F350382

General Info

Members Datasets Scaffolds Average Seq Length
237 99 474 139

Family's Representative Sequence

Representative Sequence 3300049580|Ga0501046_0279606|Ga0501046_0279606_13_465
Length 150
Sequence MPTARLLLHIDFRSGLPIYTQIVNQIQAQVVGGILKPGDQLPTVRALAEELRVNFNTVARAYRILDDARIISTQQGRGTYITEIPPAKVSERLRKESLEALTHGYIGEAMRLEFSKSEILQMVREQLKAWKASGLADENGRNGVKGIESE

Samples

Sample ID Description Type Environment
1 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
60 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
62 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
63 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
64 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
65 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
66 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
67 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
68 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
69 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
70 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
71 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
72 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
73 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
74 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
75 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
76 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
77 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
78 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
80 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
81 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
82 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
83 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
84 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
85 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
86 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
87 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
88 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
89 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
90 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
91 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
92 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
93 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
94 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
95 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
96 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
97 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
98 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
99 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.42
Rhizosphere 99.58
Stem 0
Stem Tuber 0
Unclassified 22.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501046_0279606 3300049580 Unclassified 1223
2 SwRhRL2b_contig_1237438 2162886007 Unclassified 4714
3 JGI25406J46586_10018931 3300003203 Bacteria 2817
4 Ga0065704_10070437 3300005289 Bacteria 24893
5 Ga0065707_10000998 3300005295 Bacteria 16870
6 Ga0065707_10006570 3300005295 Bacteria 2923
7 Ga0065707_10086148 3300005295 Bacteria 5625
8 Ga0065707_10094946 3300005295 Bacteria 3435
9 Ga0065707_10428129 3300005295 Unclassified 823
10 Ga0065707_10467291 3300005295 Unclassified 785
11 Ga0065707_10742157 3300005295 Unclassified 622
12 Ga0070682_100554085 3300005337 Bacteria 900
13 Ga0070689_100019932 3300005340 Unclassified 4968
14 Ga0070689_100049699 3300005340 Unclassified 3239
15 Ga0070689_100606203 3300005340 Bacteria 949
16 Ga0070689_100636948 3300005340 Unclassified 926
17 Ga0070669_100186583 3300005353 Bacteria 1625
18 Ga0070703_10128874 3300005406 Unclassified 927
19 Ga0070701_10318116 3300005438 Bacteria 962
20 Ga0070701_10442514 3300005438 Unclassified 832
21 Ga0070705_100185810 3300005440 Bacteria 1412
22 Ga0070705_100361588 3300005440 Bacteria 1062
23 Ga0070705_101537846 3300005440 Unclassified 558
24 Ga0070700_100292101 3300005441 Bacteria 1186
25 Ga0070694_100010006 3300005444 Bacteria 5831
26 Ga0070694_100088858 3300005444 Bacteria 2164
27 Ga0070694_100128839 3300005444 Unclassified 1825
28 Ga0070707_100625882 3300005468 Bacteria 1039
29 Ga0070707_100839412 3300005468 Bacteria 883
30 Ga0070707_101040269 3300005468 Bacteria 784
31 Ga0070698_100034032 3300005471 Bacteria 5279
32 Ga0070698_100229770 3300005471 Bacteria 1788
33 Ga0070698_100380664 3300005471 Bacteria 1344
34 Ga0070698_100564773 3300005471 Bacteria 1077
35 Ga0070699_100014373 3300005518 Bacteria 6806
36 Ga0070699_100032226 3300005518 Bacteria 4525
37 Ga0070699_101043744 3300005518 Bacteria 750
38 Ga0070699_101098304 3300005518 Unclassified 730
39 Ga0070697_100160046 3300005536 Bacteria 1902
40 Ga0070697_100511047 3300005536 Unclassified 1051
41 Ga0070695_100786290 3300005545 Unclassified 761
42 Ga0070696_100052001 3300005546 Bacteria 2849
43 Ga0070704_100043610 3300005549 Unclassified 3110
44 Ga0070704_100145635 3300005549 Bacteria 1856
45 Ga0070704_100671715 3300005549 Unclassified 916
46 Ga0070702_100086147 3300005615 Bacteria 1894
47 Ga0068859_100006852 3300005617 Bacteria 11574
48 Ga0068859_100413340 3300005617 Bacteria 1445
49 Ga0068859_100546365 3300005617 Bacteria 1253
50 Ga0068859_102002159 3300005617 Unclassified 639
51 Ga0068864_100903719 3300005618 Bacteria 872
52 Ga0068864_101597794 3300005618 Bacteria 656
53 Ga0068870_10140821 3300005840 Bacteria 1411
54 Ga0068858_100568836 3300005842 Bacteria 1098
55 Ga0068862_100019956 3300005844 Bacteria 5594
56 Ga0068862_100184007 3300005844 Bacteria 1876
57 Ga0068862_101433813 3300005844 Bacteria 694
58 Ga0081539_10015873 3300005985 Bacteria 5430
59 Ga0081539_10023880 3300005985 Bacteria 3988
60 Ga0075427_10000245 3300006194 Bacteria 5771
61 Ga0075428_100221952 3300006844 Bacteria 2041
62 Ga0075428_102685003 3300006844 Bacteria 508
63 Ga0075430_100387628 3300006846 Bacteria 1153
64 Ga0075430_100496710 3300006846 Bacteria 1007
65 Ga0075431_100154961 3300006847 Unclassified 2357
66 Ga0075431_100218447 3300006847 Bacteria 1945
67 Ga0075431_100338333 3300006847 Bacteria 1515
68 Ga0075431_100512330 3300006847 Bacteria 1190
69 Ga0075433_10037188 3300006852 Unclassified 4197
70 Ga0075433_10252612 3300006852 Bacteria 1564
71 Ga0075434_100390304 3300006871 Bacteria 1413
72 Ga0075434_100440408 3300006871 Bacteria 1324
73 Ga0075434_101128113 3300006871 Bacteria 797
74 Ga0075429_100006706 3300006880 Bacteria 9983
75 Ga0075429_100045225 3300006880 Bacteria 3830
76 Ga0075429_100067617 3300006880 Unclassified 3109
77 Ga0075429_100073556 3300006880 Bacteria 2977
78 Ga0075429_100681461 3300006880 Bacteria 901
79 Ga0097620_100006852 3300006931 Bacteria 11574
80 Ga0097620_100413386 3300006931 Bacteria 1445
81 Ga0097620_100546472 3300006931 Bacteria 1253
82 Ga0097620_102002201 3300006931 Unclassified 639
83 Ga0111539_10019806 3300009094 Bacteria 8293
84 Ga0111539_10159546 3300009094 Bacteria 2638
85 Ga0105245_11284340 3300009098 Bacteria 781
86 Ga0114129_10018058 3300009147 Bacteria 10047
87 Ga0114129_10022266 3300009147 Bacteria 8996
88 Ga0114129_10052723 3300009147 Bacteria 5709
89 Ga0114129_10193611 3300009147 Bacteria 2759
90 Ga0114129_10195913 3300009147 Bacteria 2740
91 Ga0114129_10197493 3300009147 Bacteria 2727
92 Ga0114129_10321044 3300009147 Unclassified 2058
93 Ga0114129_10455452 3300009147 Unclassified 1677
94 Ga0105243_10064977 3300009148 Bacteria 2929
95 Ga0105242_10281583 3300009176 Bacteria 1510
96 Ga0105249_10008961 3300009553 Bacteria 8740
97 Ga0105249_10925495 3300009553 Bacteria 939
98 Ga0105239_11816086 3300010375 Bacteria 706
99 Ga0105239_12426426 3300010375 Unclassified 611
100 Ga0105246_10050282 3300011119 Bacteria 2859
101 Ga0105246_10132214 3300011119 Unclassified 1865
102 Ga0105246_10188200 3300011119 Bacteria 1595
103 Ga0105246_11066385 3300011119 Unclassified 736
104 Ga0163162_11385735 3300013306 Bacteria 800
105 Ga0157380_10444924 3300014326 Bacteria 1243
106 Ga0157380_10840492 3300014326 Bacteria 939
107 Ga0207643_10196660 3300025908 Bacteria 1226
108 Ga0207660_11241460 3300025917 Bacteria 606
109 Ga0207646_10181721 3300025922 Bacteria 1900
110 Ga0207646_10464982 3300025922 Bacteria 1141
111 Ga0207687_11108461 3300025927 Bacteria 680
112 Ga0207686_10446050 3300025934 Bacteria 995
113 Ga0207709_10117934 3300025935 Bacteria 1787
114 Ga0207670_10052617 3300025936 Bacteria 2738
115 Ga0207670_10400410 3300025936 Bacteria 1097
116 Ga0207670_10455191 3300025936 Bacteria 1032
117 Ga0207708_10825907 3300026075 Bacteria 799
118 Ga0207641_10267955 3300026088 Bacteria 1602
119 Ga0207676_10085546 3300026095 Bacteria 2574
120 Ga0207674_10880502 3300026116 Unclassified 863
121 Ga0207674_11577644 3300026116 Unclassified 625
122 Ga0207675_100115307 3300026118 Unclassified 2538
123 Ga0209966_1028633 3300027695 Bacteria 1119
124 Ga0207428_10048348 3300027907 Bacteria 3413
125 Ga0268265_10048090 3300028380 Bacteria 3200
126 Ga0268265_10154296 3300028380 Bacteria 1941
127 Ga0268265_10183254 3300028380 Bacteria 1801
128 Ga0307408_100214788 3300031548 Bacteria 1566
129 Ga0307413_10010129 3300031824 Unclassified 4553
130 Ga0307406_10278695 3300031901 Bacteria 1274
131 Ga0307407_10054067 3300031903 Bacteria 2313
132 Ga0307412_10011836 3300031911 Bacteria 5065
133 Ga0307416_100275187 3300032002 Bacteria 1656
134 Ga0307416_100511974 3300032002 Bacteria 1267
135 Ga0307411_10916283 3300032005 Unclassified 780
136 Ga0307415_100173935 3300032126 Bacteria 1682
137 Ga0307415_100344818 3300032126 Bacteria 1251
138 Ga0373932_0087656 3300035112 Bacteria 994
139 Ga0373933_0781852 3300035724 Unclassified 628
140 Ga0439447_145571 3300041407 Unclassified 545
141 Ga0451798_0149366 3300041458 Bacteria 1177
142 Ga0451577_0000956 3300042876 Bacteria 42279
143 Ga0451577_0030187 3300042876 Bacteria 4898
144 Ga0451577_0043596 3300042876 Bacteria 4019
145 Ga0451577_0313429 3300042876 Bacteria 1422
146 Ga0451577_0564005 3300042876 Unclassified 1034
147 Ga0451577_1063063 3300042876 Unclassified 725
148 Ga0451577_1756287 3300042876 Unclassified 545
149 Ga0453683_0000844 3300044673 Bacteria 29655
150 Ga0453683_0003825 3300044673 Bacteria 10938
151 Ga0453683_0159163 3300044673 Bacteria 1428
152 Ga0453683_0187440 3300044673 Bacteria 1312
153 Ga0453683_0220907 3300044673 Bacteria 1205
154 Ga0453683_0344479 3300044673 Bacteria 957
155 Ga0453683_0488460 3300044673 Unclassified 798
156 Ga0453684_0000232 3300044712 Bacteria 240951
157 Ga0453684_0003346 3300044712 Bacteria 36327
158 Ga0453684_0007823 3300044712 Bacteria 19482
159 Ga0453684_0012038 3300044712 Bacteria 14379
160 Ga0453684_0012595 3300044712 Bacteria 13912
161 Ga0453684_0030306 3300044712 Bacteria 7646
162 Ga0453684_0036505 3300044712 Bacteria 6772
163 Ga0453684_0047401 3300044712 Bacteria 5700
164 Ga0453684_0065579 3300044712 Bacteria 4630
165 Ga0453684_0067240 3300044712 Bacteria 4558
166 Ga0453684_0068232 3300044712 Bacteria 4516
167 Ga0453684_0072796 3300044712 Bacteria 4336
168 Ga0453684_0125541 3300044712 Bacteria 3089
169 Ga0453684_0223213 3300044712 Bacteria 2181
170 Ga0453684_0230667 3300044712 Bacteria 2137
171 Ga0453684_0243575 3300044712 Unclassified 2069
172 Ga0453684_0254026 3300044712 Bacteria 2017
173 Ga0453684_0315601 3300044712 Bacteria 1772
174 Ga0453684_0516777 3300044712 Bacteria 1320
175 Ga0453684_0722822 3300044712 Unclassified 1080
176 Ga0453684_0737325 3300044712 Unclassified 1067
177 Ga0453684_0976154 3300044712 Unclassified 902
178 Ga0453684_1769056 3300044712 Bacteria 629
179 Ga0453684_2186174 3300044712 Unclassified 553
180 Ga0451576_0007375 3300045051 Bacteria 13173
181 Ga0451576_0010193 3300045051 Bacteria 10805
182 Ga0451576_0036042 3300045051 Bacteria 5247
183 Ga0451576_0112360 3300045051 Unclassified 2835
184 Ga0451576_0118869 3300045051 Bacteria 2751
185 Ga0451576_0198168 3300045051 Bacteria 2097
186 Ga0451576_0254089 3300045051 Bacteria 1837
187 Ga0451576_1014152 3300045051 Bacteria 870
188 Ga0451576_1100870 3300045051 Bacteria 831
189 Ga0451576_1802560 3300045051 Bacteria 633
190 Ga0501298_046668 3300049521 Bacteria 890
191 Ga0501312_094245 3300049528 Bacteria 555
192 Ga0501072_0281513 3300049588 Bacteria 1323
193 Ga0501072_0506355 3300049588 Unclassified 955
194 Ga0501072_1032296 3300049588 Bacteria 641
195 Ga0501075_0476940 3300049591 Bacteria 952
196 Ga0501075_1066520 3300049591 Bacteria 614
197 Ga0501076_0001021 3300049592 Bacteria 18376
198 Ga0501076_0059739 3300049592 Bacteria 3033
199 Ga0501216_119466 3300049660 Unclassified 600
200 Ga0501245_087158 3300049708 Bacteria 613
201 Ga0501079_0075649 3300049741 Bacteria 2604
202 Ga0501080_0370844 3300049742 Bacteria 1291
203 Ga0501081_0391585 3300049743 Bacteria 1028
204 Ga0501270_121129 3300049767 Bacteria 569
205 Ga0501272_045942 3300049769 Bacteria 595
206 Ga0501278_014479 3300049774 Bacteria 671
207 nmdc:mga05p37_1007910_c1 3300050507 Bacteria 884
208 nmdc:mga05p37_109077_c1 3300050507 Bacteria 3405
209 nmdc:mga05p37_118580_c1 3300050507 Bacteria 3252
210 nmdc:mga05p37_1562_c1 3300050507 Bacteria 26607
211 nmdc:mga05p37_193229_c1 3300050507 Archaea 2470
212 nmdc:mga05p37_325480_c1 3300050507 Bacteria 1818
213 nmdc:mga09592_1550279_c1 3300050508 Bacteria 538
214 nmdc:mga09592_215819_c1 3300050508 Bacteria 1662
215 nmdc:mga09592_372775_c1 3300050508 Unclassified 1235
216 nmdc:mga09592_425485_c1 3300050508 Bacteria 1147
217 nmdc:mga09592_55006_c1 3300050508 Bacteria 3363
218 nmdc:mga09592_655677_c1 3300050508 Unclassified 896
219 nmdc:mga09592_918189_c1 3300050508 Bacteria 735
220 nmdc:mga09592_94062_c1 3300050508 Bacteria 2563
221 nmdc:mga0qj67_89824_c1 3300050509 Bacteria 2467
222 nmdc:mga06r32_333316_c1 3300050510 Bacteria 1502
223 nmdc:mga06r32_506198_c1 3300050510 Bacteria 1184
224 nmdc:mga06r32_514984_c1 3300050510 Bacteria 1172
225 nmdc:mga06r32_69913_c1 3300050510 Unclassified 3394
226 nmdc:mga08y16_1810653_c1 3300050511 Unclassified 563
227 nmdc:mga08y16_1979967_c1 3300050511 Unclassified 532
228 nmdc:mga08y16_63149_c1 3300050511 Bacteria 3867
229 nmdc:mga0n895_1060547_c1 3300050512 Bacteria 789
230 nmdc:mga0a205_50893_c1 3300050515 Archaea 3998
231 nmdc:mga0a205_84821_c1 3300050515 Bacteria 3060
232 Ga0501084_0038679 3300054114 Bacteria 3988
233 Ga0501084_1151882 3300054114 Unclassified 651
234 Ga0501082_0248518 3300060353 Unclassified 1548
235 Ga0501082_1598556 3300060353 Bacteria 569
236 Ga0530510_0629488 3300061734 Unclassified 817
237 Ga0530510_1049809 3300061734 Bacteria 624
238 Ga0501046_0279606
239 SwRhRL2b_contig_1237438
240 JGI25406J46586_10018931
241 Ga0065704_10070437
242 Ga0065707_10000998
243 Ga0065707_10006570
244 Ga0065707_10086148
245 Ga0065707_10094946
246 Ga0065707_10428129
247 Ga0065707_10467291
248 Ga0065707_10742157
249 Ga0070682_100554085
250 Ga0070689_100019932
251 Ga0070689_100049699
252 Ga0070689_100606203
253 Ga0070689_100636948
254 Ga0070669_100186583
255 Ga0070703_10128874
256 Ga0070701_10318116
257 Ga0070701_10442514
258 Ga0070705_100185810
259 Ga0070705_100361588
260 Ga0070705_101537846
261 Ga0070700_100292101
262 Ga0070694_100010006
263 Ga0070694_100088858
264 Ga0070694_100128839
265 Ga0070707_100625882
266 Ga0070707_100839412
267 Ga0070707_101040269
268 Ga0070698_100034032
269 Ga0070698_100229770
270 Ga0070698_100380664
271 Ga0070698_100564773
272 Ga0070699_100014373
273 Ga0070699_100032226
274 Ga0070699_101043744
275 Ga0070699_101098304
276 Ga0070697_100160046
277 Ga0070697_100511047
278 Ga0070695_100786290
279 Ga0070696_100052001
280 Ga0070704_100043610
281 Ga0070704_100145635
282 Ga0070704_100671715
283 Ga0070702_100086147
284 Ga0068859_100006852
285 Ga0068859_100413340
286 Ga0068859_100546365
287 Ga0068859_102002159
288 Ga0068864_100903719
289 Ga0068864_101597794
290 Ga0068870_10140821
291 Ga0068858_100568836
292 Ga0068862_100019956
293 Ga0068862_100184007
294 Ga0068862_101433813
295 Ga0081539_10015873
296 Ga0081539_10023880
297 Ga0075427_10000245
298 Ga0075428_100221952
299 Ga0075428_102685003
300 Ga0075430_100387628
301 Ga0075430_100496710
302 Ga0075431_100154961
303 Ga0075431_100218447
304 Ga0075431_100338333
305 Ga0075431_100512330
306 Ga0075433_10037188
307 Ga0075433_10252612
308 Ga0075434_100390304
309 Ga0075434_100440408
310 Ga0075434_101128113
311 Ga0075429_100006706
312 Ga0075429_100045225
313 Ga0075429_100067617
314 Ga0075429_100073556
315 Ga0075429_100681461
316 Ga0097620_100006852
317 Ga0097620_100413386
318 Ga0097620_100546472
319 Ga0097620_102002201
320 Ga0111539_10019806
321 Ga0111539_10159546
322 Ga0105245_11284340
323 Ga0114129_10018058
324 Ga0114129_10022266
325 Ga0114129_10052723
326 Ga0114129_10193611
327 Ga0114129_10195913
328 Ga0114129_10197493
329 Ga0114129_10321044
330 Ga0114129_10455452
331 Ga0105243_10064977
332 Ga0105242_10281583
333 Ga0105249_10008961
334 Ga0105249_10925495
335 Ga0105239_11816086
336 Ga0105239_12426426
337 Ga0105246_10050282
338 Ga0105246_10132214
339 Ga0105246_10188200
340 Ga0105246_11066385
341 Ga0163162_11385735
342 Ga0157380_10444924
343 Ga0157380_10840492
344 Ga0207643_10196660
345 Ga0207660_11241460
346 Ga0207646_10181721
347 Ga0207646_10464982
348 Ga0207687_11108461
349 Ga0207686_10446050
350 Ga0207709_10117934
351 Ga0207670_10052617
352 Ga0207670_10400410
353 Ga0207670_10455191
354 Ga0207708_10825907
355 Ga0207641_10267955
356 Ga0207676_10085546
357 Ga0207674_10880502
358 Ga0207674_11577644
359 Ga0207675_100115307
360 Ga0209966_1028633
361 Ga0207428_10048348
362 Ga0268265_10048090
363 Ga0268265_10154296
364 Ga0268265_10183254
365 Ga0307408_100214788
366 Ga0307413_10010129
367 Ga0307406_10278695
368 Ga0307407_10054067
369 Ga0307412_10011836
370 Ga0307416_100275187
371 Ga0307416_100511974
372 Ga0307411_10916283
373 Ga0307415_100173935
374 Ga0307415_100344818
375 Ga0373932_0087656
376 Ga0373933_0781852
377 Ga0439447_145571
378 Ga0451798_0149366
379 Ga0451577_0000956
380 Ga0451577_0030187
381 Ga0451577_0043596
382 Ga0451577_0313429
383 Ga0451577_0564005
384 Ga0451577_1063063
385 Ga0451577_1756287
386 Ga0453683_0000844
387 Ga0453683_0003825
388 Ga0453683_0159163
389 Ga0453683_0187440
390 Ga0453683_0220907
391 Ga0453683_0344479
392 Ga0453683_0488460
393 Ga0453684_0000232
394 Ga0453684_0003346
395 Ga0453684_0007823
396 Ga0453684_0012038
397 Ga0453684_0012595
398 Ga0453684_0030306
399 Ga0453684_0036505
400 Ga0453684_0047401
401 Ga0453684_0065579
402 Ga0453684_0067240
403 Ga0453684_0068232
404 Ga0453684_0072796
405 Ga0453684_0125541
406 Ga0453684_0223213
407 Ga0453684_0230667
408 Ga0453684_0243575
409 Ga0453684_0254026
410 Ga0453684_0315601
411 Ga0453684_0516777
412 Ga0453684_0722822
413 Ga0453684_0737325
414 Ga0453684_0976154
415 Ga0453684_1769056
416 Ga0453684_2186174
417 Ga0451576_0007375
418 Ga0451576_0010193
419 Ga0451576_0036042
420 Ga0451576_0112360
421 Ga0451576_0118869
422 Ga0451576_0198168
423 Ga0451576_0254089
424 Ga0451576_1014152
425 Ga0451576_1100870
426 Ga0451576_1802560
427 Ga0501298_046668
428 Ga0501312_094245
429 Ga0501072_0281513
430 Ga0501072_0506355
431 Ga0501072_1032296
432 Ga0501075_0476940
433 Ga0501075_1066520
434 Ga0501076_0001021
435 Ga0501076_0059739
436 Ga0501216_119466
437 Ga0501245_087158
438 Ga0501079_0075649
439 Ga0501080_0370844
440 Ga0501081_0391585
441 Ga0501270_121129
442 Ga0501272_045942
443 Ga0501278_014479
444 nmdc:mga05p37_1007910_c1
445 nmdc:mga05p37_109077_c1
446 nmdc:mga05p37_118580_c1
447 nmdc:mga05p37_1562_c1
448 nmdc:mga05p37_193229_c1
449 nmdc:mga05p37_325480_c1
450 nmdc:mga09592_1550279_c1
451 nmdc:mga09592_215819_c1
452 nmdc:mga09592_372775_c1
453 nmdc:mga09592_425485_c1
454 nmdc:mga09592_55006_c1
455 nmdc:mga09592_655677_c1
456 nmdc:mga09592_918189_c1
457 nmdc:mga09592_94062_c1
458 nmdc:mga0qj67_89824_c1
459 nmdc:mga06r32_333316_c1
460 nmdc:mga06r32_506198_c1
461 nmdc:mga06r32_514984_c1
462 nmdc:mga06r32_69913_c1
463 nmdc:mga08y16_1810653_c1
464 nmdc:mga08y16_1979967_c1
465 nmdc:mga08y16_63149_c1
466 nmdc:mga0n895_1060547_c1
467 nmdc:mga0a205_50893_c1
468 nmdc:mga0a205_84821_c1
469 Ga0501084_0038679
470 Ga0501084_1151882
471 Ga0501082_0248518
472 Ga0501082_1598556
473 Ga0530510_0629488
474 Ga0530510_1049809

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00392

GntR

Bacterial regulatory proteins, gntR family

18

81

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mgr-assembly1.cif.gz_B the crystal structure of bacillus subtilis gabr, an autorepressor and plp- and gaba-dependent transcriptional activator of gabt 0.9494 7 84
4n0b-assembly2.cif.gz_C crystal structure of bacillus subtilis gabr, an autorepressor and transcriptional activator of gabt 0.9424 7 84
4tv7-assembly2.cif.gz_D crystal structure of bacillus subtilis gabr at 2.05 angstroms resolution 0.9394 8 84
4mgr-assembly1.cif.gz_A the crystal structure of bacillus subtilis gabr, an autorepressor and plp- and gaba-dependent transcriptional activator of gabt 0.9393 7 84
4tv7-assembly2.cif.gz_C crystal structure of bacillus subtilis gabr at 2.05 angstroms resolution 0.9392 7 84
ID Description Score Start End Superfamily
4hamA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9546 5 83 1.10.10.10
4u0wA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9519 7 83 1.10.10.10
4u0vA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9471 7 83 1.10.10.10
af_Q2G1P1_1_44_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9433 40 82 1.10.10.10
4hamA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9431 5 83 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A349Q3A9-F1-model_v4 Transcriptional regulator 0.9854 8 85 GO:0003677
GO:0003700
GO:0005737
AF-A0A2N5IS63-F1-model_v4 GntR family transcriptional regulator 0.979 7 84 GO:0003677
GO:0003700
GO:0009058
GO:0030170
AF-K1S630-F1-model_v4 Transcriptional regulator, GntR family 0.978 8 83 GO:0003677
GO:0003700
GO:0045892
AF-A0A3C1GZ12-F1-model_v4 HTH gntR-type domain-containing protein 0.975 8 83 GO:0003677
GO:0003700
GO:0045892
AF-A0A317ZBX6-F1-model_v4 PLP-dependent aminotransferase family protein 0.966 6 85 GO:0003677
GO:0003700
GO:0008483
GO:0009058
GO:0030170

Map