F350425

General Info

Members Datasets Scaffolds Average Seq Length
237 130 458 752

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_29830_c1|nmdc:mga0n895_29830_c1_1326_3971
Length 881
Sequence LSFQFDIFSLRDLPTVVIRRSSPEFNVGAFQNYFFEEALMKKMSDGKFARRLRSIARTATAVLLSVAMAGAPAFAKKGDNVNQNPDPAADCQLNGGVQHVIYIQFDNTHFRRDNPNVPSDLEQMPHLLNFIKDNGTLLTNDHTVLISHTAGGILSSLTGLYPDRHGQTVSNSYVRTPNPFTGTAAGNFAFPSSFGYWTDSVSSTGTPTAFNMVGPDGTNAPAPWVPYTRAGCDVGAIATANIVLENTKAAIFTSLAAAXXXGATNIKVASVTGFAVGQVVSIDSELATILSVGTAGAGGTGITLTAGLTNAHASGHRVSTADPTGDITKVFGAPANFLDSCPDATHAQWCEAAVAATLPNTAANAAAKAKPQADFVGFAIHCAQGSPNCANGHDDLLPQEVGGYTGFKGLFGAQEINPFLNGTPGNMNLTDLLGDPIADPFGQPGFPGFDGMFASVSLAYIVEMQKKGIPVTYAYISDAHDFHGVAGNQHVAFGPGDQGYVDQLKSYDDAFAAFFQKLADMGITKDNTLFVFTVDEGDHFVGVQKNNCDGVVTPCVYGANEVGEINANIDTLVGDQFPSLKTNFLVAGAPNAFTVHGDDAPTFYLAKKGAGMLGQTDPLTREFERSMALLTAVNPYTLATDNLMVKMADQTGMKALHMFTTGDPTRNPTFVYFADANYFLTDFPTNTCKTCINPLFAWNHGDIQPEIANTWLGFVGPGVSERGQDAVTWTDHTDVRPTILALLGLEDTYVHDGRVLFEVIDQDATPVRLRGHEHTVSQLVDVYKKINAPFGNLSLDSLTVSTSALSSNAAGDATYTTLQNKIAGWVTRRDTIAAAIKNMLNDAAFNDANLSEVQMRQLIQQANHLLAEVAGCAANTTLCAL

Samples

Sample ID Description Type Environment
1 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
44 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
45 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
60 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
61 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
62 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
63 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
64 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
65 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
66 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
67 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
68 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
69 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
70 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
71 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
72 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
73 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
74 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
75 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
76 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
77 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
78 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
79 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
80 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
81 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
82 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
83 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
84 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
85 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
86 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
87 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
88 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
89 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
90 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
91 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
92 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
93 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
94 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
95 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
96 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
97 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
98 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
99 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
100 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
101 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
102 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
103 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
104 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
105 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
106 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
107 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
108 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
109 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
110 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
111 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
112 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
113 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
114 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
115 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
116 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
117 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
118 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
119 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
120 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
121 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
122 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
123 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
124 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
125 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
126 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
127 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
128 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
129 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
130 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.16
Metatranscriptomes 0.42
Isolates 0.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 12.24
Rhizosphere 83.97
Stem 0
Stem Tuber 0
Unclassified 3.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0n895_29830_c1 3300050512 Bacteria 5205
2 JGI24735J21928_10014044 3300002067 Bacteria 2510
3 JGI25406J46586_10008920 3300003203 Bacteria 4512
4 Ga0070680_100072719 3300005336 Bacteria 2826
5 Ga0070660_100024444 3300005339 Bacteria 4480
6 Ga0070668_100013312 3300005347 Bacteria 6138
7 Ga0070659_100021617 3300005366 Bacteria 4903
8 Ga0070709_10003473 3300005434 Bacteria 8463
9 Ga0070714_100000413 3300005435 Bacteria 31367
10 Ga0070714_100000918 3300005435 Bacteria 20885
11 Ga0070714_100001290 3300005435 Bacteria 18142
12 Ga0070714_100013733 3300005435 Bacteria 6495
13 Ga0070714_100065560 3300005435 Bacteria 3128
14 Ga0070714_100069199 3300005435 Unclassified 3047
15 Ga0070714_100077058 3300005435 Bacteria 2895
16 Ga0070713_100005997 3300005436 Bacteria 8364
17 Ga0070710_10000081 3300005437 Bacteria 43533
18 Ga0070710_10026972 3300005437 Bacteria 3058
19 Ga0070711_100017148 3300005439 Bacteria 4607
20 Ga0070694_100012297 3300005444 Bacteria 5318
21 Ga0070708_100001444 3300005445 Bacteria 18134
22 Ga0070708_100006239 3300005445 Bacteria 9477
23 Ga0070708_100017414 3300005445 Bacteria 5992
24 Ga0070681_10050356 3300005458 Bacteria 4156
25 Ga0070706_100003234 3300005467 Bacteria 16094
26 Ga0070706_100011799 3300005467 Bacteria 8112
27 Ga0070706_100015984 3300005467 Bacteria 6931
28 Ga0070706_100021307 3300005467 Bacteria 5970
29 Ga0070707_100000996 3300005468 Bacteria 28037
30 Ga0070707_100010456 3300005468 Bacteria 8644
31 Ga0070707_100012938 3300005468 Bacteria 7796
32 Ga0070707_100045220 3300005468 Bacteria 4214
33 Ga0070707_100066971 3300005468 Bacteria 3453
34 Ga0070707_100067980 3300005468 Unclassified 3428
35 Ga0070698_100000592 3300005471 Bacteria 38966
36 Ga0070698_100003155 3300005471 Bacteria 18170
37 Ga0070698_100003995 3300005471 Bacteria 16235
38 Ga0070698_100032788 3300005471 Bacteria 5379
39 Ga0070699_100000734 3300005518 Bacteria 30386
40 Ga0070699_100009788 3300005518 Bacteria 8293
41 Ga0070699_100026637 3300005518 Bacteria 4985
42 Ga0070699_100054884 3300005518 Bacteria 3450
43 Ga0070697_100000239 3300005536 Bacteria 44408
44 Ga0070697_100014550 3300005536 Bacteria 6180
45 Ga0070697_100061568 3300005536 Bacteria 3061
46 Ga0070697_100069641 3300005536 Bacteria 2882
47 Ga0070695_100000073 3300005545 Bacteria 40528
48 Ga0070704_100002981 3300005549 Bacteria 9625
49 Ga0068863_100059860 3300005841 Bacteria 3603
50 Ga0081455_10068170 3300005937 Bacteria 2962
51 Ga0081540_1000009 3300005983 Bacteria 193562
52 Ga0081540_1001262 3300005983 Bacteria 22081
53 Ga0081539_10003042 3300005985 Bacteria 21704
54 Ga0070717_10002653 3300006028 Bacteria 12596
55 Ga0070717_10015767 3300006028 Bacteria 5842
56 Ga0070717_10027343 3300006028 Bacteria 4559
57 Ga0070715_10003908 3300006163 Bacteria 4823
58 Ga0070716_100002927 3300006173 Bacteria 7963
59 Ga0070716_100027397 3300006173 Bacteria 3061
60 Ga0070712_100011721 3300006175 Bacteria 5569
61 Ga0070712_100037916 3300006175 Bacteria 3289
62 Ga0075433_10014054 3300006852 Bacteria 6527
63 Ga0075433_10037265 3300006852 Bacteria 4194
64 Ga0075434_100022448 3300006871 Bacteria 6146
65 Ga0075434_100035981 3300006871 Bacteria 4896
66 Ga0075434_100040836 3300006871 Bacteria 4595
67 Ga0075434_100094504 3300006871 Bacteria 2994
68 Ga0075436_100003754 3300006914 Bacteria 10408
69 Ga0075435_100044453 3300007076 Bacteria 3558
70 Ga0099794_10000747 3300007265 Bacteria 10952
71 Ga0105245_10017153 3300009098 Bacteria 6317
72 Ga0105248_10030163 3300009177 Bacteria 6054
73 Ga0105237_10016142 3300009545 Bacteria 7767
74 Ga0157369_10035382 3300013105 Bacteria 5476
75 Ga0157369_10068084 3300013105 Bacteria 3825
76 Ga0157372_10030727 3300013307 Bacteria 5877
77 Ga0163163_10021658 3300014325 Bacteria 6069
78 Ga0157376_10084018 3300014969 Bacteria 2740
79 Ga0163161_10022214 3300017792 Bacteria 4465
80 Ga0213875_10000249 3300021388 Bacteria 54258
81 Ga0207692_10003070 3300025898 Bacteria 6481
82 Ga0207692_10009590 3300025898 Bacteria 4051
83 Ga0207699_10001361 3300025906 Bacteria 11626
84 Ga0207699_10004599 3300025906 Bacteria 6597
85 Ga0207705_10019410 3300025909 Bacteria 4861
86 Ga0207684_10005729 3300025910 Bacteria 11407
87 Ga0207684_10009122 3300025910 Bacteria 8787
88 Ga0207671_10024061 3300025914 Bacteria 4584
89 Ga0207693_10001002 3300025915 Bacteria 25405
90 Ga0207657_10002021 3300025919 Bacteria 21926
91 Ga0207657_10039375 3300025919 Bacteria 4202
92 Ga0207646_10000062 3300025922 Bacteria 151179
93 Ga0207646_10001227 3300025922 Bacteria 32208
94 Ga0207646_10006531 3300025922 Bacteria 12036
95 Ga0207646_10014660 3300025922 Bacteria 7426
96 Ga0207646_10050494 3300025922 Unclassified 3722
97 Ga0207700_10000490 3300025928 Bacteria 23233
98 Ga0207664_10001280 3300025929 Bacteria 16581
99 Ga0207664_10002701 3300025929 Bacteria 11770
100 Ga0207664_10002984 3300025929 Bacteria 11238
101 Ga0207664_10015484 3300025929 Bacteria 5536
102 Ga0207664_10016775 3300025929 Bacteria 5350
103 Ga0207664_10044288 3300025929 Bacteria 3484
104 Ga0207664_10054810 3300025929 Bacteria 3161
105 Ga0207664_10078266 3300025929 Bacteria 2681
106 Ga0207665_10000110 3300025939 Bacteria 53827
107 Ga0207668_10041729 3300025972 Bacteria 3104
108 Ga0207708_10047147 3300026075 Unclassified 3282
109 Ga0207675_100001286 3300026118 Bacteria 25132
110 Ga0265338_10019344 3300028800 Bacteria 7229
111 Ga0265760_10008664 3300031090 Bacteria 2906
112 Ga0265331_10019769 3300031250 Bacteria 3470
113 Ga0265327_10006288 3300031251 Bacteria 9564
114 Ga0265316_10017060 3300031344 Bacteria 6284
115 Ga0373926_0002138 3300035083 Bacteria 6220
116 Ga0373935_0000686 3300035692 Bacteria 17883
117 Ga0373947_0000006 3300035725 Bacteria 223611
118 Ga0373925_0000381 3300037068 Bacteria 45775
119 Ga0373925_0003597 3300037068 Bacteria 11945
120 Ga0373925_0024554 3300037068 Bacteria 4401
121 Ga0395899_0010533 3300037312 Bacteria 7083
122 Ga0395900_0019541 3300037418 Bacteria 6906
123 Ga0395900_0051225 3300037418 Bacteria 4253
124 Ga0395900_0108336 3300037418 Bacteria 2854
125 Ga0395898_0017685 3300037466 Bacteria 7275
126 Ga0395905_0028415 3300037471 Bacteria 5272
127 Ga0395905_0032238 3300037471 Bacteria 4928
128 Ga0395905_0049197 3300037471 Bacteria 3950
129 Ga0436364_0317557 3300037853 Bacteria 4593
130 Ga0436364_0573575 3300037853 Bacteria 5207
131 Ga0436364_0584067 3300037853 Bacteria 157477
132 Ga0395901_0030489 3300038443 Bacteria 5556
133 Ga0395901_0039684 3300038443 Bacteria 4873
134 Ga0395901_0047687 3300038443 Bacteria 4447
135 Ga0436365_0507266 3300039437 Bacteria 21317
136 Ga0436365_1287464 3300039437 Bacteria 3259
137 Ga0436365_1622630 3300039437 Bacteria 3356
138 Ga0436360_0039594 3300039438 Bacteria 4813
139 Ga0436361_0128043 3300039447 Bacteria 6884
140 Ga0436363_0985243 3300039450 Bacteria 3030
141 Ga0436363_1491071 3300039450 Unclassified 3053
142 Ga0466963_0003657 3300044694 Bacteria 8845
143 Ga0466963_0009193 3300044694 Bacteria 5945
144 Ga0466971_0009047 3300044719 Bacteria 4352
145 Ga0466957_0014843 3300044842 Bacteria 4541
146 Ga0466960_0024543 3300044901 Bacteria 2721
147 Ga0466959_0022935 3300045049 Bacteria 4614
148 Ga0466958_0000465 3300045836 Bacteria 16891
149 Ga0466958_0018895 3300045836 Bacteria 4006
150 Ga0466958_0019408 3300045836 Bacteria 3957
151 Ga0466958_0046279 3300045836 Bacteria 2625
152 Ga0466958_0062473 3300045836 Bacteria 2270
153 Ga0466967_0002014 3300045976 Bacteria 12378
154 Ga0466967_0032278 3300045976 Bacteria 4420
155 Ga0466967_0036998 3300045976 Bacteria 4172
156 Ga0466967_0043779 3300045976 Bacteria 3878
157 Ga0495592_0000168 3300046454 Bacteria 58320
158 Ga0495603_0062413 3300046455 Unclassified 2200
159 Ga0495651_0000011 3300046462 Bacteria 147193
160 Ga0495651_0005441 3300046462 Bacteria 9715
161 Ga0495653_0011017 3300046463 Bacteria 7394
162 Ga0495639_0022484 3300046475 Bacteria 2766
163 Ga0495608_0006462 3300046511 Bacteria 8323
164 Ga0495608_0008184 3300046511 Bacteria 7342
165 Ga0495618_0027148 3300046514 Bacteria 3564
166 Ga0495628_0000024 3300046516 Bacteria 130196
167 Ga0495652_0010340 3300046529 Bacteria 8454
168 Ga0495652_0065310 3300046529 Bacteria 3058
169 Ga0495640_0004416 3300046533 Bacteria 11232
170 Ga0495587_0000204 3300046536 Bacteria 43619
171 Ga0495587_0030936 3300046536 Bacteria 3244
172 Ga0495645_0000035 3300046543 Bacteria 102305
173 Ga0495667_0002121 3300046559 Bacteria 13196
174 Ga0495634_0074669 3300046642 Unclassified 2228
175 Ga0495635_0012356 3300046663 Bacteria 5984
176 Ga0495657_0015595 3300046675 Bacteria 5554
177 Ga0495599_0000009 3300046678 Bacteria 217299
178 Ga0495623_0000039 3300046679 Bacteria 80360
179 Ga0495646_0044230 3300046680 Bacteria 2723
180 Ga0495658_0014502 3300046683 Bacteria 4029
181 Ga0495581_0014584 3300047315 Bacteria 4556
182 Ga0495604_0000183 3300047317 Bacteria 55826
183 Ga0495674_0011923 3300047319 Bacteria 8195
184 Ga0495674_0021248 3300047319 Bacteria 6005
185 Ga0495674_0022206 3300047319 Bacteria 5853
186 Ga0495674_0075770 3300047319 Bacteria 2895
187 Ga0495680_0003910 3300047322 Bacteria 14413
188 Ga0495680_0004932 3300047322 Bacteria 12628
189 Ga0495680_0018781 3300047322 Bacteria 5859
190 Ga0495675_0000608 3300047444 Bacteria 23082
191 Ga0495684_0080596 3300047471 Bacteria 2471
192 Ga0495602_0029942 3300048088 Bacteria 5172
193 Ga0495602_0034279 3300048088 Unclassified 4751
194 Ga0496100_0000765 3300048903 Bacteria 15272
195 Ga0496101_0005839 3300048904 Bacteria 7873
196 Ga0496101_0069088 3300048904 Unclassified 2584
197 Ga0496102_0007553 3300048905 Bacteria 9292
198 Ga0496102_0025902 3300048905 Bacteria 5225
199 Ga0496103_0011060 3300048906 Bacteria 5344
200 Ga0496104_0000850 3300048907 Bacteria 26414
201 Ga0496104_0002147 3300048907 Bacteria 17120
202 Ga0496104_0082012 3300048907 Bacteria 3076
203 Ga0496105_0001578 3300048908 Bacteria 16154
204 Ga0496105_0001901 3300048908 Bacteria 14989
205 Ga0496105_0063718 3300048908 Bacteria 3041
206 Ga0496107_0020839 3300048910 Bacteria 4633
207 Ga0496108_0019383 3300048911 Bacteria 5585
208 Ga0496108_0031177 3300048911 Bacteria 4421
209 Ga0496108_0032595 3300048911 Bacteria 4328
210 Ga0496109_0002418 3300048912 Bacteria 15632
211 Ga0496109_0006832 3300048912 Bacteria 9620
212 Ga0496109_0019563 3300048912 Bacteria 5973
213 Ga0496112_0081976 3300048915 Bacteria 3190
214 Ga0496112_0097966 3300048915 Bacteria 2902
215 Ga0496113_0021646 3300048916 Bacteria 4537
216 Ga0496114_0004700 3300048917 Bacteria 10621
217 Ga0496115_0000892 3300048918 Bacteria 21640
218 Ga0496115_0004766 3300048918 Bacteria 9843
219 Ga0496115_0004800 3300048918 Bacteria 9808
220 Ga0496115_0027580 3300048918 Bacteria 4444
221 Ga0496115_0039989 3300048918 Bacteria 3726
222 Ga0496115_0059736 3300048918 Bacteria 3071
223 Ga0501067_0015822 3300049583 Bacteria 4173
224 nmdc:mga0n895_55747_c1 3300050512 Bacteria 3891
225 nmdc:mga0rr50_23326_c1 3300050513 Bacteria 4265
226 nmdc:mga08x19_656_c1 3300050514 Bacteria 22328
227 Ga0495619_0002773 3300053085 Bacteria 11432
228 Ga0466962_0026425 3300061719 Bacteria 2787
229 2819741736 2818991472 Bacteria 10089953
230 nmdc:mga0n895_29830_c1
231 JGI24735J21928_10014044
232 JGI25406J46586_10008920
233 Ga0070680_100072719
234 Ga0070660_100024444
235 Ga0070668_100013312
236 Ga0070659_100021617
237 Ga0070709_10003473
238 Ga0070714_100000413
239 Ga0070714_100000918
240 Ga0070714_100001290
241 Ga0070714_100013733
242 Ga0070714_100065560
243 Ga0070714_100069199
244 Ga0070714_100077058
245 Ga0070713_100005997
246 Ga0070710_10000081
247 Ga0070710_10026972
248 Ga0070711_100017148
249 Ga0070694_100012297
250 Ga0070708_100001444
251 Ga0070708_100006239
252 Ga0070708_100017414
253 Ga0070681_10050356
254 Ga0070706_100003234
255 Ga0070706_100011799
256 Ga0070706_100015984
257 Ga0070706_100021307
258 Ga0070707_100000996
259 Ga0070707_100010456
260 Ga0070707_100012938
261 Ga0070707_100045220
262 Ga0070707_100066971
263 Ga0070707_100067980
264 Ga0070698_100000592
265 Ga0070698_100003155
266 Ga0070698_100003995
267 Ga0070698_100032788
268 Ga0070699_100000734
269 Ga0070699_100009788
270 Ga0070699_100026637
271 Ga0070699_100054884
272 Ga0070697_100000239
273 Ga0070697_100014550
274 Ga0070697_100061568
275 Ga0070697_100069641
276 Ga0070695_100000073
277 Ga0070704_100002981
278 Ga0068863_100059860
279 Ga0081455_10068170
280 Ga0081540_1000009
281 Ga0081540_1001262
282 Ga0081539_10003042
283 Ga0070717_10002653
284 Ga0070717_10015767
285 Ga0070717_10027343
286 Ga0070715_10003908
287 Ga0070716_100002927
288 Ga0070716_100027397
289 Ga0070712_100011721
290 Ga0070712_100037916
291 Ga0075433_10014054
292 Ga0075433_10037265
293 Ga0075434_100022448
294 Ga0075434_100035981
295 Ga0075434_100040836
296 Ga0075434_100094504
297 Ga0075436_100003754
298 Ga0075435_100044453
299 Ga0099794_10000747
300 Ga0105245_10017153
301 Ga0105248_10030163
302 Ga0105237_10016142
303 Ga0157369_10035382
304 Ga0157369_10068084
305 Ga0157372_10030727
306 Ga0163163_10021658
307 Ga0157376_10084018
308 Ga0163161_10022214
309 Ga0213875_10000249
310 Ga0207692_10003070
311 Ga0207692_10009590
312 Ga0207699_10001361
313 Ga0207699_10004599
314 Ga0207705_10019410
315 Ga0207684_10005729
316 Ga0207684_10009122
317 Ga0207671_10024061
318 Ga0207693_10001002
319 Ga0207657_10002021
320 Ga0207657_10039375
321 Ga0207646_10000062
322 Ga0207646_10001227
323 Ga0207646_10006531
324 Ga0207646_10014660
325 Ga0207646_10050494
326 Ga0207700_10000490
327 Ga0207664_10001280
328 Ga0207664_10002701
329 Ga0207664_10002984
330 Ga0207664_10015484
331 Ga0207664_10016775
332 Ga0207664_10044288
333 Ga0207664_10054810
334 Ga0207664_10078266
335 Ga0207665_10000110
336 Ga0207668_10041729
337 Ga0207708_10047147
338 Ga0207675_100001286
339 Ga0265338_10019344
340 Ga0265760_10008664
341 Ga0265331_10019769
342 Ga0265327_10006288
343 Ga0265316_10017060
344 Ga0373926_0002138
345 Ga0373935_0000686
346 Ga0373947_0000006
347 Ga0373925_0000381
348 Ga0373925_0003597
349 Ga0373925_0024554
350 Ga0395899_0010533
351 Ga0395900_0019541
352 Ga0395900_0051225
353 Ga0395900_0108336
354 Ga0395898_0017685
355 Ga0395905_0028415
356 Ga0395905_0032238
357 Ga0395905_0049197
358 Ga0436364_0317557
359 Ga0436364_0573575
360 Ga0436364_0584067
361 Ga0395901_0030489
362 Ga0395901_0039684
363 Ga0395901_0047687
364 Ga0436365_0507266
365 Ga0436365_1287464
366 Ga0436365_1622630
367 Ga0436360_0039594
368 Ga0436361_0128043
369 Ga0436363_0985243
370 Ga0436363_1491071
371 Ga0466963_0003657
372 Ga0466963_0009193
373 Ga0466971_0009047
374 Ga0466957_0014843
375 Ga0466960_0024543
376 Ga0466959_0022935
377 Ga0466958_0000465
378 Ga0466958_0018895
379 Ga0466958_0019408
380 Ga0466958_0046279
381 Ga0466958_0062473
382 Ga0466967_0002014
383 Ga0466967_0032278
384 Ga0466967_0036998
385 Ga0466967_0043779
386 Ga0495592_0000168
387 Ga0495603_0062413
388 Ga0495651_0000011
389 Ga0495651_0005441
390 Ga0495653_0011017
391 Ga0495639_0022484
392 Ga0495608_0006462
393 Ga0495608_0008184
394 Ga0495618_0027148
395 Ga0495628_0000024
396 Ga0495652_0010340
397 Ga0495652_0065310
398 Ga0495640_0004416
399 Ga0495587_0000204
400 Ga0495587_0030936
401 Ga0495645_0000035
402 Ga0495667_0002121
403 Ga0495634_0074669
404 Ga0495635_0012356
405 Ga0495657_0015595
406 Ga0495599_0000009
407 Ga0495623_0000039
408 Ga0495646_0044230
409 Ga0495658_0014502
410 Ga0495581_0014584
411 Ga0495604_0000183
412 Ga0495674_0011923
413 Ga0495674_0021248
414 Ga0495674_0022206
415 Ga0495674_0075770
416 Ga0495680_0003910
417 Ga0495680_0004932
418 Ga0495680_0018781
419 Ga0495675_0000608
420 Ga0495684_0080596
421 Ga0495602_0029942
422 Ga0495602_0034279
423 Ga0496100_0000765
424 Ga0496101_0005839
425 Ga0496101_0069088
426 Ga0496102_0007553
427 Ga0496102_0025902
428 Ga0496103_0011060
429 Ga0496104_0000850
430 Ga0496104_0002147
431 Ga0496104_0082012
432 Ga0496105_0001578
433 Ga0496105_0001901
434 Ga0496105_0063718
435 Ga0496107_0020839
436 Ga0496108_0019383
437 Ga0496108_0031177
438 Ga0496108_0032595
439 Ga0496109_0002418
440 Ga0496109_0006832
441 Ga0496109_0019563
442 Ga0496112_0081976
443 Ga0496112_0097966
444 Ga0496113_0021646
445 Ga0496114_0004700
446 Ga0496115_0000892
447 Ga0496115_0004766
448 Ga0496115_0004800
449 Ga0496115_0027580
450 Ga0496115_0039989
451 Ga0496115_0059736
452 Ga0501067_0015822
453 nmdc:mga0n895_55747_c1
454 nmdc:mga0rr50_23326_c1
455 nmdc:mga08x19_656_c1
456 Ga0495619_0002773
457 Ga0466962_0026425
458 2819741736

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gqt-assembly3.cif.gz_C crystal structure of glutaryl-coa dehydrogenase from burkholderia pseudomallei with fragment (1,4-dimethyl-1,2,3,4-tetrahydroquinoxalin-6-yl)methylamine 0.7431 616 716
3gnc-assembly1.cif.gz_D crystal structure of glutaryl-coa dehydrogenase from burkholderia pseudomallei with fragment 6421 0.7426 615 716
3gnc-assembly1.cif.gz_A crystal structure of glutaryl-coa dehydrogenase from burkholderia pseudomallei with fragment 6421 0.7417 616 716
3d6b-assembly1.cif.gz_A 2.2 a crystal structure of glutaryl-coa dehydrogenase from burkholderia pseudomallei 0.7392 620 716
5vem-assembly3.cif.gz_C human ectonucleotide pyrophosphatase / phosphodiesterase 5 (enpp5, npp5) 0.7166 28 609
ID Description Score Start End Superfamily
5iduC03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.7676 614 716 1.20.140.10
af_P96397_240_357_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.7619 614 716 1.20.140.10
af_P90754_170_556_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.7363 13 610 3.40.720.10
af_P90754_170_556_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.7329 13 610 3.40.720.10
3eomC03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.7152 617 716 1.20.140.10
ID Description Score Start End GO Terms
AF-A0A358STR4-F1-model_v4 Phosphoesterase 0.9475 324 717
AF-A0A535VCH8-F1-model_v4 Uncharacterized protein 0.9472 572 714
AF-A0A1M3FAN6-F1-model_v4 Phosphoesterase 0.9466 1 714
AF-A0A1M3FAN6-F1-model_v4 Phosphoesterase 0.9414 1 714
AF-A0A3D3ZKZ9-F1-model_v4 Flagellin 0.9355 596 710

Map