F350299

General Info

Members Datasets Scaffolds Average Seq Length
237 168 235 152

Family's Representative Sequence

Representative Sequence 3300046523|Ga0495644_0255814|Ga0495644_0255814_106_636
Length 176
Sequence MPIFASFVCGLVFGCGLTVSSMIQPAKVLGFLDVFGIRSGAWDPSLAVVMAAGLAVASIGYALVRRRSPLFEKESLWPTKKDIDQSLLFGALLFGVGWGLVGLCPGPAVANLATLSLPVIIFVIAMALGMLAHDLWPARAAVGAADNIKILKCPPSNTSITPLPNSGICYDDRKTF

Samples

Sample ID Description Type Environment
1 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
2 2643221638 Duganella sp. Root336D2 Isolate Unclassified
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
61 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
62 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
63 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
64 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
65 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
66 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
67 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
68 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
69 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
70 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
71 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
72 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
73 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
74 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
75 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
76 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
77 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
78 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
79 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
80 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
81 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
82 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
84 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
88 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
89 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
90 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
91 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
92 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
93 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
94 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
95 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
96 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
97 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
98 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
99 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
100 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
101 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
102 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
103 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
104 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
105 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
106 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
107 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
108 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
109 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
110 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
111 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
112 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
113 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
114 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
115 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
116 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
117 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
118 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
119 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
120 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
121 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
122 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
123 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
124 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
125 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
126 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
127 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
128 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
129 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
130 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
131 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
132 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
133 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
134 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
135 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
136 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
137 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
138 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
139 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
145 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
151 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
152 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
155 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
156 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
160 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
161 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
162 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
163 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
164 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
165 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
166 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
167 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
168 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.73
Metatranscriptomes 0.42
Isolates 0.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.53
Nodule 0
Rhizoplane 5.06
Rhizosphere 90.72
Stem 0
Stem Tuber 0
Unclassified 1.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10032908 3300005328 Bacteria 2972
2 Ga0070676_10761951 3300005328 Bacteria 711
3 Ga0070683_100654997 3300005329 Bacteria 1005
4 Ga0070690_100061737 3300005330 Bacteria 2415
5 Ga0070690_100137264 3300005330 Bacteria 1657
6 Ga0070669_100985825 3300005353 Bacteria 722
7 Ga0070671_100440397 3300005355 Bacteria 1117
8 Ga0070671_101150356 3300005355 Bacteria 682
9 Ga0070671_101314267 3300005355 Bacteria 638
10 Ga0070688_101150794 3300005365 Bacteria 622
11 Ga0070709_11231911 3300005434 Bacteria 602
12 Ga0070714_100368390 3300005435 Bacteria 1352
13 Ga0070713_100187763 3300005436 Bacteria 1861
14 Ga0070710_10083773 3300005437 Bacteria 1867
15 Ga0070710_10931325 3300005437 Bacteria 629
16 Ga0070701_10224626 3300005438 Bacteria 1122
17 Ga0070705_100390849 3300005440 Bacteria 1027
18 Ga0068867_100701902 3300005459 Bacteria 893
19 Ga0070698_100393836 3300005471 Bacteria 1318
20 Ga0070684_100314777 3300005535 Bacteria 1437
21 Ga0070697_101911319 3300005536 Unclassified 531
22 Ga0070664_100148101 3300005564 Bacteria 2071
23 Ga0068854_100268694 3300005578 Bacteria 1368
24 Ga0068856_101496137 3300005614 Unclassified 689
25 Ga0068852_101545454 3300005616 Bacteria 686
26 Ga0068861_100489732 3300005719 Bacteria 1109
27 Ga0070717_10066070 3300006028 Bacteria 3007
28 Ga0070717_11166415 3300006028 Bacteria 701
29 Ga0070717_11198962 3300006028 Bacteria 691
30 Ga0075365_10100589 3300006038 Bacteria 1979
31 Ga0075365_10494189 3300006038 Bacteria 865
32 Ga0070712_101179743 3300006175 Bacteria 666
33 Ga0068871_100875894 3300006358 Bacteria 831
34 Ga0075428_100004608 3300006844 Bacteria 15246
35 Ga0075428_100137752 3300006844 Bacteria 2654
36 Ga0075430_100293623 3300006846 Bacteria 1345
37 Ga0075430_100995256 3300006846 Bacteria 691
38 Ga0075431_100104787 3300006847 Bacteria 2919
39 Ga0075433_10111208 3300006852 Bacteria 2430
40 Ga0075434_100037795 3300006871 Bacteria 4779
41 Ga0075434_100399694 3300006871 Bacteria 1395
42 Ga0075429_100058937 3300006880 Bacteria 3344
43 Ga0068865_100490339 3300006881 Bacteria 1023
44 Ga0075436_100612671 3300006914 Bacteria 803
45 Ga0099795_10151723 3300007788 Bacteria 949
46 Ga0105245_12096050 3300009098 Unclassified 619
47 Ga0105247_10264461 3300009101 Bacteria 1181
48 Ga0114129_10090201 3300009147 Bacteria 4249
49 Ga0114129_10258564 3300009147 Bacteria 2335
50 Ga0114129_11043545 3300009147 Unclassified 1027
51 Ga0105243_10845116 3300009148 Unclassified 906
52 Ga0105248_10305117 3300009177 Bacteria 1793
53 Ga0105248_11962501 3300009177 Unclassified 665
54 Ga0105249_11049443 3300009553 Bacteria 884
55 Ga0105239_10671521 3300010375 Bacteria 1184
56 Ga0157375_11731820 3300013308 Bacteria 740
57 Ga0157380_10009980 3300014326 Bacteria 6815
58 Ga0157380_10458507 3300014326 Bacteria 1226
59 Ga0157379_10383066 3300014968 Bacteria 1290
60 Ga0207692_10052659 3300025898 Bacteria 2070
61 Ga0207705_10034643 3300025909 Bacteria 3610
62 Ga0207681_10824853 3300025923 Bacteria 775
63 Ga0207700_10011787 3300025928 Bacteria 5596
64 Ga0207700_10162627 3300025928 Bacteria 1855
65 Ga0207664_10252728 3300025929 Bacteria 1539
66 Ga0207644_10719321 3300025931 Bacteria 833
67 Ga0207690_10277743 3300025932 Bacteria 1304
68 Ga0207706_10093002 3300025933 Bacteria 2652
69 Ga0207661_10288359 3300025944 Bacteria 1468
70 Ga0207679_10062570 3300025945 Bacteria 2774
71 Ga0207712_11156782 3300025961 Bacteria 690
72 Ga0207678_10109780 3300026067 Bacteria 2353
73 Ga0207648_10933247 3300026089 Bacteria 811
74 Ga0265763_1000375 3300030763 Bacteria 2613
75 Ga0265332_10117874 3300031238 Bacteria 1116
76 Ga0265332_10148003 3300031238 Bacteria 983
77 Ga0265339_10039892 3300031249 Bacteria 2612
78 Ga0265331_10043372 3300031250 Bacteria 2179
79 Ga0307408_100006721 3300031548 Bacteria 7626
80 Ga0265314_10114058 3300031711 Bacteria 1712
81 Ga0265342_10071907 3300031712 Bacteria 2014
82 Ga0307516_10009049 3300031730 Bacteria 11156
83 Ga0373926_0014172 3300035083 Bacteria 2708
84 Ga0373936_0114402 3300035113 Bacteria 1148
85 Ga0373936_0314968 3300035113 Bacteria 708
86 Ga0373954_0136528 3300035118 Bacteria 1195
87 Ga0373956_0041635 3300035119 Bacteria 2040
88 Ga0373957_0004133 3300035120 Bacteria 4385
89 Ga0373943_0124661 3300035170 Bacteria 1372
90 Ga0373946_0068442 3300035171 Bacteria 1527
91 Ga0373955_0022469 3300035172 Bacteria 3200
92 Ga0373961_0044025 3300035241 Bacteria 1300
93 Ga0373931_0261434 3300035691 Bacteria 1056
94 Ga0373931_0653405 3300035691 Bacteria 691
95 Ga0373931_1059872 3300035691 Bacteria 550
96 Ga0373935_0018024 3300035692 Bacteria 4291
97 Ga0373935_0042788 3300035692 Bacteria 2849
98 Ga0373935_0121152 3300035692 Bacteria 1748
99 Ga0373927_0061452 3300035695 Bacteria 2430
100 Ga0373927_0074274 3300035695 Bacteria 2201
101 Ga0373927_0763096 3300035695 Bacteria 639
102 Ga0373933_0125969 3300035724 Unclassified 1607
103 Ga0373933_0301430 3300035724 Bacteria 1037
104 Ga0373933_0518775 3300035724 Bacteria 781
105 Ga0373933_0740600 3300035724 Bacteria 647
106 Ga0373947_0006547 3300035725 Bacteria 6757
107 Ga0373947_0010828 3300035725 Bacteria 5233
108 Ga0373947_0125103 3300035725 Bacteria 1636
109 Ga0373937_0001937 3300036401 Bacteria 17319
110 Ga0373937_0004407 3300036401 Bacteria 11964
111 Ga0373937_0048634 3300036401 Bacteria 3883
112 Ga0373937_0086712 3300036401 Bacteria 2897
113 Ga0373937_0125862 3300036401 Bacteria 2390
114 Ga0373937_0407756 3300036401 Bacteria 1290
115 Ga0373937_0639769 3300036401 Bacteria 1009
116 Ga0373925_0011989 3300037068 Bacteria 6276
117 Ga0373925_0038122 3300037068 Bacteria 3551
118 Ga0373925_0110378 3300037068 Unclassified 2124
119 Ga0395899_0802966 3300037312 Bacteria 581
120 Ga0395900_1580308 3300037418 Bacteria 567
121 Ga0395901_1241146 3300038443 Bacteria 709
122 Ga0395901_1507264 3300038443 Bacteria 628
123 Ga0436360_0139916 3300039438 Bacteria 1057
124 Ga0451853_1948128 3300041512 Bacteria 821
125 Ga0450923_100453 3300042125 Bacteria 667
126 Ga0466958_0527543 3300045836 Bacteria 767
127 Ga0495592_0005905 3300046454 Bacteria 9089
128 Ga0495592_0263575 3300046454 Bacteria 1134
129 Ga0495603_0006259 3300046455 Bacteria 7115
130 Ga0495603_0084196 3300046455 Bacteria 1862
131 Ga0495641_0014915 3300046461 Bacteria 4184
132 Ga0495651_0007900 3300046462 Bacteria 8151
133 Ga0495651_0094102 3300046462 Bacteria 2243
134 Ga0495651_0606402 3300046462 Bacteria 690
135 Ga0495653_0006933 3300046463 Bacteria 9304
136 Ga0495653_0024669 3300046463 Bacteria 4841
137 Ga0495580_0231917 3300046472 Bacteria 1267
138 Ga0495582_0005638 3300046473 Bacteria 6969
139 Ga0495639_0052563 3300046475 Bacteria 1855
140 Ga0495639_0163300 3300046475 Bacteria 1079
141 Ga0495639_0600389 3300046475 Bacteria 566
142 Ga0495664_0005997 3300046477 Bacteria 6698
143 Ga0495664_0042896 3300046477 Bacteria 2681
144 Ga0495585_0353174 3300046492 Bacteria 714
145 Ga0495594_0003673 3300046499 Bacteria 7882
146 Ga0495607_0093352 3300046501 Bacteria 1626
147 Ga0495607_0499202 3300046501 Bacteria 540
148 Ga0495618_0002221 3300046514 Bacteria 12656
149 Ga0495628_0045430 3300046516 Bacteria 3492
150 Ga0495628_0482645 3300046516 Bacteria 897
151 Ga0495630_0270364 3300046517 Bacteria 1298
152 Ga0495644_0255814 3300046523 Unclassified 681
153 Ga0495666_0195387 3300046526 Unclassified 931
154 Ga0495652_0042041 3300046529 Bacteria 3942
155 Ga0495652_0073946 3300046529 Bacteria 2835
156 Ga0495665_0044524 3300046531 Bacteria 2358
157 Ga0495667_0001723 3300046559 Bacteria 14518
158 Ga0495667_0511830 3300046559 Bacteria 752
159 Ga0495634_0011236 3300046642 Bacteria 6528
160 Ga0495634_0317658 3300046642 Bacteria 938
161 Ga0495635_0007930 3300046663 Bacteria 7417
162 Ga0495588_0184382 3300046674 Bacteria 1103
163 Ga0495657_0009717 3300046675 Bacteria 7273
164 Ga0495599_0004227 3300046678 Bacteria 8484
165 Ga0495599_0550951 3300046678 Unclassified 675
166 Ga0495623_0003456 3300046679 Bacteria 10454
167 Ga0495646_0001948 3300046680 Bacteria 12440
168 Ga0495647_0006707 3300046681 Bacteria 3829
169 Ga0495658_0009915 3300046683 Bacteria 4752
170 Ga0495613_0062717 3300046689 Bacteria 2720
171 Ga0495613_0092821 3300046689 Bacteria 2185
172 Ga0495624_0051561 3300046690 Bacteria 2603
173 Ga0495624_0212481 3300046690 Bacteria 1173
174 Ga0495670_0102954 3300046691 Bacteria 1472
175 Ga0495600_0137924 3300046809 Bacteria 1583
176 Ga0495581_0104113 3300047315 Bacteria 1649
177 Ga0495604_0000434 3300047317 Bacteria 37257
178 Ga0495674_0002439 3300047319 Bacteria 18169
179 Ga0495674_0167948 3300047319 Bacteria 1832
180 Ga0495676_0003011 3300047321 Bacteria 15232
181 Ga0495680_0002854 3300047322 Bacteria 17362
182 Ga0495680_0225489 3300047322 Bacteria 1336
183 Ga0495675_0006122 3300047444 Bacteria 7364
184 Ga0495679_118303 3300047446 Bacteria 726
185 Ga0495684_0199978 3300047471 Bacteria 1474
186 Ga0495593_0098723 3300047673 Bacteria 1499
187 Ga0495593_0100412 3300047673 Bacteria 1484
188 Ga0495602_0009466 3300048088 Bacteria 10128
189 Ga0495614_0270076 3300048089 Bacteria 781
190 Ga0496100_0444044 3300048903 Unclassified 994
191 Ga0496101_0361709 3300048904 Bacteria 1141
192 Ga0496104_0486869 3300048907 Unclassified 1145
193 Ga0496105_0211519 3300048908 Unclassified 1581
194 Ga0496108_0545245 3300048911 Bacteria 1012
195 Ga0496109_0120731 3300048912 Bacteria 2442
196 Ga0496109_1118948 3300048912 Bacteria 724
197 Ga0496112_0678206 3300048915 Bacteria 959
198 Ga0496113_0454248 3300048916 Bacteria 1030
199 Ga0496114_0267570 3300048917 Unclassified 1506
200 Ga0496114_1066170 3300048917 Bacteria 692
201 Ga0496115_0589569 3300048918 Bacteria 885
202 Ga0501031_0083431 3300049568 Bacteria 2083
203 Ga0501032_0875727 3300049569 Bacteria 566
204 Ga0501036_1505550 3300049572 Bacteria 544
205 Ga0501038_0731448 3300049574 Bacteria 739
206 Ga0501042_0471126 3300049578 Bacteria 911
207 Ga0501070_0347701 3300049586 Bacteria 1204
208 Ga0501035_0547332 3300049822 Bacteria 948
209 nmdc:mga0yw44_171860_c1 3300050492 Bacteria 1423
210 nmdc:mga05p37_179406_c1 3300050507 Bacteria 2578
211 nmdc:mga05p37_717131_c1 3300050507 Bacteria 1108
212 nmdc:mga09592_77371_c1 3300050508 Bacteria 2830
213 nmdc:mga0qj67_296147_c1 3300050509 Bacteria 1311
214 nmdc:mga0qj67_869720_c1 3300050509 Bacteria 711
215 nmdc:mga0qj67_94379_c1 3300050509 Bacteria 2406
216 nmdc:mga06r32_308111_c1 3300050510 Bacteria 1569
217 nmdc:mga08y16_976454_c1 3300050511 Bacteria 828
218 nmdc:mga0n895_237320_c1 3300050512 Bacteria 1850
219 nmdc:mga0n895_329653_c1 3300050512 Bacteria 1547
220 nmdc:mga0rr50_22662_c1 3300050513 Bacteria 4315
221 nmdc:mga08x19_385728_c1 3300050514 Unclassified 981
222 nmdc:mga0a205_232640_c1 3300050515 Bacteria 1726
223 nmdc:mga0sz30_295226_c1 3300050516 Bacteria 722
224 Ga0495601_0001161 3300053077 Bacteria 14400
225 Ga0495601_0040068 3300053077 Bacteria 2933
226 Ga0495612_0007295 3300053078 Bacteria 4522
227 Ga0495595_0008360 3300053084 Bacteria 4247
228 Ga0495595_0119104 3300053084 Unclassified 1285
229 Ga0495595_0334135 3300053084 Unclassified 764
230 Ga0495619_0009353 3300053085 Bacteria 6186
231 Ga0495619_0010725 3300053085 Bacteria 5769
232 Ga0495619_0340077 3300053085 Bacteria 1038
233 Ga0495619_0465894 3300053085 Bacteria 870
234 Ga0500578_0747476 3300053086 Bacteria 522
235 Ga0500641_0005262 3300053096 Bacteria 4584

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_1580308 Ga0395900_1580308_183_557 122
2 3300036401 Ga0373937_0407756 Ga0373937_0407756_38_439 131
3 3300050509 nmdc:mga0qj67_94379_c1 nmdc:mga0qj67_94379_c1_12_425 131
4 3300046462 Ga0495651_0606402 Ga0495651_0606402_13_423 134
5 3300046559 Ga0495667_0511830 Ga0495667_0511830_25_435 134
6 iso_pu_bacteria 2643221554 2643789642 134
7 iso_pu_bacteria 2643221638 2644214617 134
8 3300045836 Ga0466958_0527543 Ga0466958_0527543_13_426 135
9 3300049569 Ga0501032_0875727 Ga0501032_0875727_118_534 137
10 3300005616 Ga0068852_101545454 Ga0068852_1015454542 138
11 3300025909 Ga0207705_10034643 Ga0207705_100346435 138
12 3300031548 Ga0307408_100006721 Ga0307408_1000067215 138
13 3300042125 Ga0450923_100453 Ga0450923_100453_195_611 138
14 3300005437 Ga0070710_10931325 Ga0070710_109313251 140
15 3300005471 Ga0070698_100393836 Ga0070698_1003938362 140
16 3300005536 Ga0070697_101911319 Ga0070697_1019113191 140
17 3300006852 Ga0075433_10111208 Ga0075433_101112082 140
18 3300006871 Ga0075434_100037795 Ga0075434_1000377953 140
19 3300006871 Ga0075434_100399694 Ga0075434_1003996943 140
20 3300006914 Ga0075436_100612671 Ga0075436_1006126712 140
21 3300009147 Ga0114129_11043545 Ga0114129_110435452 140
22 3300025928 Ga0207700_10162627 Ga0207700_101626273 140
23 3300050507 nmdc:mga05p37_179406_c1 nmdc:mga05p37_179406_c1_15_452 140
24 3300050512 nmdc:mga0n895_237320_c1 nmdc:mga0n895_237320_c1_773_1219 140
25 3300050512 nmdc:mga0n895_329653_c1 nmdc:mga0n895_329653_c1_194_631 140
26 3300050513 nmdc:mga0rr50_22662_c1 nmdc:mga0rr50_22662_c1_2937_3374 140
27 3300050514 nmdc:mga08x19_385728_c1 nmdc:mga08x19_385728_c1_193_630 140
28 3300050515 nmdc:mga0a205_232640_c1 nmdc:mga0a205_232640_c1_629_1093 140
29 3300049586 Ga0501070_0347701 Ga0501070_0347701_100_564 142
30 3300026067 Ga0207678_10109780 Ga0207678_101097802 143
31 3300039438 Ga0436360_0139916 Ga0436360_0139916_113_562 144
32 3300006028 Ga0070717_11198962 Ga0070717_111989621 145
33 3300005328 Ga0070676_10761951 Ga0070676_107619511 146
34 3300005330 Ga0070690_100137264 Ga0070690_1001372641 146
35 3300005355 Ga0070671_100440397 Ga0070671_1004403972 146
36 3300005564 Ga0070664_100148101 Ga0070664_1001481013 146
37 3300005578 Ga0068854_100268694 Ga0068854_1002686943 146
38 3300005614 Ga0068856_101496137 Ga0068856_1014961371 146
39 3300006358 Ga0068871_100875894 Ga0068871_1008758942 146
40 3300010375 Ga0105239_10671521 Ga0105239_106715212 146
41 3300025931 Ga0207644_10719321 Ga0207644_107193212 146
42 3300025932 Ga0207690_10277743 Ga0207690_102777432 146
43 3300025933 Ga0207706_10093002 Ga0207706_100930022 146
44 3300025945 Ga0207679_10062570 Ga0207679_100625702 146
45 3300035691 Ga0373931_0261434 Ga0373931_0261434_182_637 146
46 3300053086 Ga0500578_0747476 Ga0500578_0747476_70_510 146
47 3300006846 Ga0075430_100995256 Ga0075430_1009952561 147
48 3300014326 Ga0157380_10458507 Ga0157380_104585072 147
49 3300035171 Ga0373946_0068442 Ga0373946_0068442_360_803 147
50 3300035692 Ga0373935_0121152 Ga0373935_0121152_843_1286 147
51 3300035724 Ga0373933_0740600 Ga0373933_0740600_40_492 147
52 3300035725 Ga0373947_0125103 Ga0373947_0125103_866_1309 147
53 3300036401 Ga0373937_0639769 Ga0373937_0639769_429_881 147
54 3300037068 Ga0373925_0011989 Ga0373925_0011989_216_659 147
55 3300050509 nmdc:mga0qj67_869720_c1 nmdc:mga0qj67_869720_c1_102_545 147
56 3300006844 Ga0075428_100004608 Ga0075428_1000046088 148
57 3300009177 Ga0105248_11962501 Ga0105248_119625012 148
58 3300005434 Ga0070709_11231911 Ga0070709_112319111 149
59 3300005435 Ga0070714_100368390 Ga0070714_1003683902 149
60 3300005436 Ga0070713_100187763 Ga0070713_1001877631 149
61 3300005437 Ga0070710_10083773 Ga0070710_100837732 149
62 3300006175 Ga0070712_101179743 Ga0070712_1011797431 149
63 3300009147 Ga0114129_10090201 Ga0114129_100902013 149
64 3300025898 Ga0207692_10052659 Ga0207692_100526593 149
65 3300025928 Ga0207700_10011787 Ga0207700_100117875 149
66 3300025929 Ga0207664_10252728 Ga0207664_102527283 149
67 3300030763 Ga0265763_1000375 Ga0265763_10003751 149
68 3300031238 Ga0265332_10148003 Ga0265332_101480032 149
69 3300035113 Ga0373936_0314968 Ga0373936_0314968_61_531 149
70 3300035118 Ga0373954_0136528 Ga0373954_0136528_262_732 149
71 3300035119 Ga0373956_0041635 Ga0373956_0041635_1081_1551 149
72 3300035120 Ga0373957_0004133 Ga0373957_0004133_1828_2298 149
73 3300035172 Ga0373955_0022469 Ga0373955_0022469_2535_3005 149
74 3300035691 Ga0373931_0653405 Ga0373931_0653405_91_561 149
75 3300035692 Ga0373935_0018024 Ga0373935_0018024_614_1084 149
76 3300035695 Ga0373927_0074274 Ga0373927_0074274_973_1443 149
77 3300035724 Ga0373933_0301430 Ga0373933_0301430_237_707 149
78 3300035725 Ga0373947_0010828 Ga0373947_0010828_4479_4949 149
79 3300036401 Ga0373937_0004407 Ga0373937_0004407_4044_4514 149
80 3300037068 Ga0373925_0110378 Ga0373925_0110378_443_913 149
81 3300037312 Ga0395899_0802966 Ga0395899_0802966_80_538 149
82 3300038443 Ga0395901_1241146 Ga0395901_1241146_226_684 149
83 3300038443 Ga0395901_1507264 Ga0395901_1507264_36_494 149
84 3300046454 Ga0495592_0005905 Ga0495592_0005905_8544_9014 149
85 3300046462 Ga0495651_0007900 Ga0495651_0007900_3719_4189 149
86 3300046463 Ga0495653_0006933 Ga0495653_0006933_4975_5445 149
87 3300046475 Ga0495639_0163300 Ga0495639_0163300_452_913 149
88 3300046475 Ga0495639_0600389 Ga0495639_0600389_62_532 149
89 3300046477 Ga0495664_0005997 Ga0495664_0005997_5376_5846 149
90 3300046514 Ga0495618_0002221 Ga0495618_0002221_12033_12503 149
91 3300046516 Ga0495628_0045430 Ga0495628_0045430_2463_2933 149
92 3300046529 Ga0495652_0073946 Ga0495652_0073946_2159_2629 149
93 3300046559 Ga0495667_0001723 Ga0495667_0001723_10569_11039 149
94 3300046642 Ga0495634_0011236 Ga0495634_0011236_636_1106 149
95 3300046663 Ga0495635_0007930 Ga0495635_0007930_6296_6766 149
96 3300046675 Ga0495657_0009717 Ga0495657_0009717_3858_4328 149
97 3300046678 Ga0495599_0004227 Ga0495599_0004227_6641_7111 149
98 3300046679 Ga0495623_0003456 Ga0495623_0003456_1046_1516 149
99 3300046680 Ga0495646_0001948 Ga0495646_0001948_1401_1871 149
100 3300046689 Ga0495613_0062717 Ga0495613_0062717_339_809 149
101 3300046690 Ga0495624_0212481 Ga0495624_0212481_432_902 149
102 3300046809 Ga0495600_0137924 Ga0495600_0137924_237_707 149
103 3300047315 Ga0495581_0104113 Ga0495581_0104113_1075_1545 149
104 3300047317 Ga0495604_0000434 Ga0495604_0000434_28455_28925 149
105 3300047319 Ga0495674_0002439 Ga0495674_0002439_2478_2948 149
106 3300047322 Ga0495680_0002854 Ga0495680_0002854_4345_4815 149
107 3300047444 Ga0495675_0006122 Ga0495675_0006122_1128_1598 149
108 3300047673 Ga0495593_0100412 Ga0495593_0100412_535_1005 149
109 3300048088 Ga0495602_0009466 Ga0495602_0009466_8519_8989 149
110 3300048908 Ga0496105_0211519 Ga0496105_0211519_847_1317 149
111 3300048912 Ga0496109_0120731 Ga0496109_0120731_96_566 149
112 3300048916 Ga0496113_0454248 Ga0496113_0454248_320_790 149
113 3300049572 Ga0501036_1505550 Ga0501036_1505550_36_494 149
114 3300049574 Ga0501038_0731448 Ga0501038_0731448_88_546 149
115 3300049822 Ga0501035_0547332 Ga0501035_0547332_150_608 149
116 3300053077 Ga0495601_0040068 Ga0495601_0040068_378_848 149
117 3300053078 Ga0495612_0007295 Ga0495612_0007295_3815_4285 149
118 3300053084 Ga0495595_0008360 Ga0495595_0008360_2931_3401 149
119 3300053085 Ga0495619_0010725 Ga0495619_0010725_3268_3738 149
120 3300005330 Ga0070690_100061737 Ga0070690_1000617374 150
121 3300005353 Ga0070669_100985825 Ga0070669_1009858252 150
122 3300005438 Ga0070701_10224626 Ga0070701_102246262 150
123 3300005440 Ga0070705_100390849 Ga0070705_1003908492 150
124 3300005459 Ga0068867_100701902 Ga0068867_1007019022 150
125 3300005719 Ga0068861_100489732 Ga0068861_1004897323 150
126 3300025923 Ga0207681_10824853 Ga0207681_108248531 150
127 3300026089 Ga0207648_10933247 Ga0207648_109332472 150
128 3300049568 Ga0501031_0083431 Ga0501031_0083431_882_1364 150
129 3300005355 Ga0070671_101150356 Ga0070671_1011503562 151
130 3300006028 Ga0070717_10066070 Ga0070717_100660704 151
131 3300006881 Ga0068865_100490339 Ga0068865_1004903392 151
132 3300009098 Ga0105245_12096050 Ga0105245_120960501 151
133 3300009177 Ga0105248_10305117 Ga0105248_103051172 151
134 3300014968 Ga0157379_10383066 Ga0157379_103830662 151
135 3300035083 Ga0373926_0014172 Ga0373926_0014172_421_882 151
136 3300035113 Ga0373936_0114402 Ga0373936_0114402_179_640 151
137 3300035170 Ga0373943_0124661 Ga0373943_0124661_720_1181 151
138 3300035691 Ga0373931_1059872 Ga0373931_1059872_49_510 151
139 3300035692 Ga0373935_0042788 Ga0373935_0042788_1404_1865 151
140 3300035695 Ga0373927_0061452 Ga0373927_0061452_1579_2040 151
141 3300035724 Ga0373933_0125969 Ga0373933_0125969_126_587 151
142 3300035724 Ga0373933_0518775 Ga0373933_0518775_251_712 151
143 3300035725 Ga0373947_0006547 Ga0373947_0006547_6123_6584 151
144 3300036401 Ga0373937_0048634 Ga0373937_0048634_1714_2175 151
145 3300036401 Ga0373937_0086712 Ga0373937_0086712_1983_2444 151
146 3300037068 Ga0373925_0038122 Ga0373925_0038122_15_476 151
147 3300046455 Ga0495603_0006259 Ga0495603_0006259_6502_6963 151
148 3300046455 Ga0495603_0084196 Ga0495603_0084196_585_1046 151
149 3300046461 Ga0495641_0014915 Ga0495641_0014915_89_550 151
150 3300046463 Ga0495653_0024669 Ga0495653_0024669_1045_1506 151
151 3300046472 Ga0495580_0231917 Ga0495580_0231917_463_924 151
152 3300046473 Ga0495582_0005638 Ga0495582_0005638_634_1095 151
153 3300046475 Ga0495639_0052563 Ga0495639_0052563_323_784 151
154 3300046477 Ga0495664_0042896 Ga0495664_0042896_472_933 151
155 3300046492 Ga0495585_0353174 Ga0495585_0353174_31_561 151
156 3300046499 Ga0495594_0003673 Ga0495594_0003673_4941_5402 151
157 3300046501 Ga0495607_0093352 Ga0495607_0093352_595_1125 151
158 3300046501 Ga0495607_0499202 Ga0495607_0499202_22_483 151
159 3300046516 Ga0495628_0482645 Ga0495628_0482645_166_627 151
160 3300046517 Ga0495630_0270364 Ga0495630_0270364_397_858 151
161 3300046523 Ga0495644_0255814 Ga0495644_0255814_106_636 151
162 3300046526 Ga0495666_0195387 Ga0495666_0195387_115_576 151
163 3300046529 Ga0495652_0042041 Ga0495652_0042041_93_554 151
164 3300046531 Ga0495665_0044524 Ga0495665_0044524_516_977 151
165 3300046642 Ga0495634_0317658 Ga0495634_0317658_373_834 151
166 3300046674 Ga0495588_0184382 Ga0495588_0184382_243_704 151
167 3300046678 Ga0495599_0550951 Ga0495599_0550951_86_547 151
168 3300046681 Ga0495647_0006707 Ga0495647_0006707_1000_1461 151
169 3300046683 Ga0495658_0009915 Ga0495658_0009915_680_1141 151
170 3300046689 Ga0495613_0092821 Ga0495613_0092821_472_933 151
171 3300046690 Ga0495624_0051561 Ga0495624_0051561_230_691 151
172 3300046691 Ga0495670_0102954 Ga0495670_0102954_945_1406 151
173 3300047319 Ga0495674_0167948 Ga0495674_0167948_573_1034 151
174 3300047321 Ga0495676_0003011 Ga0495676_0003011_7651_8112 151
175 3300047322 Ga0495680_0225489 Ga0495680_0225489_89_550 151
176 3300047446 Ga0495679_118303 Ga0495679_118303_125_586 151
177 3300047471 Ga0495684_0199978 Ga0495684_0199978_449_910 151
178 3300047673 Ga0495593_0098723 Ga0495593_0098723_753_1214 151
179 3300048089 Ga0495614_0270076 Ga0495614_0270076_22_483 151
180 3300048907 Ga0496104_0486869 Ga0496104_0486869_122_577 151
181 3300048912 Ga0496109_1118948 Ga0496109_1118948_222_683 151
182 3300048915 Ga0496112_0678206 Ga0496112_0678206_308_769 151
183 3300053077 Ga0495601_0001161 Ga0495601_0001161_13082_13543 151
184 3300053084 Ga0495595_0119104 Ga0495595_0119104_483_938 151
185 3300053085 Ga0495619_0009353 Ga0495619_0009353_2453_2914 151
186 3300053085 Ga0495619_0340077 Ga0495619_0340077_563_1024 151
187 3300053085 Ga0495619_0465894 Ga0495619_0465894_193_651 151
188 3300005328 Ga0070676_10032908 Ga0070676_100329083 152
189 3300005329 Ga0070683_100654997 Ga0070683_1006549972 152
190 3300005355 Ga0070671_101314267 Ga0070671_1013142671 152
191 3300005365 Ga0070688_101150794 Ga0070688_1011507942 152
192 3300005535 Ga0070684_100314777 Ga0070684_1003147772 152
193 3300006028 Ga0070717_11166415 Ga0070717_111664151 152
194 3300006038 Ga0075365_10100589 Ga0075365_101005893 152
195 3300006038 Ga0075365_10494189 Ga0075365_104941892 152
196 3300006844 Ga0075428_100137752 Ga0075428_1001377523 152
197 3300006846 Ga0075430_100293623 Ga0075430_1002936231 152
198 3300006847 Ga0075431_100104787 Ga0075431_1001047872 152
199 3300006880 Ga0075429_100058937 Ga0075429_1000589371 152
200 3300007788 Ga0099795_10151723 Ga0099795_101517232 152
201 3300009101 Ga0105247_10264461 Ga0105247_102644612 152
202 3300009147 Ga0114129_10258564 Ga0114129_102585642 152
203 3300009148 Ga0105243_10845116 Ga0105243_108451161 152
204 3300009553 Ga0105249_11049443 Ga0105249_110494432 152
205 3300013308 Ga0157375_11731820 Ga0157375_117318201 152
206 3300014326 Ga0157380_10009980 Ga0157380_100099803 152
207 3300025944 Ga0207661_10288359 Ga0207661_102883591 152
208 3300025961 Ga0207712_11156782 Ga0207712_111567822 152
209 3300031238 Ga0265332_10117874 Ga0265332_101178741 152
210 3300031249 Ga0265339_10039892 Ga0265339_100398922 152
211 3300031250 Ga0265331_10043372 Ga0265331_100433721 152
212 3300031711 Ga0265314_10114058 Ga0265314_101140584 152
213 3300031712 Ga0265342_10071907 Ga0265342_100719072 152
214 3300031730 Ga0307516_10009049 Ga0307516_100090499 152
215 3300035241 Ga0373961_0044025 Ga0373961_0044025_303_767 152
216 3300035695 Ga0373927_0763096 Ga0373927_0763096_110_571 152
217 3300036401 Ga0373937_0001937 Ga0373937_0001937_10614_11078 152
218 3300036401 Ga0373937_0125862 Ga0373937_0125862_566_1033 152
219 3300041512 Ga0451853_1948128 Ga0451853_1948128_325_783 152
220 3300046454 Ga0495592_0263575 Ga0495592_0263575_430_894 152
221 3300046462 Ga0495651_0094102 Ga0495651_0094102_1657_2124 152
222 3300048903 Ga0496100_0444044 Ga0496100_0444044_32_496 152
223 3300048904 Ga0496101_0361709 Ga0496101_0361709_75_533 152
224 3300048911 Ga0496108_0545245 Ga0496108_0545245_390_848 152
225 3300048917 Ga0496114_0267570 Ga0496114_0267570_195_659 152
226 3300048917 Ga0496114_1066170 Ga0496114_1066170_223_681 152
227 3300048918 Ga0496115_0589569 Ga0496115_0589569_342_800 152
228 3300049578 Ga0501042_0471126 Ga0501042_0471126_265_729 152
229 3300050492 nmdc:mga0yw44_171860_c1 nmdc:mga0yw44_171860_c1_813_1280 152
230 3300050507 nmdc:mga05p37_717131_c1 nmdc:mga05p37_717131_c1_351_812 152
231 3300050508 nmdc:mga09592_77371_c1 nmdc:mga09592_77371_c1_511_972 152
232 3300050509 nmdc:mga0qj67_296147_c1 nmdc:mga0qj67_296147_c1_124_585 152
233 3300050510 nmdc:mga06r32_308111_c1 nmdc:mga06r32_308111_c1_371_832 152
234 3300050511 nmdc:mga08y16_976454_c1 nmdc:mga08y16_976454_c1_137_598 152
235 3300050516 nmdc:mga0sz30_295226_c1 nmdc:mga0sz30_295226_c1_134_592 152
236 3300053084 Ga0495595_0334135 Ga0495595_0334135_156_620 152
237 3300053096 Ga0500641_0005262 Ga0500641_0005262_226_690 152

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20398

DUF6691

Family of unknown function (DUF6691)

1

144

0.91

Feature Viewer

pLDDT pTM Quality
70.56 0.46 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map