F350342

General Info

Members Datasets Scaffolds Average Seq Length
237 158 474 231

Family's Representative Sequence

Representative Sequence 3300048917|Ga0496114_0415522|Ga0496114_0415522_92_856
Length 254
Sequence VGVDGQHRKLVIPGDPERRAAFRAGQRAILQSLPGAAAWGLVSGVAMVKGGLSPPWAATMSLLVYAGSAQLAALPLIATGMPLWVIVATGLITNLRFVIYSAALRPYFADQSLRKRAAIGFFMTDFTFTLFMRSAQEGRLPGQHRDAWFAGVCSSNWTTWQVCAMTGIVAASYVPTQWGLEFTGTLALLALVGPALITRPAIVGAVTASLVALLTHGISYRLGLFCAAIAGIAAATLADGWRSSGGSQDAAETS

Samples

Sample ID Description Type Environment
1 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
78 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
79 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
80 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
81 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
82 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
83 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
84 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
85 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
86 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
89 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
90 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
91 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
92 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
93 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
94 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
95 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
96 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
97 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
98 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
99 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
100 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
101 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
102 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
103 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
104 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
105 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
106 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
107 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
108 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
109 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
110 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
111 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
112 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
113 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
114 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
115 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
116 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
117 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
118 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
119 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
120 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
121 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
122 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
123 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
124 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
125 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
126 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
127 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
128 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
129 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
130 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
131 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
134 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
135 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
136 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
137 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
138 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
139 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
140 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
146 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
149 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
150 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
151 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
152 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
153 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
158 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.95
Rhizosphere 91.98
Stem 0
Stem Tuber 0
Unclassified 1.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496114_0415522 3300048917 Bacteria 1191
2 rootL2_10002920 3300003322 Bacteria 5279
3 rootL2_10131626 3300003322 Bacteria 2010
4 Ga0070670_100000001 3300005331 Bacteria 728788
5 Ga0070677_10101126 3300005333 Bacteria 1271
6 Ga0068869_100038243 3300005334 Bacteria 3418
7 Ga0068869_100168849 3300005334 Bacteria 1708
8 Ga0070689_100006209 3300005340 Bacteria 8246
9 Ga0070689_100055090 3300005340 Bacteria 3080
10 Ga0070689_100276912 3300005340 Bacteria 1391
11 Ga0070669_100003202 3300005353 Bacteria 11764
12 Ga0070669_100187890 3300005353 Bacteria 1619
13 Ga0070675_100018477 3300005354 Bacteria 5550
14 Ga0070675_100042395 3300005354 Bacteria 3719
15 Ga0070675_100066807 3300005354 Bacteria 2975
16 Ga0070671_100000033 3300005355 Bacteria 105788
17 Ga0070674_100644771 3300005356 Bacteria 900
18 Ga0070667_100000096 3300005367 Bacteria 108816
19 Ga0070701_10026601 3300005438 Bacteria 2823
20 Ga0070700_100045405 3300005441 Bacteria 2710
21 Ga0070700_100048485 3300005441 Bacteria 2632
22 Ga0070700_100080437 3300005441 Bacteria 2102
23 Ga0070700_100091150 3300005441 Bacteria 1989
24 Ga0070700_100194463 3300005441 Bacteria 1421
25 Ga0070694_100043677 3300005444 Bacteria 2997
26 Ga0070663_100083218 3300005455 Bacteria 2356
27 Ga0070678_100317869 3300005456 Bacteria 1329
28 Ga0070685_10000002 3300005466 Bacteria 295205
29 Ga0070672_100018533 3300005543 Bacteria 5035
30 Ga0070672_100095053 3300005543 Bacteria 2410
31 Ga0070672_100522860 3300005543 Bacteria 1028
32 Ga0070686_100023033 3300005544 Bacteria 3718
33 Ga0070696_100016862 3300005546 Bacteria 4927
34 Ga0070693_100366603 3300005547 Bacteria 990
35 Ga0070665_100002609 3300005548 Bacteria 19675
36 Ga0070665_100913429 3300005548 Bacteria 890
37 Ga0068857_100056415 3300005577 Bacteria 3486
38 Ga0070702_100264883 3300005615 Bacteria 1172
39 Ga0068859_100068976 3300005617 Bacteria 3570
40 Ga0068859_100089833 3300005617 Bacteria 3122
41 Ga0068859_100124620 3300005617 Bacteria 2645
42 Ga0068864_100000006 3300005618 Bacteria 393838
43 Ga0068864_100631282 3300005618 Unclassified 1042
44 Ga0068861_100016305 3300005719 Bacteria 5255
45 Ga0068861_100505079 3300005719 Bacteria 1094
46 Ga0068861_100548807 3300005719 Bacteria 1053
47 Ga0068870_10054950 3300005840 Bacteria 2120
48 Ga0068863_100094614 3300005841 Bacteria 2836
49 Ga0068858_100071315 3300005842 Bacteria 3222
50 Ga0068858_100171769 3300005842 Bacteria 2044
51 Ga0068860_100114037 3300005843 Bacteria 2584
52 Ga0068862_100004683 3300005844 Bacteria 11521
53 Ga0070716_100411517 3300006173 Bacteria 975
54 Ga0097621_100092365 3300006237 Bacteria 2535
55 Ga0097621_100169627 3300006237 Bacteria 1880
56 Ga0068871_100003635 3300006358 Bacteria 10596
57 Ga0068865_100092322 3300006881 Bacteria 2199
58 Ga0097620_100068968 3300006931 Bacteria 3570
59 Ga0097620_100089834 3300006931 Bacteria 3122
60 Ga0097620_100124615 3300006931 Bacteria 2645
61 Ga0111539_10026261 3300009094 Bacteria 7123
62 Ga0105247_10015922 3300009101 Bacteria 4503
63 Ga0105242_10786924 3300009176 Bacteria 940
64 Ga0105248_10021133 3300009177 Bacteria 7212
65 Ga0105248_10376431 3300009177 Bacteria 1598
66 Ga0157378_10240381 3300013297 Bacteria 1729
67 Ga0157375_10030177 3300013308 Bacteria 5109
68 Ga0157375_10394745 3300013308 Bacteria 1550
69 Ga0157375_10583993 3300013308 Bacteria 1277
70 Ga0163163_10000032 3300014325 Bacteria 167085
71 Ga0163163_10014556 3300014325 Bacteria 7236
72 Ga0163163_10243640 3300014325 Bacteria 1848
73 Ga0163163_11035435 3300014325 Bacteria 884
74 Ga0157380_10006415 3300014326 Bacteria 8281
75 Ga0157380_10462023 3300014326 Bacteria 1222
76 Ga0157376_10104410 3300014969 Bacteria 2483
77 Ga0157376_10172830 3300014969 Bacteria 1969
78 Ga0163161_10153702 3300017792 Bacteria 1750
79 Ga0207682_10001146 3300025893 Bacteria 12278
80 Ga0207682_10138409 3300025893 Bacteria 1091
81 Ga0207692_10318945 3300025898 Bacteria 950
82 Ga0207643_10012643 3300025908 Bacteria 4560
83 Ga0207681_10004118 3300025923 Bacteria 9012
84 Ga0207681_10075951 3300025923 Bacteria 2358
85 Ga0207650_10000002 3300025925 Bacteria 1439222
86 Ga0207650_10036009 3300025925 Bacteria 3598
87 Ga0207659_10063850 3300025926 Bacteria 2664
88 Ga0207659_10065403 3300025926 Bacteria 2635
89 Ga0207644_10000079 3300025931 Bacteria 71463
90 Ga0207670_10025092 3300025936 Bacteria 3736
91 Ga0207669_10034921 3300025937 Bacteria 2855
92 Ga0207669_10111945 3300025937 Bacteria 1831
93 Ga0207704_10005201 3300025938 Bacteria 5989
94 Ga0207691_10012176 3300025940 Bacteria 8247
95 Ga0207691_10148523 3300025940 Bacteria 2062
96 Ga0207711_10000872 3300025941 Bacteria 29118
97 Ga0207689_10060799 3300025942 Bacteria 3107
98 Ga0207689_10425904 3300025942 Bacteria 1108
99 Ga0207679_10015593 3300025945 Bacteria 5027
100 Ga0207651_10022280 3300025960 Bacteria 3870
101 Ga0207651_10212513 3300025960 Bacteria 1558
102 Ga0207668_10153495 3300025972 Bacteria 1786
103 Ga0207658_10000001 3300025986 Bacteria 1439333
104 Ga0207703_10077968 3300026035 Bacteria 2752
105 Ga0207703_10101675 3300026035 Bacteria 2438
106 Ga0207678_10095965 3300026067 Bacteria 2534
107 Ga0207708_10014958 3300026075 Bacteria 5812
108 Ga0207708_10042127 3300026075 Bacteria 3481
109 Ga0207708_10087563 3300026075 Bacteria 2398
110 Ga0207708_10170987 3300026075 Bacteria 1721
111 Ga0207641_10046227 3300026088 Bacteria 3668
112 Ga0207641_10074030 3300026088 Bacteria 2937
113 Ga0207641_10106339 3300026088 Bacteria 2480
114 Ga0207648_10195680 3300026089 Bacteria 1792
115 Ga0207676_10000001 3300026095 Bacteria 1439222
116 Ga0207676_10779750 3300026095 Unclassified 931
117 Ga0207674_10166672 3300026116 Bacteria 2157
118 Ga0207675_100005010 3300026118 Bacteria 12758
119 Ga0207675_100045712 3300026118 Bacteria 4091
120 Ga0207675_100050371 3300026118 Bacteria 3886
121 Ga0207675_100410283 3300026118 Bacteria 1336
122 Ga0207675_100447464 3300026118 Bacteria 1280
123 Ga0207683_10045322 3300026121 Bacteria 3846
124 Ga0268266_10035696 3300028379 Bacteria 4228
125 Ga0268265_10004897 3300028380 Bacteria 9218
126 Ga0268265_10016679 3300028380 Bacteria 5053
127 Ga0268265_10942644 3300028380 Bacteria 850
128 Ga0268264_10000004 3300028381 Bacteria 1116842
129 Ga0307515_10096679 3300028794 Bacteria 3619
130 Ga0307513_10017928 3300031456 Bacteria 8477
131 Ga0307513_10019010 3300031456 Bacteria 8192
132 Ga0307513_10019740 3300031456 Bacteria 8011
133 Ga0307513_10099119 3300031456 Bacteria 2943
134 Ga0307509_10181592 3300031507 Bacteria 1968
135 Ga0307408_100062963 3300031548 Bacteria 2712
136 Ga0307405_10443857 3300031731 Bacteria 1027
137 Ga0307413_10008476 3300031824 Bacteria 4857
138 Ga0307410_10019819 3300031852 Bacteria 4100
139 Ga0307406_10005737 3300031901 Bacteria 6799
140 Ga0307406_10122779 3300031901 Bacteria 1809
141 Ga0307407_10022631 3300031903 Bacteria 3265
142 Ga0307407_10459453 3300031903 Bacteria 926
143 Ga0307409_100012963 3300031995 Bacteria 5340
144 Ga0307409_100047550 3300031995 Bacteria 3257
145 Ga0307416_100123279 3300032002 Bacteria 2316
146 Ga0307414_10105127 3300032004 Bacteria 2134
147 Ga0307414_10678100 3300032004 Bacteria 931
148 Ga0307411_10048095 3300032005 Bacteria 2762
149 Ga0307415_100380579 3300032126 Bacteria 1198
150 Ga0373956_0102941 3300035119 Bacteria 1326
151 Ga0373955_0426528 3300035172 Bacteria 807
152 Ga0373937_0350573 3300036401 Bacteria 1398
153 Ga0395901_0991481 3300038443 Bacteria 817
154 Ga0451791_0267567 3300041451 Bacteria 2010
155 Ga0451807_2290999 3300041486 Bacteria 1211
156 Ga0451837_0567630 3300041494 Bacteria 3858
157 Ga0451843_0839990 3300041509 Bacteria 1872
158 Ga0451577_0102094 3300042876 Bacteria 2562
159 Ga0495603_0082045 3300046455 Bacteria 1889
160 Ga0495603_0304385 3300046455 Bacteria 916
161 Ga0495638_0003825 3300046460 Bacteria 11683
162 Ga0495638_0050908 3300046460 Bacteria 2586
163 Ga0495580_0142012 3300046472 Bacteria 1664
164 Ga0495662_0228268 3300046476 Bacteria 918
165 Ga0495584_0108166 3300046491 Bacteria 1406
166 Ga0495594_0107119 3300046499 Bacteria 1574
167 Ga0495594_0196132 3300046499 Bacteria 1150
168 Ga0495606_0090685 3300046507 Bacteria 1880
169 Ga0495616_0006572 3300046513 Bacteria 7023
170 Ga0495630_0128986 3300046517 Bacteria 1920
171 Ga0495631_0047668 3300046518 Bacteria 1880
172 Ga0495666_0016804 3300046526 Bacteria 3643
173 Ga0495666_0053407 3300046526 Bacteria 1939
174 Ga0495666_0088269 3300046526 Bacteria 1464
175 Ga0495642_0113613 3300046528 Bacteria 1159
176 Ga0495652_0067329 3300046529 Bacteria 3003
177 Ga0495665_0056383 3300046531 Bacteria 2074
178 Ga0495665_0063302 3300046531 Bacteria 1952
179 Ga0495665_0273843 3300046531 Bacteria 866
180 Ga0495640_0242119 3300046533 Bacteria 1132
181 Ga0495586_0037288 3300046535 Bacteria 2610
182 Ga0495587_0047008 3300046536 Bacteria 2559
183 Ga0495597_0000750 3300046542 Bacteria 25631
184 Ga0495622_0052977 3300046557 Bacteria 1882
185 Ga0495633_0109078 3300046558 Bacteria 1283
186 Ga0495667_0161036 3300046559 Bacteria 1443
187 Ga0495668_0017193 3300046616 Bacteria 4200
188 Ga0495668_0109614 3300046616 Bacteria 1510
189 Ga0495668_0200627 3300046616 Bacteria 1092
190 Ga0495634_0218910 3300046642 Bacteria 1176
191 Ga0495625_0010426 3300046660 Bacteria 7691
192 Ga0495625_0030951 3300046660 Bacteria 3986
193 Ga0495625_0053182 3300046660 Bacteria 2898
194 Ga0495661_0059915 3300046665 Bacteria 2263
195 Ga0495588_0023747 3300046674 Bacteria 3038
196 Ga0495588_0024022 3300046674 Bacteria 3024
197 Ga0495588_0053086 3300046674 Bacteria 2089
198 Ga0495646_0118017 3300046680 Bacteria 1504
199 Ga0495613_0077562 3300046689 Bacteria 2417
200 Ga0495649_0002890 3300046694 Bacteria 11907
201 Ga0495600_0077432 3300046809 Bacteria 2171
202 Ga0495581_0039490 3300047315 Bacteria 2732
203 Ga0495604_0104486 3300047317 Bacteria 2075
204 Ga0495604_0174853 3300047317 Bacteria 1506
205 Ga0495674_0004779 3300047319 Bacteria 13028
206 Ga0495676_0063743 3300047321 Bacteria 2871
207 Ga0495680_0087017 3300047322 Bacteria 2351
208 Ga0495683_0092427 3300047323 Bacteria 1464
209 Ga0495675_0165042 3300047444 Bacteria 1362
210 Ga0495614_0066322 3300048089 Bacteria 1553
211 Ga0496114_0373964 3300048917 Bacteria 1261
212 Ga0496115_0005153 3300048918 Bacteria 9510
213 Ga0496115_0180727 3300048918 Bacteria 1744
214 Ga0496115_0506220 3300048918 Bacteria 970
215 Ga0496124_0050202 3300048927 Bacteria 3556
216 Ga0496126_0090389 3300048929 Bacteria 2694
217 Ga0501036_0297093 3300049572 Bacteria 1351
218 Ga0501040_0233390 3300049576 Bacteria 1310
219 Ga0501041_0311382 3300049577 Bacteria 993
220 Ga0501042_0059779 3300049578 Bacteria 2722
221 Ga0501067_0045999 3300049583 Unclassified 2422
222 Ga0501068_0003685 3300049584 Bacteria 8289
223 Ga0501068_0151878 3300049584 Bacteria 1456
224 Ga0501070_0058028 3300049586 Bacteria 3209
225 Ga0501070_0226597 3300049586 Bacteria 1532
226 Ga0501072_0189745 3300049588 Bacteria 1639
227 Ga0501073_0018851 3300049589 Bacteria 4986
228 Ga0501074_0047060 3300049590 Bacteria 3118
229 Ga0501076_0095140 3300049592 Bacteria 2399
230 Ga0501077_0032072 3300049593 Bacteria 3343
231 Ga0501079_0001111 3300049741 Bacteria 18700
232 Ga0501080_0126748 3300049742 Bacteria 2364
233 Ga0501080_0265689 3300049742 Bacteria 1562
234 Ga0501083_0013752 3300049744 Bacteria 5659
235 nmdc:mga08y16_120507_c1 3300050511 Bacteria 2730
236 Ga0501084_0120036 3300054114 Bacteria 2210
237 Ga0501082_0075194 3300060353 Bacteria 2910
238 Ga0496114_0415522
239 rootL2_10002920
240 rootL2_10131626
241 Ga0070670_100000001
242 Ga0070677_10101126
243 Ga0068869_100038243
244 Ga0068869_100168849
245 Ga0070689_100006209
246 Ga0070689_100055090
247 Ga0070689_100276912
248 Ga0070669_100003202
249 Ga0070669_100187890
250 Ga0070675_100018477
251 Ga0070675_100042395
252 Ga0070675_100066807
253 Ga0070671_100000033
254 Ga0070674_100644771
255 Ga0070667_100000096
256 Ga0070701_10026601
257 Ga0070700_100045405
258 Ga0070700_100048485
259 Ga0070700_100080437
260 Ga0070700_100091150
261 Ga0070700_100194463
262 Ga0070694_100043677
263 Ga0070663_100083218
264 Ga0070678_100317869
265 Ga0070685_10000002
266 Ga0070672_100018533
267 Ga0070672_100095053
268 Ga0070672_100522860
269 Ga0070686_100023033
270 Ga0070696_100016862
271 Ga0070693_100366603
272 Ga0070665_100002609
273 Ga0070665_100913429
274 Ga0068857_100056415
275 Ga0070702_100264883
276 Ga0068859_100068976
277 Ga0068859_100089833
278 Ga0068859_100124620
279 Ga0068864_100000006
280 Ga0068864_100631282
281 Ga0068861_100016305
282 Ga0068861_100505079
283 Ga0068861_100548807
284 Ga0068870_10054950
285 Ga0068863_100094614
286 Ga0068858_100071315
287 Ga0068858_100171769
288 Ga0068860_100114037
289 Ga0068862_100004683
290 Ga0070716_100411517
291 Ga0097621_100092365
292 Ga0097621_100169627
293 Ga0068871_100003635
294 Ga0068865_100092322
295 Ga0097620_100068968
296 Ga0097620_100089834
297 Ga0097620_100124615
298 Ga0111539_10026261
299 Ga0105247_10015922
300 Ga0105242_10786924
301 Ga0105248_10021133
302 Ga0105248_10376431
303 Ga0157378_10240381
304 Ga0157375_10030177
305 Ga0157375_10394745
306 Ga0157375_10583993
307 Ga0163163_10000032
308 Ga0163163_10014556
309 Ga0163163_10243640
310 Ga0163163_11035435
311 Ga0157380_10006415
312 Ga0157380_10462023
313 Ga0157376_10104410
314 Ga0157376_10172830
315 Ga0163161_10153702
316 Ga0207682_10001146
317 Ga0207682_10138409
318 Ga0207692_10318945
319 Ga0207643_10012643
320 Ga0207681_10004118
321 Ga0207681_10075951
322 Ga0207650_10000002
323 Ga0207650_10036009
324 Ga0207659_10063850
325 Ga0207659_10065403
326 Ga0207644_10000079
327 Ga0207670_10025092
328 Ga0207669_10034921
329 Ga0207669_10111945
330 Ga0207704_10005201
331 Ga0207691_10012176
332 Ga0207691_10148523
333 Ga0207711_10000872
334 Ga0207689_10060799
335 Ga0207689_10425904
336 Ga0207679_10015593
337 Ga0207651_10022280
338 Ga0207651_10212513
339 Ga0207668_10153495
340 Ga0207658_10000001
341 Ga0207703_10077968
342 Ga0207703_10101675
343 Ga0207678_10095965
344 Ga0207708_10014958
345 Ga0207708_10042127
346 Ga0207708_10087563
347 Ga0207708_10170987
348 Ga0207641_10046227
349 Ga0207641_10074030
350 Ga0207641_10106339
351 Ga0207648_10195680
352 Ga0207676_10000001
353 Ga0207676_10779750
354 Ga0207674_10166672
355 Ga0207675_100005010
356 Ga0207675_100045712
357 Ga0207675_100050371
358 Ga0207675_100410283
359 Ga0207675_100447464
360 Ga0207683_10045322
361 Ga0268266_10035696
362 Ga0268265_10004897
363 Ga0268265_10016679
364 Ga0268265_10942644
365 Ga0268264_10000004
366 Ga0307515_10096679
367 Ga0307513_10017928
368 Ga0307513_10019010
369 Ga0307513_10019740
370 Ga0307513_10099119
371 Ga0307509_10181592
372 Ga0307408_100062963
373 Ga0307405_10443857
374 Ga0307413_10008476
375 Ga0307410_10019819
376 Ga0307406_10005737
377 Ga0307406_10122779
378 Ga0307407_10022631
379 Ga0307407_10459453
380 Ga0307409_100012963
381 Ga0307409_100047550
382 Ga0307416_100123279
383 Ga0307414_10105127
384 Ga0307414_10678100
385 Ga0307411_10048095
386 Ga0307415_100380579
387 Ga0373956_0102941
388 Ga0373955_0426528
389 Ga0373937_0350573
390 Ga0395901_0991481
391 Ga0451791_0267567
392 Ga0451807_2290999
393 Ga0451837_0567630
394 Ga0451843_0839990
395 Ga0451577_0102094
396 Ga0495603_0082045
397 Ga0495603_0304385
398 Ga0495638_0003825
399 Ga0495638_0050908
400 Ga0495580_0142012
401 Ga0495662_0228268
402 Ga0495584_0108166
403 Ga0495594_0107119
404 Ga0495594_0196132
405 Ga0495606_0090685
406 Ga0495616_0006572
407 Ga0495630_0128986
408 Ga0495631_0047668
409 Ga0495666_0016804
410 Ga0495666_0053407
411 Ga0495666_0088269
412 Ga0495642_0113613
413 Ga0495652_0067329
414 Ga0495665_0056383
415 Ga0495665_0063302
416 Ga0495665_0273843
417 Ga0495640_0242119
418 Ga0495586_0037288
419 Ga0495587_0047008
420 Ga0495597_0000750
421 Ga0495622_0052977
422 Ga0495633_0109078
423 Ga0495667_0161036
424 Ga0495668_0017193
425 Ga0495668_0109614
426 Ga0495668_0200627
427 Ga0495634_0218910
428 Ga0495625_0010426
429 Ga0495625_0030951
430 Ga0495625_0053182
431 Ga0495661_0059915
432 Ga0495588_0023747
433 Ga0495588_0024022
434 Ga0495588_0053086
435 Ga0495646_0118017
436 Ga0495613_0077562
437 Ga0495649_0002890
438 Ga0495600_0077432
439 Ga0495581_0039490
440 Ga0495604_0104486
441 Ga0495604_0174853
442 Ga0495674_0004779
443 Ga0495676_0063743
444 Ga0495680_0087017
445 Ga0495683_0092427
446 Ga0495675_0165042
447 Ga0495614_0066322
448 Ga0496114_0373964
449 Ga0496115_0005153
450 Ga0496115_0180727
451 Ga0496115_0506220
452 Ga0496124_0050202
453 Ga0496126_0090389
454 Ga0501036_0297093
455 Ga0501040_0233390
456 Ga0501041_0311382
457 Ga0501042_0059779
458 Ga0501067_0045999
459 Ga0501068_0003685
460 Ga0501068_0151878
461 Ga0501070_0058028
462 Ga0501070_0226597
463 Ga0501072_0189745
464 Ga0501073_0018851
465 Ga0501074_0047060
466 Ga0501076_0095140
467 Ga0501077_0032072
468 Ga0501079_0001111
469 Ga0501080_0126748
470 Ga0501080_0265689
471 Ga0501083_0013752
472 nmdc:mga08y16_120507_c1
473 Ga0501084_0120036
474 Ga0501082_0075194

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03591

AzlC

AzlC protein

32

174

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oa6-assembly1.cif.gz_B aristolochene synthase from aspergillus terreus complexed with pyrophosphate 0.3173 49 151
8fed-assembly1.cif.gz_K structure of mce1-lucb complex from mycobacterium smegmatis (map1) 0.311 34 160
7zoy-assembly1.cif.gz_A crystal structure of synechocystis halorhodopsin (syhr), so4-bound form, ground state 0.3102 29 162
3bny-assembly1.cif.gz_D crystal structure of aristolochene synthase complexed with 2-fluorofarnesyl diphosphate (2f-fpp) 0.3026 49 151
5aqd-assembly1.cif.gz_P crystal structure of phormidium phycoerythrin at ph 8.5 0.2896 2 157
ID Description Score Start End Superfamily
af_Q9M007_41_449_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.4234 74 164 1.20.1530.20
af_Q2FVB6_8_378_1.20.1720.10 Mainly Alpha;Up-down Bundle;Multidrug resistance protein D;Multidrug resistance protein D 0.3546 18 181 1.20.1720.10
af_K7MPH0_48_451_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.3525 72 154 1.20.1530.20
af_A0A1D6MVG0_125_298_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.3504 83 156 1.20.1530.20
af_Q4DN15_2_175_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3393 11 159 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A5C8X9V5-F1-model_v4 deleted 0.8661 11 164
AF-A0A7C5MJI2-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.8633 7 185 GO:0005886
GO:1903785
AF-C7RR12-F1-model_v4 AzlC family protein 0.8622 7 188 GO:0005886
GO:1903785
AF-A0A7Z9UYT9-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.8613 10 159 GO:0005886
GO:1903785
AF-A0A7W0LRQ9-F1-model_v4 AzlC family ABC transporter permease 0.861 5 157 GO:0005886
GO:1903785

Map