F350706

General Info

Members Datasets Scaffolds Average Seq Length
238 151 476 313

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100012401|Ga0070713_1000124012
Length 349
Sequence MNLGFGSSTEKNGVPRIDRVTPAAAIPGGELVIHGSGFATRTGARPTVYFGEADAGLMLVTENRMIVRVPDNAGDGTVRITNGNGESRPHPVSIGLQIADNLHPVGNPAVDIDGNIYVTFSGPRGQPVPVSLYKISANYSIKPFVTSLVNPSGLALDRWSNLFVSCRHDGTIHRVTPDGRAEQWIEGMGIATGIAFDGDGNLYVGDRSGTIFKISPSREIFVFATLEPSVAAYHLAFHPSGDLYVTGPTTSSYDRVYRITQGGDVSTFYRGLGRPQGLAFDRDGNLYVAASFAGRRGIVRVTQDGKAEVTLSGSGLVGLALQPSGRAILTTNGALFTLDWDVRGLPLLG

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
51 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
52 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
53 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
54 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
55 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
72 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
73 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
74 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
77 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
78 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
79 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
80 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
81 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
82 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
83 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
84 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
85 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
86 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
87 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
88 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
89 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
90 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
91 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
92 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
93 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
98 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
99 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
100 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
101 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
102 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
103 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
104 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
105 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
106 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
107 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
108 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
109 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
110 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
111 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
112 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
113 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
114 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
115 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
116 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
117 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
118 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
119 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
120 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
121 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
122 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
123 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
124 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
125 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
126 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
127 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
128 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
129 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
130 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
131 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
138 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
139 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
144 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
147 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
148 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
149 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
150 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
151 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.16
Metatranscriptomes 0.84
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.94
Rhizosphere 89.08
Stem 0
Stem Tuber 0
Unclassified 20.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100012401 3300005436 Bacteria 6250
2 Ga0065707_10093110 3300005295 Bacteria 3673
3 Ga0070683_100478330 3300005329 Unclassified 1189
4 Ga0068869_100089964 3300005334 Bacteria 2306
5 Ga0070680_100056532 3300005336 Bacteria 3207
6 Ga0070703_10004277 3300005406 Unclassified 4022
7 Ga0070709_10167629 3300005434 Unclassified 1532
8 Ga0070709_10302791 3300005434 Bacteria 1168
9 Ga0070714_100068950 3300005435 Unclassified 3053
10 Ga0070713_100015868 3300005436 Bacteria 5647
11 Ga0070713_100124645 3300005436 Unclassified 2264
12 Ga0070711_100021792 3300005439 Bacteria 4147
13 Ga0070711_100113080 3300005439 Unclassified 1996
14 Ga0070711_100123233 3300005439 Unclassified 1920
15 Ga0070694_100019933 3300005444 Unclassified 4270
16 Ga0070694_100100233 3300005444 Unclassified 2048
17 Ga0070708_100000446 3300005445 Bacteria 30890
18 Ga0070708_100092170 3300005445 Unclassified 2760
19 Ga0070708_100261123 3300005445 Bacteria 1628
20 Ga0070681_10224630 3300005458 Bacteria 1793
21 Ga0070685_10050009 3300005466 Bacteria 2413
22 Ga0070706_100020940 3300005467 Bacteria 6020
23 Ga0070706_100022919 3300005467 Bacteria 5751
24 Ga0070707_100000399 3300005468 Bacteria 42939
25 Ga0070707_100039713 3300005468 Bacteria 4500
26 Ga0070698_100004034 3300005471 Bacteria 16161
27 Ga0070698_100005028 3300005471 Bacteria 14485
28 Ga0070698_100164420 3300005471 Unclassified 2162
29 Ga0070699_100004320 3300005518 Bacteria 12566
30 Ga0070699_100053125 3300005518 Bacteria 3507
31 Ga0070699_100077025 3300005518 Bacteria 2903
32 Ga0070699_100211238 3300005518 Unclassified 1727
33 Ga0070679_100015831 3300005530 Bacteria 7256
34 Ga0070697_100003953 3300005536 Bacteria 11389
35 Ga0070697_100016841 3300005536 Bacteria 5747
36 Ga0070697_100025022 3300005536 Bacteria 4758
37 Ga0070697_100103897 3300005536 Bacteria 2362
38 Ga0070697_100112037 3300005536 Bacteria 2275
39 Ga0070686_100265274 3300005544 Bacteria 1260
40 Ga0070695_100001163 3300005545 Bacteria 14447
41 Ga0070695_100107877 3300005545 Bacteria 1885
42 Ga0070696_100020047 3300005546 Bacteria 4533
43 Ga0070693_100001546 3300005547 Bacteria 10400
44 Ga0070693_100008773 3300005547 Bacteria 5007
45 Ga0070665_100000666 3300005548 Bacteria 46257
46 Ga0070704_100004729 3300005549 Bacteria 7881
47 Ga0068856_100097217 3300005614 Bacteria 2933
48 Ga0068863_100005899 3300005841 Bacteria 12006
49 Ga0068860_100002494 3300005843 Bacteria 19315
50 Ga0068860_100136683 3300005843 Bacteria 2354
51 Ga0070716_100000078 3300006173 Bacteria 37885
52 Ga0070716_100002080 3300006173 Bacteria 9176
53 Ga0070716_100054873 3300006173 Bacteria 2278
54 Ga0070712_100017943 3300006175 Unclassified 4587
55 Ga0070712_100166538 3300006175 Bacteria 1707
56 Ga0070712_100214231 3300006175 Unclassified 1521
57 Ga0097621_100004793 3300006237 Bacteria 9467
58 Ga0068871_100004637 3300006358 Bacteria 9601
59 Ga0075434_100005002 3300006871 Bacteria 12031
60 Ga0075434_100047556 3300006871 Bacteria 4257
61 Ga0075436_100003263 3300006914 Bacteria 11112
62 Ga0075436_100006753 3300006914 Bacteria 7853
63 Ga0075435_100004652 3300007076 Bacteria 9456
64 Ga0099794_10002847 3300007265 Bacteria 6491
65 Ga0099794_10015979 3300007265 Unclassified 3321
66 Ga0099794_10034777 3300007265 Bacteria 2376
67 Ga0099794_10046556 3300007265 Unclassified 2078
68 Ga0105240_10136892 3300009093 Bacteria 2932
69 Ga0105240_10228485 3300009093 Bacteria 2164
70 Ga0105242_10213514 3300009176 Bacteria 1721
71 Ga0105248_10156103 3300009177 Unclassified 2575
72 Ga0105237_10081387 3300009545 Bacteria 3229
73 Ga0105249_10214837 3300009553 Bacteria 1889
74 Ga0099796_10010066 3300010159 Viruses 2585
75 Ga0157371_10193979 3300013102 Unclassified 1455
76 Ga0157370_10023204 3300013104 Bacteria 6163
77 Ga0157369_10032960 3300013105 Bacteria 5694
78 Ga0157369_10106997 3300013105 Bacteria 2976
79 Ga0157378_10000053 3300013297 Bacteria 99982
80 Ga0157378_10025605 3300013297 Bacteria 5194
81 Ga0157372_10200390 3300013307 Bacteria 2312
82 Ga0157379_10030028 3300014968 Bacteria 4834
83 Ga0157376_10000029 3300014969 Bacteria 201828
84 Ga0157376_10029265 3300014969 Bacteria 4387
85 Ga0213872_10000977 3300021361 Bacteria 19960
86 Ga0213874_10002409 3300021377 Unclassified 4025
87 Ga0213874_10028383 3300021377 Bacteria 1598
88 Ga0213876_10001283 3300021384 Bacteria 15857
89 Ga0213875_10000010 3300021388 Bacteria 370268
90 Ga0213875_10020736 3300021388 Bacteria 3152
91 Ga0228598_1006950 3300024227 Bacteria 2323
92 Ga0207699_10014032 3300025906 Bacteria 4119
93 Ga0207699_10087264 3300025906 Bacteria 1950
94 Ga0207699_10282014 3300025906 Unclassified 1155
95 Ga0207684_10046091 3300025910 Bacteria 3698
96 Ga0207684_10083813 3300025910 Bacteria 2715
97 Ga0207693_10133783 3300025915 Unclassified 1949
98 Ga0207663_10011614 3300025916 Unclassified 4735
99 Ga0207663_10047981 3300025916 Unclassified 2640
100 Ga0207663_10066021 3300025916 Unclassified 2315
101 Ga0207663_10085734 3300025916 Unclassified 2075
102 Ga0207646_10000586 3300025922 Bacteria 47556
103 Ga0207646_10000927 3300025922 Bacteria 37748
104 Ga0207694_10145977 3300025924 Bacteria 1904
105 Ga0207700_10013922 3300025928 Bacteria 5256
106 Ga0207700_10091026 3300025928 Unclassified 2409
107 Ga0207664_10108370 3300025929 Unclassified 2306
108 Ga0207664_10285615 3300025929 Bacteria 1449
109 Ga0207686_10154509 3300025934 Unclassified 1601
110 Ga0207665_10000014 3300025939 Bacteria 137803
111 Ga0207665_10003226 3300025939 Bacteria 10927
112 Ga0207665_10011382 3300025939 Bacteria 5842
113 Ga0207665_10124963 3300025939 Bacteria 1821
114 Ga0207665_10261576 3300025939 Bacteria 1282
115 Ga0207702_10136575 3300026078 Bacteria 2213
116 Ga0207641_10003794 3300026088 Bacteria 13254
117 Ga0209588_1001974 3300027671 Bacteria 5502
118 Ga0209588_1010611 3300027671 Unclassified 2773
119 Ga0265354_1002326 3300028016 Unclassified 2390
120 Ga0268266_10000777 3300028379 Bacteria 42678
121 Ga0268264_10013639 3300028381 Bacteria 6688
122 Ga0265319_1003415 3300028563 Bacteria 8288
123 Ga0265318_10000614 3300028577 Bacteria 24662
124 Ga0265338_10190581 3300028800 Bacteria 1555
125 Ga0265762_1016529 3300030760 Bacteria 1340
126 Ga0265765_1000932 3300030879 Bacteria 2571
127 Ga0265328_10024735 3300031239 Unclassified 2266
128 Ga0265320_10000189 3300031240 Bacteria 51176
129 Ga0265325_10050348 3300031241 Bacteria 2145
130 Ga0265325_10086603 3300031241 Bacteria 1550
131 Ga0265329_10000655 3300031242 Bacteria 17736
132 Ga0265340_10006567 3300031247 Bacteria 6391
133 Ga0265331_10000021 3300031250 Bacteria 242632
134 Ga0265314_10009567 3300031711 Bacteria 8167
135 Ga0265342_10000032 3300031712 Bacteria 150633
136 Ga0316214_1004513 3300033545 Bacteria 1797
137 Ga0373934_0001508 3300035086 Bacteria 8536
138 Ga0373954_0003095 3300035118 Bacteria 7031
139 Ga0373954_0005400 3300035118 Bacteria 5525
140 Ga0373956_0000947 3300035119 Bacteria 12063
141 Ga0373946_0009780 3300035171 Unclassified 3541
142 Ga0373955_0000406 3300035172 Bacteria 18304
143 Ga0373935_0037690 3300035692 Bacteria 3026
144 Ga0373935_0084639 3300035692 Bacteria 2066
145 Ga0373927_0001792 3300035695 Bacteria 16032
146 Ga0373927_0002304 3300035695 Bacteria 13957
147 Ga0373933_0011104 3300035724 Bacteria 4952
148 Ga0373933_0249375 3300035724 Unclassified 1143
149 Ga0373947_0004537 3300035725 Bacteria 8144
150 Ga0373947_0034162 3300035725 Bacteria 3008
151 Ga0373947_0143315 3300035725 Bacteria 1534
152 Ga0373937_0001271 3300036401 Bacteria 21130
153 Ga0373937_0263836 3300036401 Bacteria 1624
154 Ga0373925_0005275 3300037068 Bacteria 9649
155 Ga0395900_0026976 3300037418 Bacteria 5880
156 Ga0395905_0022466 3300037471 Bacteria 5966
157 Ga0436364_0140865 3300037853 Unclassified 3297
158 Ga0436364_0162815 3300037853 Bacteria 11511
159 Ga0436364_0176247 3300037853 Bacteria 6033
160 Ga0436364_0225954 3300037853 Bacteria 33671
161 Ga0436364_0518884 3300037853 Bacteria 3286
162 Ga0436364_1343639 3300037853 Bacteria 2447
163 Ga0436364_1466683 3300037853 Unclassified 3843
164 Ga0436365_0093601 3300039437 Bacteria 2100
165 Ga0436365_0757704 3300039437 Unclassified 1233
166 Ga0436365_0865637 3300039437 Unclassified 2448
167 Ga0436365_1535343 3300039437 Bacteria 7388
168 Ga0436365_1817938 3300039437 Unclassified 3612
169 Ga0436361_0878921 3300039447 Bacteria 41824
170 Ga0436363_0093858 3300039450 Unclassified 1453
171 Ga0436362_0124567 3300039453 Bacteria 4334
172 Ga0436362_0239343 3300039453 Bacteria 3351
173 Ga0451577_0014002 3300042876 Bacteria 7486
174 Ga0453683_0005009 3300044673 Bacteria 9309
175 Ga0453683_0016264 3300044673 Bacteria 4803
176 Ga0453684_0007931 3300044712 Bacteria 19259
177 Ga0453684_0108341 3300044712 Bacteria 3381
178 Ga0495592_0057175 3300046454 Unclassified 2880
179 Ga0495603_0007059 3300046455 Bacteria 6740
180 Ga0495629_0120892 3300046459 Unclassified 1824
181 Ga0495651_0167429 3300046462 Bacteria 1568
182 Ga0495653_0059800 3300046463 Bacteria 2890
183 Ga0495580_0001026 3300046472 Bacteria 24496
184 Ga0495580_0023630 3300046472 Bacteria 4510
185 Ga0495580_0037142 3300046472 Bacteria 3497
186 Ga0495580_0091426 3300046472 Unclassified 2118
187 Ga0495582_0000982 3300046473 Bacteria 15959
188 Ga0495582_0012176 3300046473 Bacteria 4738
189 Ga0495664_0084866 3300046477 Unclassified 1901
190 Ga0495594_0020742 3300046499 Bacteria 3502
191 Ga0495608_0014014 3300046511 Bacteria 5562
192 Ga0495630_0016432 3300046517 Bacteria 5408
193 Ga0495666_0003607 3300046526 Bacteria 7823
194 Ga0495666_0007940 3300046526 Bacteria 5315
195 Ga0495640_0008317 3300046533 Bacteria 8137
196 Ga0495587_0003222 3300046536 Bacteria 10910
197 Ga0495645_0013254 3300046543 Bacteria 5827
198 Ga0495635_0041199 3300046663 Bacteria 3191
199 Ga0495635_0084837 3300046663 Bacteria 2167
200 Ga0495647_0006229 3300046681 Bacteria 3942
201 Ga0495658_0042553 3300046683 Bacteria 2536
202 Ga0495624_0044017 3300046690 Unclassified 2847
203 Ga0495604_0005499 3300047317 Bacteria 10048
204 Ga0495674_0020319 3300047319 Bacteria 6151
205 Ga0495674_0029231 3300047319 Bacteria 5021
206 Ga0495676_0058239 3300047321 Unclassified 3041
207 Ga0495675_0074859 3300047444 Bacteria 2134
208 Ga0495684_0029659 3300047471 Bacteria 4198
209 Ga0495684_0134710 3300047471 Bacteria 1854
210 Ga0495602_0007182 3300048088 Bacteria 11675
211 Ga0495602_0318511 3300048088 Bacteria 1132
212 Ga0495614_0102291 3300048089 Unclassified 1253
213 Ga0496102_0025328 3300048905 Bacteria 5280
214 Ga0496103_0014444 3300048906 Bacteria 4688
215 Ga0496104_0309432 3300048907 Unclassified 1492
216 Ga0496105_0170566 3300048908 Bacteria 1784
217 Ga0496112_0283339 3300048915 Unclassified 1604
218 Ga0496114_0285170 3300048917 Bacteria 1456
219 Ga0496115_0002983 3300048918 Bacteria 12157
220 Ga0501033_0130106 3300049570 Bacteria 1824
221 Ga0501034_0035996 3300049571 Bacteria 5018
222 Ga0501043_0193068 3300049579 Bacteria 1583
223 Ga0501047_0065915 3300049581 Bacteria 3490
224 Ga0501070_0047026 3300049586 Bacteria 3588
225 Ga0501073_0171441 3300049589 Bacteria 1502
226 Ga0501035_0037413 3300049822 Bacteria 4395
227 Ga0501044_0000766 3300049823 Bacteria 38886
228 Ga0501044_0020157 3300049823 Bacteria 7116
229 nmdc:mga0n895_15439_c1 3300050512 Bacteria 6963
230 nmdc:mga0rr50_6059_c1 3300050513 Bacteria 7306
231 nmdc:mga08x19_15326_c1 3300050514 Bacteria 4663
232 nmdc:mga08x19_3467_c1 3300050514 Bacteria 9402
233 nmdc:mga08x19_36277_c1 3300050514 Bacteria 3122
234 nmdc:mga08x19_6425_c1 3300050514 Bacteria 6961
235 Ga0495601_0003817 3300053077 Bacteria 8668
236 Ga0495601_0115413 3300053077 Bacteria 1741
237 Ga0495619_0006846 3300053085 Bacteria 7207
238 Ga0495619_0076181 3300053085 Unclassified 2252
239 Ga0070713_100012401
240 Ga0065707_10093110
241 Ga0070683_100478330
242 Ga0068869_100089964
243 Ga0070680_100056532
244 Ga0070703_10004277
245 Ga0070709_10167629
246 Ga0070709_10302791
247 Ga0070714_100068950
248 Ga0070713_100015868
249 Ga0070713_100124645
250 Ga0070711_100021792
251 Ga0070711_100113080
252 Ga0070711_100123233
253 Ga0070694_100019933
254 Ga0070694_100100233
255 Ga0070708_100000446
256 Ga0070708_100092170
257 Ga0070708_100261123
258 Ga0070681_10224630
259 Ga0070685_10050009
260 Ga0070706_100020940
261 Ga0070706_100022919
262 Ga0070707_100000399
263 Ga0070707_100039713
264 Ga0070698_100004034
265 Ga0070698_100005028
266 Ga0070698_100164420
267 Ga0070699_100004320
268 Ga0070699_100053125
269 Ga0070699_100077025
270 Ga0070699_100211238
271 Ga0070679_100015831
272 Ga0070697_100003953
273 Ga0070697_100016841
274 Ga0070697_100025022
275 Ga0070697_100103897
276 Ga0070697_100112037
277 Ga0070686_100265274
278 Ga0070695_100001163
279 Ga0070695_100107877
280 Ga0070696_100020047
281 Ga0070693_100001546
282 Ga0070693_100008773
283 Ga0070665_100000666
284 Ga0070704_100004729
285 Ga0068856_100097217
286 Ga0068863_100005899
287 Ga0068860_100002494
288 Ga0068860_100136683
289 Ga0070716_100000078
290 Ga0070716_100002080
291 Ga0070716_100054873
292 Ga0070712_100017943
293 Ga0070712_100166538
294 Ga0070712_100214231
295 Ga0097621_100004793
296 Ga0068871_100004637
297 Ga0075434_100005002
298 Ga0075434_100047556
299 Ga0075436_100003263
300 Ga0075436_100006753
301 Ga0075435_100004652
302 Ga0099794_10002847
303 Ga0099794_10015979
304 Ga0099794_10034777
305 Ga0099794_10046556
306 Ga0105240_10136892
307 Ga0105240_10228485
308 Ga0105242_10213514
309 Ga0105248_10156103
310 Ga0105237_10081387
311 Ga0105249_10214837
312 Ga0099796_10010066
313 Ga0157371_10193979
314 Ga0157370_10023204
315 Ga0157369_10032960
316 Ga0157369_10106997
317 Ga0157378_10000053
318 Ga0157378_10025605
319 Ga0157372_10200390
320 Ga0157379_10030028
321 Ga0157376_10000029
322 Ga0157376_10029265
323 Ga0213872_10000977
324 Ga0213874_10002409
325 Ga0213874_10028383
326 Ga0213876_10001283
327 Ga0213875_10000010
328 Ga0213875_10020736
329 Ga0228598_1006950
330 Ga0207699_10014032
331 Ga0207699_10087264
332 Ga0207699_10282014
333 Ga0207684_10046091
334 Ga0207684_10083813
335 Ga0207693_10133783
336 Ga0207663_10011614
337 Ga0207663_10047981
338 Ga0207663_10066021
339 Ga0207663_10085734
340 Ga0207646_10000586
341 Ga0207646_10000927
342 Ga0207694_10145977
343 Ga0207700_10013922
344 Ga0207700_10091026
345 Ga0207664_10108370
346 Ga0207664_10285615
347 Ga0207686_10154509
348 Ga0207665_10000014
349 Ga0207665_10003226
350 Ga0207665_10011382
351 Ga0207665_10124963
352 Ga0207665_10261576
353 Ga0207702_10136575
354 Ga0207641_10003794
355 Ga0209588_1001974
356 Ga0209588_1010611
357 Ga0265354_1002326
358 Ga0268266_10000777
359 Ga0268264_10013639
360 Ga0265319_1003415
361 Ga0265318_10000614
362 Ga0265338_10190581
363 Ga0265762_1016529
364 Ga0265765_1000932
365 Ga0265328_10024735
366 Ga0265320_10000189
367 Ga0265325_10050348
368 Ga0265325_10086603
369 Ga0265329_10000655
370 Ga0265340_10006567
371 Ga0265331_10000021
372 Ga0265314_10009567
373 Ga0265342_10000032
374 Ga0316214_1004513
375 Ga0373934_0001508
376 Ga0373954_0003095
377 Ga0373954_0005400
378 Ga0373956_0000947
379 Ga0373946_0009780
380 Ga0373955_0000406
381 Ga0373935_0037690
382 Ga0373935_0084639
383 Ga0373927_0001792
384 Ga0373927_0002304
385 Ga0373933_0011104
386 Ga0373933_0249375
387 Ga0373947_0004537
388 Ga0373947_0034162
389 Ga0373947_0143315
390 Ga0373937_0001271
391 Ga0373937_0263836
392 Ga0373925_0005275
393 Ga0395900_0026976
394 Ga0395905_0022466
395 Ga0436364_0140865
396 Ga0436364_0162815
397 Ga0436364_0176247
398 Ga0436364_0225954
399 Ga0436364_0518884
400 Ga0436364_1343639
401 Ga0436364_1466683
402 Ga0436365_0093601
403 Ga0436365_0757704
404 Ga0436365_0865637
405 Ga0436365_1535343
406 Ga0436365_1817938
407 Ga0436361_0878921
408 Ga0436363_0093858
409 Ga0436362_0124567
410 Ga0436362_0239343
411 Ga0451577_0014002
412 Ga0453683_0005009
413 Ga0453683_0016264
414 Ga0453684_0007931
415 Ga0453684_0108341
416 Ga0495592_0057175
417 Ga0495603_0007059
418 Ga0495629_0120892
419 Ga0495651_0167429
420 Ga0495653_0059800
421 Ga0495580_0001026
422 Ga0495580_0023630
423 Ga0495580_0037142
424 Ga0495580_0091426
425 Ga0495582_0000982
426 Ga0495582_0012176
427 Ga0495664_0084866
428 Ga0495594_0020742
429 Ga0495608_0014014
430 Ga0495630_0016432
431 Ga0495666_0003607
432 Ga0495666_0007940
433 Ga0495640_0008317
434 Ga0495587_0003222
435 Ga0495645_0013254
436 Ga0495635_0041199
437 Ga0495635_0084837
438 Ga0495647_0006229
439 Ga0495658_0042553
440 Ga0495624_0044017
441 Ga0495604_0005499
442 Ga0495674_0020319
443 Ga0495674_0029231
444 Ga0495676_0058239
445 Ga0495675_0074859
446 Ga0495684_0029659
447 Ga0495684_0134710
448 Ga0495602_0007182
449 Ga0495602_0318511
450 Ga0495614_0102291
451 Ga0496102_0025328
452 Ga0496103_0014444
453 Ga0496104_0309432
454 Ga0496105_0170566
455 Ga0496112_0283339
456 Ga0496114_0285170
457 Ga0496115_0002983
458 Ga0501033_0130106
459 Ga0501034_0035996
460 Ga0501043_0193068
461 Ga0501047_0065915
462 Ga0501070_0047026
463 Ga0501073_0171441
464 Ga0501035_0037413
465 Ga0501044_0000766
466 Ga0501044_0020157
467 nmdc:mga0n895_15439_c1
468 nmdc:mga0rr50_6059_c1
469 nmdc:mga08x19_15326_c1
470 nmdc:mga08x19_3467_c1
471 nmdc:mga08x19_36277_c1
472 nmdc:mga08x19_6425_c1
473 Ga0495601_0003817
474 Ga0495601_0115413
475 Ga0495619_0006846
476 Ga0495619_0076181

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01833

TIG

IPT/TIG domain

15

94

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3n50-assembly4.cif.gz_E-2 human early b-cell factor 3 (ebf3) ipt/tig and hlhlh domains 0.7631 14 93
3n50-assembly1.cif.gz_B human early b-cell factor 3 (ebf3) ipt/tig and hlhlh domains 0.7608 14 93
3mlp-assembly2.cif.gz_E early b-cell factor 1 (ebf1) bound to dna 0.76 14 93
3mlp-assembly1.cif.gz_A early b-cell factor 1 (ebf1) bound to dna 0.7579 14 91
3mqi-assembly2.cif.gz_C-2 human early b-cell factor 1 (ebf1) ipt/tig domain 0.7518 11 93
ID Description Score Start End Superfamily
3tc9A01 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8734 13 81 2.60.40.10
1qhpA03 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8637 11 91 2.60.40.10
4jcmA03 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8494 13 93 2.60.40.10
1qhpA03 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.844 11 91 2.60.40.10
af_Q86WI1_1065_1155_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8432 13 93 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A7W0G381-F1-model_v4 Gluconolaconase 0.9433 207 307
AF-A0A7C2L715-F1-model_v4 IPT/TIG domain-containing protein 0.9258 13 90
AF-A0A0S7X0K2-F1-model_v4 IPT/TIG domain-containing protein 0.9059 13 93
AF-A0A2V8CCI0-F1-model_v4 Gluconolaconase 0.9033 206 299
AF-A0A7C3E101-F1-model_v4 IPT/TIG domain-containing protein 0.8969 13 86

Map