0013866 3300042007 Bacteria 3031
173 Ga0453684_0078806 3300044712 Bacteria 4121
174 Ga0466967_0014063 3300045976 Bacteria 6216
175 Ga0495603_0039806 3300046455 Bacteria 2815
176 Ga0495629_0010234 3300046459 Bacteria 6832
177 Ga0495651_0002040 3300046462 Bacteria 15608
178 Ga0495651_0003173 3300046462 Bacteria 12635
179 Ga0495653_0022445 3300046463 Bacteria 5108
180 Ga0495580_0003373 3300046472 Bacteria 13649
181 Ga0495580_0028644 3300046472 Bacteria 4048
182 Ga0495582_0004118 3300046473 Bacteria 8173
183 Ga0495639_0003874 3300046475 Bacteria 6426
184 Ga0495628_0000482 3300046516 Bacteria 36490
185 Ga0495630_0106598 3300046517 Bacteria 2122
186 Ga0495666_0013459 3300046526 Bacteria 4080
187 Ga0495652_0018341 3300046529 Bacteria 6241
188 Ga0495640_0066342 3300046533 Unclassified 2434
189 Ga0495586_0019996 3300046535 Bacteria 3567
190 Ga0495587_0000391 3300046536 Bacteria 31181
191 Ga0495587_0001201 3300046536 Bacteria 17146
192 Ga0495587_0006355 3300046536 Bacteria 7704
193 Ga0495645_0059867 3300046543 Bacteria 2760
194 Ga0495667_0003507 3300046559 Bacteria 10521
195 Ga0495634_0039630 3300046642 Unclassified 3208
196 Ga0495657_0008682 3300046675 Bacteria 7757
197 Ga0495599_0003548 3300046678 Bacteria 9137
198 Ga0495647_0011101 3300046681 Bacteria 3079
199 Ga0495658_0004276 3300046683 Bacteria 7027
200 Ga0495600_0001978 3300046809 Bacteria 11522
201 Ga0495604_0001562 3300047317 Bacteria 18849
202 Ga0495674_0007235 3300047319 Bacteria 10621
203 Ga0495674_0021648 3300047319 Bacteria 5944
204 Ga0495674_0151292 3300047319 Bacteria 1946
205 Ga0495680_0001394 3300047322 Bacteria 26072
206 Ga0495680_0016311 3300047322 Bacteria 6388
207 Ga0495675_0000367 3300047444 Bacteria 31346
208 Ga0495675_0000873 3300047444 Bacteria 18421
209 Ga0495684_0059888 3300047471 Unclassified 2899
210 Ga0495593_0030364 3300047673 Bacteria 2958
211 Ga0495602_0000380 3300048088 Bacteria 41484
212 Ga0495602_0030059 3300048088 Bacteria 5161
213 Ga0495614_0012172 3300048089 Bacteria 3777
214 Ga0496102_0048235 3300048905 Bacteria 3872
215 Ga0496114_0021720 3300048917 Bacteria 5224
216 Ga0496115_0011667 3300048918 Bacteria 6595
217 Ga0496115_0041322 3300048918 Unclassified 3669
218 Ga0501040_0059716 3300049576 Unclassified 2620
219 Ga0501040_0186808 3300049576 Bacteria 1470
220 Ga0501046_0024103 3300049580 Bacteria 4996
221 Ga0501047_0066302 3300049581 Bacteria 3480
222 Ga0501073_0008851 3300049589 Bacteria 7444
223 Ga0501073_0064881 3300049589 Bacteria 2546
224 Ga0501081_0180426 3300049743 Bacteria 1527
225 Ga0501035_0028873 3300049822 Bacteria 5061
226 Ga0501044_0020672 3300049823 Bacteria 7028
227 Ga0501044_0033007 3300049823 Bacteria 5440
228 Ga0501044_0183029 3300049823 Unclassified 2061
229 Ga0501045_0045025 3300049824 Bacteria 3213
230 nmdc:mga0n895_181062_c1 3300050512 Bacteria 2139
231 nmdc:mga0n895_4898_c1 3300050512 Bacteria 11095
232 nmdc:mga08x19_267_c1 3300050514 Bacteria 39505
233 nmdc:mga08x19_27806_c1 3300050514 Unclassified 3539
234 nmdc:mga08x19_386_c1 3300050514 Bacteria 30958
235 nmdc:mga08x19_52363_c1 3300050514 Archaea 2625
236 nmdc:mga0a205_49563_c1 3300050515 Bacteria 4054
237 Ga0495601_0014487 3300053077 Unclassified 4753
238 Ga0501084_0134127 3300054114 Bacteria 2084
239 Ga0070665_100007679
240 JGI24740J21852_10004249
241 JGI24740J21852_10024641
242 JGI24738J21930_10002480
243 Ga0070670_100005395
244 Ga0070670_100014280
245 Ga0070666_10007627
246 Ga0068868_100113482
247 Ga0070660_100010193
248 Ga0070661_100027520
249 Ga0070661_100041205
250 Ga0070668_100008319
251 Ga0070674_100042213
252 Ga0070673_100015260
253 Ga0070659_100146744
254 Ga0070667_100006043
255 Ga0070709_10007697
256 Ga0070709_10019948
257 Ga0070713_100064056
258 Ga0070711_100007822
259 Ga0070711_100049523
260 Ga0070711_100081262
261 Ga0070694_100005301
262 Ga0070708_100004956
263 Ga0070708_100147896
264 Ga0070663_100006715
265 Ga0070678_100131490
266 Ga0070662_100007194
267 Ga0070681_10166780
268 Ga0070706_100041019
269 Ga0070707_100001114
270 Ga0070698_100055957
271 Ga0070698_100068174
272 Ga0070698_100116509
273 Ga0070679_100016349
274 Ga0070697_100001294
275 Ga0070697_100003365
276 Ga0070697_100219117
277 Ga0068853_100020145
278 Ga0068853_100098247
279 Ga0068853_100211625
280 Ga0070695_100006120
281 Ga0070696_100059850
282 Ga0070696_100109905
283 Ga0070665_100012313
284 Ga0070704_100022371
285 Ga0068855_100055551
286 Ga0068855_100067227
287 Ga0070664_100009732
288 Ga0068857_100015473
289 Ga0068854_100049878
290 Ga0068863_100005791
291 Ga0068860_100006993
292 Ga0081539_10038954
293 Ga0075368_10007473
294 Ga0070716_100012950
295 Ga0075367_10029551
296 Ga0075366_10002028
297 Ga0097621_100012271
298 Ga0097621_100014034
299 Ga0068871_100000644
300 Ga0075431_100169089
301 Ga0075434_100018243
302 Ga0075436_100002382
303 Ga0075435_100016345
304 Ga0099794_10021855
305 Ga0105242_10195144
306 Ga0105248_10049674
307 Ga0105248_10128796
308 Ga0105237_10083303
309 Ga0105237_10139474
310 Ga0099796_10014681
311 Ga0105239_10129724
312 Ga0157374_10014089
313 Ga0157374_10189530
314 Ga0157378_10000044
315 Ga0157378_10090933
316 Ga0157372_10042719
317 Ga0157376_10000017
318 Ga0157376_10047590
319 Ga0207653_10027028
320 Ga0207688_10026911
321 Ga0207647_10011782
322 Ga0207699_10118594
323 Ga0207705_10118243
324 Ga0207705_10131868
325 Ga0207707_10058978
326 Ga0207693_10033202
327 Ga0207663_10019546
328 Ga0207663_10100536
329 Ga0207657_10012562
330 Ga0207657_10019107
331 Ga0207649_10083623
332 Ga0207652_10011415
333 Ga0207652_10185141
334 Ga0207646_10000152
335 Ga0207646_10000572
336 Ga0207690_10080704
337 Ga0207706_10011739
338 Ga0207706_10012837
339 Ga0207706_10018110
340 Ga0207706_10048394
341 Ga0207686_10135619
342 Ga0207665_10000023
343 Ga0207665_10025352
344 Ga0207665_10038161
345 Ga0207665_10116764
346 Ga0207711_10028552
347 Ga0207679_10005348
348 Ga0207667_10117843
349 Ga0207658_10014018
350 Ga0207678_10000487
351 Ga0207678_10016987
352 Ga0207678_10017026
353 Ga0207678_10022098
354 Ga0207641_10005287
355 Ga0207674_10002967
356 Ga0207674_10023732
357 Ga0207698_10104224
358 Ga0209588_1008716
359 Ga0265354_1000134
360 Ga0268266_10000444
361 Ga0268266_10005597
362 Ga0268266_10007113
363 Ga0268264_10004923
364 Ga0265338_10063796
365 Ga0265770_1000434
366 Ga0265760_10001273
367 Ga0265760_10005106
368 Ga0265760_10019779
369 Ga0307408_100009450
370 Ga0307408_100017267
371 Ga0316576_10107538
372 Ga0307405_10014570
373 Ga0307405_10087652
374 Ga0307413_10034484
375 Ga0307413_10074614
376 Ga0307410_10018997
377 Ga0307410_10058204
378 Ga0307406_10014893
379 Ga0307412_10025940
380 Ga0307416_100043335
381 Ga0307416_100054318
382 Ga0307416_100055851
383 Ga0307414_10017980
384 Ga0307411_10067062
385 Ga0307411_10142034
386 Ga0307415_100054324
387 Ga0307415_100082194
388 Ga0316212_1004168
389 Ga0373926_0009383
390 Ga0373934_0001183
391 Ga0373953_0002566
392 Ga0373955_0000159
393 Ga0373927_0000264
394 Ga0373933_0001856
395 Ga0373933_0041049
396 Ga0373947_0000931
397 Ga0373937_0000214
398 Ga0373937_0002092
399 Ga0316584_0030779
400 Ga0373925_0000415
401 Ga0373925_0168585
402 Ga0395899_0102389
403 Ga0395900_0011270
404 Ga0395900_0030220
405 Ga0395900_0172586
406 Ga0395898_0061392
407 Ga0395905_0252675
408 Ga0395901_0000131
409 Ga0395901_0259066
410 Ga0439449_0013866
411 Ga0453684_0078806
412 Ga0466967_0014063
413 Ga0495603_0039806
414 Ga0495629_0010234
415 Ga0495651_0002040
416 Ga0495651_0003173
417 Ga0495653_0022445
418 Ga0495580_0003373
419 Ga0495580_0028644
420 Ga0495582_0004118
421 Ga0495639_0003874
422 Ga0495628_0000482
423 Ga0495630_0106598
424 Ga0495666_0013459
425 Ga0495652_0018341
426 Ga0495640_0066342
427 Ga0495586_0019996
428 Ga0495587_0000391
429 Ga0495587_0001201
430 Ga0495587_0006355
431 Ga0495645_0059867
432 Ga0495667_0003507
433 Ga0495634_0039630
434 Ga0495657_0008682
435 Ga0495599_0003548
436 Ga0495647_0011101
437 Ga0495658_0004276
438 Ga0495600_0001978
439 Ga0495604_0001562
440 Ga0495674_0007235
441 Ga0495674_0021648
442 Ga0495674_0151292
443 Ga0495680_0001394
444 Ga0495680_0016311
445 Ga0495675_0000367
446 Ga0495675_0000873
447 Ga0495684_0059888
448 Ga0495593_0030364
449 Ga0495602_0000380
450 Ga0495602_0030059
451 Ga0495614_0012172
452 Ga0496102_0048235
453 Ga0496114_0021720
454 Ga0496115_0011667
455 Ga0496115_0041322
456 Ga0501040_0059716
457 Ga0501040_0186808
458 Ga0501046_0024103
459 Ga0501047_0066302
460 Ga0501073_0008851
461 Ga0501073_0064881
462 Ga0501081_0180426
463 Ga0501035_0028873
464 Ga0501044_0020672
465 Ga0501044_0033007
466 Ga0501044_0183029
467 Ga0501045_0045025
468 nmdc:mga0n895_181062_c1
469 nmdc:mga0n895_4898_c1
470 nmdc:mga08x19_267_c1
471 nmdc:mga08x19_27806_c1
472 nmdc:mga08x19_386_c1
473 nmdc:mga08x19_52363_c1
474 nmdc:mga0a205_49563_c1
475 Ga0495601_0014487
476 Ga0501084_0134127

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kz1-assembly1.cif.gz_A-2 crystal structure of the soluble domain of virb8 from bartonella grahamii 0.7457 375 404
4lso-assembly1.cif.gz_A crystal structure of the soluble domain of a type iv secretion system protein virb8 from bartonella quintana toulouse 0.7276 375 404
4mei-assembly1.cif.gz_A-2 crystal structure of a virb8 type iv secretion system machinery soluble domain from bartonella tribocorum 0.7224 375 404
5jbs-assembly1.cif.gz_A conformational changes during monomer-to-dimer transition of brucella suis virb8 0.7158 376 404
6ezs-assembly2.cif.gz_B crystal structure of gh20 exo beta-n-acetylglucosaminidase from vibrio harveyi in complex with n-acetylglucosamine 0.7019 376 461
ID Description Score Start End Superfamily
af_Q9UTQ1_28_231_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8582 108 137 2.30.110.10
af_A0A1D6KE71_6_97_3.30.390.80 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;DNA repair protein Rad52/59/22 0.7957 379 404 3.30.390.80
af_Q8GZ17_1_232_2.60.40.290 Mainly Beta;Sandwich;Immunoglobulin-like; 0.782 377 462 2.60.40.290
4kz1A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;VirB8 protein 0.7457 375 404 3.10.450.230
af_M9PDR0_822_937_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7328 379 462 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A7X7PUB4-F1-model_v4 DUF4139 domain-containing protein 0.9752 395 462
AF-A0A7X7PUB4-F1-model_v4 DUF4139 domain-containing protein 0.9348 395 462
AF-A0A202DSY0-F1-model_v4 DUF4139 domain-containing protein 0.9109 294 462
AF-A0A2V6RD92-F1-model_v4 DUF4139 domain-containing protein 0.8992 295 462
AF-A0A202DSY0-F1-model_v4 DUF4139 domain-containing protein 0.8954 294 462

Map