F350246

General Info

Members Datasets Scaffolds Average Seq Length
237 162 474 170

Family's Representative Sequence

Representative Sequence 3300044684|Ga0466966_0248861|Ga0466966_0248861_190_777
Length 195
Sequence MRAVNNRIDSRGLLVRLDARAGRERMSMRIAVTLAATMGAGMLMTGTVQARPEIVSIHNEYSPGTIVVRTSERRLYLILDADHAMRYPVGVGKDGKRWAGTTTIEGKYRYPAWSPPAEVKHDIPSLPDVIPGGSPHNPMGVAAMTLAGGEYAIHGTNKPSSVGHFVSYGCIRMYNADITDLFRRVSVGTPVVVTR

Samples

Sample ID Description Type Environment
1 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
2 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
24 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
42 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
43 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
44 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
45 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
46 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
48 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
49 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
50 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
77 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
78 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
81 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
82 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
83 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
84 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
85 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
86 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
87 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
88 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
89 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
90 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
91 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
92 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
93 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
94 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
95 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
96 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
97 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
98 3300036242 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
99 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
106 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
107 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
108 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
109 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
110 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
111 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
112 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
113 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
114 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
115 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
116 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
117 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
118 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
119 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
120 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
121 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
122 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
123 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
124 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
125 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
126 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
127 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
128 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
129 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
130 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
131 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
132 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
133 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
134 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
135 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
138 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
139 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
142 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
143 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
144 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
145 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
146 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
147 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
148 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
149 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
150 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
151 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
152 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
153 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
154 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
155 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
156 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
157 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
158 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
159 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
160 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
161 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
162 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.47
Metatranscriptomes 2.11
Isolates 0.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.77
Nodule 0.42
Rhizoplane 0.42
Rhizosphere 77.64
Stem 0
Stem Tuber 0
Unclassified 0.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466966_0248861 3300044684 Bacteria 1071
2 Ga0055526_1037898 3300003771 Bacteria 1251
3 Ga0070658_10055203 3300005327 Bacteria 3227
4 Ga0070683_100013631 3300005329 Bacteria 7096
5 Ga0070680_100081810 3300005336 Bacteria 2664
6 Ga0070661_100391966 3300005344 Bacteria 1097
7 Ga0070659_100089146 3300005366 Bacteria 2471
8 Ga0070714_100142931 3300005435 Bacteria 2150
9 Ga0070713_100048589 3300005436 Bacteria 3494
10 Ga0070681_10126843 3300005458 Bacteria 2484
11 Ga0070681_10287862 3300005458 Bacteria 1553
12 Ga0070679_100057991 3300005530 Bacteria 3859
13 Ga0070679_100149594 3300005530 Bacteria 2312
14 Ga0070684_100401609 3300005535 Bacteria 1263
15 Ga0068853_100008484 3300005539 Bacteria 8258
16 Ga0068853_100168292 3300005539 Bacteria 1982
17 Ga0068855_100015566 3300005563 Bacteria 9156
18 Ga0068855_100049674 3300005563 Bacteria 4946
19 Ga0068855_100132661 3300005563 Bacteria 2843
20 Ga0068855_100641429 3300005563 Bacteria 1141
21 Ga0068855_101171151 3300005563 Bacteria 800
22 Ga0068857_100036186 3300005577 Bacteria 4374
23 Ga0068854_100011405 3300005578 Bacteria 5784
24 Ga0068856_100000540 3300005614 Bacteria 41724
25 Ga0068856_100002838 3300005614 Bacteria 17741
26 Ga0068852_100042237 3300005616 Bacteria 3859
27 Ga0068852_100113685 3300005616 Bacteria 2465
28 Ga0068851_10000402 3300005834 Bacteria 19592
29 Ga0068851_10029079 3300005834 Bacteria 2734
30 Ga0068863_100218782 3300005841 Bacteria 1834
31 Ga0070717_10006150 3300006028 Bacteria 8813
32 Ga0075365_10027492 3300006038 Bacteria 3620
33 Ga0075368_10008795 3300006042 Bacteria 3614
34 Ga0075363_100004510 3300006048 Bacteria 6104
35 Ga0075363_100083823 3300006048 Bacteria 1747
36 Ga0075364_10163281 3300006051 Bacteria 1504
37 Ga0075362_10056224 3300006177 Bacteria 1771
38 Ga0075367_10023741 3300006178 Bacteria 3454
39 Ga0075367_10097411 3300006178 Bacteria 1794
40 Ga0075369_10054321 3300006186 Bacteria 1739
41 Ga0105240_10004430 3300009093 Bacteria 21410
42 Ga0105240_10093575 3300009093 Bacteria 3668
43 Ga0105241_10001668 3300009174 Bacteria 16913
44 Ga0105237_10036250 3300009545 Bacteria 4989
45 Ga0105237_10282572 3300009545 Bacteria 1662
46 Ga0105238_10009609 3300009551 Bacteria 9677
47 Ga0105238_10114004 3300009551 Bacteria 2682
48 Ga0105238_10310533 3300009551 Bacteria 1562
49 Ga0099796_10165328 3300010159 Bacteria 880
50 Ga0105239_10015010 3300010375 Bacteria 8587
51 Ga0105239_10055104 3300010375 Bacteria 4361
52 Ga0157370_10027842 3300013104 Bacteria 5569
53 Ga0157369_10070239 3300013105 Bacteria 3763
54 Ga0157372_10693441 3300013307 Bacteria 1185
55 Ga0163163_10597444 3300014325 Bacteria 1167
56 Ga0206356_10356705 3300020070 Bacteria 1142
57 Ga0206350_10333208 3300020080 Bacteria 1082
58 Ga0154015_1449203 3300020610 Bacteria 1149
59 Ga0154015_1517379 3300020610 Bacteria 704
60 Ga0213873_10108280 3300021358 Bacteria 805
61 Ga0213872_10028441 3300021361 Bacteria 2563
62 Ga0213872_10092382 3300021361 Bacteria 1354
63 Ga0213872_10284556 3300021361 Bacteria 689
64 Ga0213874_10028402 3300021377 Bacteria 1598
65 Ga0213874_10146787 3300021377 Bacteria 820
66 Ga0213876_10010713 3300021384 Bacteria 4912
67 Ga0209677_100522 3300025253 Bacteria 21397
68 Ga0209564_1016634 3300025295 Bacteria 2912
69 Ga0209758_1013561 3300025297 Bacteria 4429
70 Ga0207426_1000420 3300025302 Bacteria 69895
71 Ga0207656_10018269 3300025321 Bacteria 2758
72 Ga0207656_10053421 3300025321 Bacteria 1753
73 Ga0207705_10118897 3300025909 Bacteria 1959
74 Ga0207705_10171741 3300025909 Bacteria 1632
75 Ga0207654_10000058 3300025911 Bacteria 75628
76 Ga0207707_10001462 3300025912 Bacteria 21837
77 Ga0207707_10044673 3300025912 Bacteria 3862
78 Ga0207695_10000387 3300025913 Bacteria 99734
79 Ga0207695_10066173 3300025913 Bacteria 3713
80 Ga0207695_10069902 3300025913 Bacteria 3592
81 Ga0207671_10027271 3300025914 Bacteria 4270
82 Ga0207671_10174019 3300025914 Bacteria 1673
83 Ga0207671_10364144 3300025914 Bacteria 1148
84 Ga0207671_10439883 3300025914 Bacteria 1038
85 Ga0207693_10248359 3300025915 Bacteria 1396
86 Ga0207660_10009013 3300025917 Bacteria 6458
87 Ga0207657_10001095 3300025919 Bacteria 28754
88 Ga0207649_10090402 3300025920 Bacteria 2003
89 Ga0207649_10431018 3300025920 Bacteria 992
90 Ga0207652_10003169 3300025921 Bacteria 13699
91 Ga0207694_10000564 3300025924 Bacteria 33580
92 Ga0207694_10022787 3300025924 Bacteria 4750
93 Ga0207694_10262969 3300025924 Bacteria 1413
94 Ga0207700_10029062 3300025928 Bacteria 3897
95 Ga0207664_10310595 3300025929 Bacteria 1389
96 Ga0207664_10788571 3300025929 Bacteria 855
97 Ga0207690_10079582 3300025932 Bacteria 2284
98 Ga0207661_10034462 3300025944 Bacteria 3937
99 Ga0207679_10597729 3300025945 Bacteria 994
100 Ga0207667_10049708 3300025949 Bacteria 4427
101 Ga0207667_10082876 3300025949 Bacteria 3321
102 Ga0207667_10173412 3300025949 Bacteria 2216
103 Ga0207667_11997776 3300025949 Bacteria 540
104 Ga0207640_10058424 3300025981 Bacteria 2541
105 Ga0207658_10813229 3300025986 Bacteria 849
106 Ga0207639_10004666 3300026041 Bacteria 9228
107 Ga0207639_10039352 3300026041 Bacteria 3523
108 Ga0207678_10109271 3300026067 Bacteria 2359
109 Ga0207702_10000004 3300026078 Bacteria 422182
110 Ga0207702_10001310 3300026078 Bacteria 24935
111 Ga0207702_10050779 3300026078 Bacteria 3502
112 Ga0207641_11216086 3300026088 Bacteria 753
113 Ga0207674_10044476 3300026116 Bacteria 4573
114 Ga0207674_10069854 3300026116 Bacteria 3531
115 Ga0207698_10016601 3300026142 Bacteria 4969
116 Ga0209813_10004631 3300027866 Bacteria 3293
117 Ga0209813_10041661 3300027866 Bacteria 1400
118 Ga0265323_10005053 3300028653 Bacteria 5635
119 Ga0265336_10002549 3300028666 Bacteria 7455
120 Ga0265338_10001066 3300028800 Bacteria 45588
121 Ga0265338_10039087 3300028800 Bacteria 4483
122 Ga0265332_10286951 3300031238 Bacteria 680
123 Ga0265325_10046349 3300031241 Unclassified 2255
124 Ga0265340_10074442 3300031247 Bacteria 1606
125 Ga0265339_10000033 3300031249 Bacteria 130595
126 Ga0265339_10001277 3300031249 Bacteria 18834
127 Ga0265313_10000049 3300031595 Bacteria 111617
128 Ga0307508_10011347 3300031616 Bacteria 8147
129 Ga0307508_10102493 3300031616 Bacteria 2458
130 Ga0265314_10019045 3300031711 Bacteria 5326
131 Ga0265342_10018139 3300031712 Bacteria 4565
132 Ga0307516_10009995 3300031730 Bacteria 10505
133 Ga0307516_10242971 3300031730 Bacteria 1498
134 Ga0307412_10525200 3300031911 Bacteria 990
135 Ga0307415_100172473 3300032126 Bacteria 1688
136 Ga0373936_0057172 3300035113 Bacteria 1586
137 Ga0373936_0096973 3300035113 Bacteria 1241
138 Ga0373943_0037051 3300035170 Bacteria 2340
139 Ga0373946_0038594 3300035171 Bacteria 1946
140 Ga0373955_0057791 3300035172 Bacteria 2132
141 Ga0373935_0106891 3300035692 Bacteria 1852
142 Ga0373927_0167697 3300035695 Bacteria 1439
143 Ga0373927_0220046 3300035695 Bacteria 1247
144 Ga0373933_0009644 3300035724 Bacteria 5276
145 Ga0310104_10661 3300036242 Bacteria 744
146 Ga0373937_0007832 3300036401 Bacteria 9258
147 Ga0373925_0022373 3300037068 Bacteria 4610
148 Ga0373925_0421262 3300037068 Bacteria 1091
149 Ga0395900_0229251 3300037418 Bacteria 1869
150 Ga0395900_0615646 3300037418 Bacteria 1025
151 Ga0395898_0127982 3300037466 Bacteria 2433
152 Ga0395905_0312802 3300037471 Bacteria 1459
153 Ga0395901_0866759 3300038443 Bacteria 887
154 Ga0436365_0096191 3300039437 Bacteria 5650
155 Ga0436365_0931205 3300039437 Bacteria 2340
156 Ga0436360_0936605 3300039438 Bacteria 884
157 Ga0436360_1228874 3300039438 Bacteria 1255
158 Ga0436361_0885340 3300039447 Bacteria 1839
159 Ga0436361_1212460 3300039447 Bacteria 2861
160 Ga0436363_0116325 3300039450 Bacteria 4569
161 Ga0436363_1501826 3300039450 Bacteria 1431
162 Ga0436362_0007417 3300039453 Bacteria 1441
163 Ga0436362_1081417 3300039453 Bacteria 917
164 Ga0466961_0336969 3300044693 Bacteria 919
165 Ga0466963_0064367 3300044694 Bacteria 2456
166 Ga0466957_0038840 3300044842 Bacteria 2870
167 Ga0466957_0040147 3300044842 Bacteria 2826
168 Ga0466960_0424747 3300044901 Bacteria 769
169 Ga0466959_0125329 3300045049 Bacteria 1823
170 Ga0466959_0278206 3300045049 Bacteria 1149
171 Ga0466958_0057710 3300045836 Bacteria 2359
172 Ga0466967_0014467 3300045976 Bacteria 6148
173 Ga0466967_1317941 3300045976 Bacteria 719
174 Ga0495592_0060225 3300046454 Bacteria 2793
175 Ga0495651_0007065 3300046462 Bacteria 8584
176 Ga0495651_0011151 3300046462 Bacteria 6911
177 Ga0495650_0144993 3300046471 Bacteria 856
178 Ga0495608_0001760 3300046511 Bacteria 15463
179 Ga0495618_0153732 3300046514 Bacteria 1469
180 Ga0495628_0062099 3300046516 Bacteria 2929
181 Ga0495628_0131730 3300046516 Bacteria 1912
182 Ga0495652_0005084 3300046529 Bacteria 12447
183 Ga0495652_0157785 3300046529 Bacteria 1765
184 Ga0495640_0017888 3300046533 Bacteria 5269
185 Ga0495587_0022897 3300046536 Bacteria 3843
186 Ga0495645_0125973 3300046543 Bacteria 1800
187 Ga0495667_0003960 3300046559 Bacteria 9942
188 Ga0495667_0186306 3300046559 Bacteria 1331
189 Ga0495634_0387106 3300046642 Bacteria 833
190 Ga0495635_0086734 3300046663 Bacteria 2142
191 Ga0495657_0111631 3300046675 Bacteria 1731
192 Ga0495599_0016076 3300046678 Bacteria 4644
193 Ga0495623_0431551 3300046679 Unclassified 704
194 Ga0495624_0174912 3300046690 Bacteria 1309
195 Ga0495600_0055518 3300046809 Bacteria 2587
196 Ga0495604_0001820 3300047317 Bacteria 17360
197 Ga0495604_0229941 3300047317 Bacteria 1272
198 Ga0495674_0004030 3300047319 Bacteria 14220
199 Ga0495674_0053687 3300047319 Bacteria 3541
200 Ga0495674_0249475 3300047319 Bacteria 1461
201 Ga0495680_0007419 3300047322 Bacteria 10058
202 Ga0495675_0277414 3300047444 Bacteria 1000
203 Ga0495602_0018353 3300048088 Bacteria 6992
204 Ga0495602_0455478 3300048088 Bacteria 902
205 Ga0496108_0473970 3300048911 Bacteria 1094
206 Ga0496118_0007986 3300048921 Bacteria 11060
207 Ga0496118_0043804 3300048921 Bacteria 3513
208 Ga0496125_0478518 3300048928 Bacteria 706
209 Ga0496126_0112071 3300048929 Bacteria 2376
210 Ga0495682_0097586 3300049460 Bacteria 1055
211 Ga0501034_0415964 3300049571 Bacteria 1266
212 Ga0501034_0716446 3300049571 Bacteria 898
213 nmdc:mga03683_37047_c1 3300050489 Bacteria 1986
214 nmdc:mga03n38_27379_c1 3300050490 Bacteria 2364
215 nmdc:mga03n38_66160_c1 3300050490 Bacteria 1659
216 nmdc:mga00v17_204834_c1 3300050491 Bacteria 1276
217 nmdc:mga00v17_372052_c1 3300050491 Bacteria 929
218 nmdc:mga0yw44_11702_c1 3300050492 Bacteria 4544
219 nmdc:mga0yw44_263554_c1 3300050492 Bacteria 1149
220 nmdc:mga0yw44_398218_c1 3300050492 Bacteria 931
221 nmdc:mga06z11_164818_c1 3300050494 Bacteria 1269
222 nmdc:mga06z11_190044_c1 3300050494 Bacteria 1188
223 nmdc:mga06z11_204936_c1 3300050494 Bacteria 1147
224 nmdc:mga04h51_1624_c1 3300050495 Bacteria 5244
225 nmdc:mga04h51_49922_c1 3300050495 Bacteria 1400
226 nmdc:mga08x19_537471_c1 3300050514 Bacteria 827
227 nmdc:mga0sz30_52628_c1 3300050516 Bacteria 1729
228 Ga0495601_0005970 3300053077 Bacteria 7105
229 Ga0500635_0013728 3300053080 Bacteria 2359
230 Ga0495595_0000270 3300053084 Bacteria 20465
231 Ga0495619_0002116 3300053085 Bacteria 13149
232 Ga0495619_0006210 3300053085 Bacteria 7574
233 Ga0500566_0018748 3300053094 Bacteria 4063
234 Ga0500568_0088725 3300053139 Bacteria 1168
235 Ga0500636_0019365 3300053177 Bacteria 4028
236 Ga0500596_008577 3300053735 Bacteria 1626
237 2509151888 2508501128 Bacteria 8613869
238 Ga0466966_0248861
239 Ga0055526_1037898
240 Ga0070658_10055203
241 Ga0070683_100013631
242 Ga0070680_100081810
243 Ga0070661_100391966
244 Ga0070659_100089146
245 Ga0070714_100142931
246 Ga0070713_100048589
247 Ga0070681_10126843
248 Ga0070681_10287862
249 Ga0070679_100057991
250 Ga0070679_100149594
251 Ga0070684_100401609
252 Ga0068853_100008484
253 Ga0068853_100168292
254 Ga0068855_100015566
255 Ga0068855_100049674
256 Ga0068855_100132661
257 Ga0068855_100641429
258 Ga0068855_101171151
259 Ga0068857_100036186
260 Ga0068854_100011405
261 Ga0068856_100000540
262 Ga0068856_100002838
263 Ga0068852_100042237
264 Ga0068852_100113685
265 Ga0068851_10000402
266 Ga0068851_10029079
267 Ga0068863_100218782
268 Ga0070717_10006150
269 Ga0075365_10027492
270 Ga0075368_10008795
271 Ga0075363_100004510
272 Ga0075363_100083823
273 Ga0075364_10163281
274 Ga0075362_10056224
275 Ga0075367_10023741
276 Ga0075367_10097411
277 Ga0075369_10054321
278 Ga0105240_10004430
279 Ga0105240_10093575
280 Ga0105241_10001668
281 Ga0105237_10036250
282 Ga0105237_10282572
283 Ga0105238_10009609
284 Ga0105238_10114004
285 Ga0105238_10310533
286 Ga0099796_10165328
287 Ga0105239_10015010
288 Ga0105239_10055104
289 Ga0157370_10027842
290 Ga0157369_10070239
291 Ga0157372_10693441
292 Ga0163163_10597444
293 Ga0206356_10356705
294 Ga0206350_10333208
295 Ga0154015_1449203
296 Ga0154015_1517379
297 Ga0213873_10108280
298 Ga0213872_10028441
299 Ga0213872_10092382
300 Ga0213872_10284556
301 Ga0213874_10028402
302 Ga0213874_10146787
303 Ga0213876_10010713
304 Ga0209677_100522
305 Ga0209564_1016634
306 Ga0209758_1013561
307 Ga0207426_1000420
308 Ga0207656_10018269
309 Ga0207656_10053421
310 Ga0207705_10118897
311 Ga0207705_10171741
312 Ga0207654_10000058
313 Ga0207707_10001462
314 Ga0207707_10044673
315 Ga0207695_10000387
316 Ga0207695_10066173
317 Ga0207695_10069902
318 Ga0207671_10027271
319 Ga0207671_10174019
320 Ga0207671_10364144
321 Ga0207671_10439883
322 Ga0207693_10248359
323 Ga0207660_10009013
324 Ga0207657_10001095
325 Ga0207649_10090402
326 Ga0207649_10431018
327 Ga0207652_10003169
328 Ga0207694_10000564
329 Ga0207694_10022787
330 Ga0207694_10262969
331 Ga0207700_10029062
332 Ga0207664_10310595
333 Ga0207664_10788571
334 Ga0207690_10079582
335 Ga0207661_10034462
336 Ga0207679_10597729
337 Ga0207667_10049708
338 Ga0207667_10082876
339 Ga0207667_10173412
340 Ga0207667_11997776
341 Ga0207640_10058424
342 Ga0207658_10813229
343 Ga0207639_10004666
344 Ga0207639_10039352
345 Ga0207678_10109271
346 Ga0207702_10000004
347 Ga0207702_10001310
348 Ga0207702_10050779
349 Ga0207641_11216086
350 Ga0207674_10044476
351 Ga0207674_10069854
352 Ga0207698_10016601
353 Ga0209813_10004631
354 Ga0209813_10041661
355 Ga0265323_10005053
356 Ga0265336_10002549
357 Ga0265338_10001066
358 Ga0265338_10039087
359 Ga0265332_10286951
360 Ga0265325_10046349
361 Ga0265340_10074442
362 Ga0265339_10000033
363 Ga0265339_10001277
364 Ga0265313_10000049
365 Ga0307508_10011347
366 Ga0307508_10102493
367 Ga0265314_10019045
368 Ga0265342_10018139
369 Ga0307516_10009995
370 Ga0307516_10242971
371 Ga0307412_10525200
372 Ga0307415_100172473
373 Ga0373936_0057172
374 Ga0373936_0096973
375 Ga0373943_0037051
376 Ga0373946_0038594
377 Ga0373955_0057791
378 Ga0373935_0106891
379 Ga0373927_0167697
380 Ga0373927_0220046
381 Ga0373933_0009644
382 Ga0310104_10661
383 Ga0373937_0007832
384 Ga0373925_0022373
385 Ga0373925_0421262
386 Ga0395900_0229251
387 Ga0395900_0615646
388 Ga0395898_0127982
389 Ga0395905_0312802
390 Ga0395901_0866759
391 Ga0436365_0096191
392 Ga0436365_0931205
393 Ga0436360_0936605
394 Ga0436360_1228874
395 Ga0436361_0885340
396 Ga0436361_1212460
397 Ga0436363_0116325
398 Ga0436363_1501826
399 Ga0436362_0007417
400 Ga0436362_1081417
401 Ga0466961_0336969
402 Ga0466963_0064367
403 Ga0466957_0038840
404 Ga0466957_0040147
405 Ga0466960_0424747
406 Ga0466959_0125329
407 Ga0466959_0278206
408 Ga0466958_0057710
409 Ga0466967_0014467
410 Ga0466967_1317941
411 Ga0495592_0060225
412 Ga0495651_0007065
413 Ga0495651_0011151
414 Ga0495650_0144993
415 Ga0495608_0001760
416 Ga0495618_0153732
417 Ga0495628_0062099
418 Ga0495628_0131730
419 Ga0495652_0005084
420 Ga0495652_0157785
421 Ga0495640_0017888
422 Ga0495587_0022897
423 Ga0495645_0125973
424 Ga0495667_0003960
425 Ga0495667_0186306
426 Ga0495634_0387106
427 Ga0495635_0086734
428 Ga0495657_0111631
429 Ga0495599_0016076
430 Ga0495623_0431551
431 Ga0495624_0174912
432 Ga0495600_0055518
433 Ga0495604_0001820
434 Ga0495604_0229941
435 Ga0495674_0004030
436 Ga0495674_0053687
437 Ga0495674_0249475
438 Ga0495680_0007419
439 Ga0495675_0277414
440 Ga0495602_0018353
441 Ga0495602_0455478
442 Ga0496108_0473970
443 Ga0496118_0007986
444 Ga0496118_0043804
445 Ga0496125_0478518
446 Ga0496126_0112071
447 Ga0495682_0097586
448 Ga0501034_0415964
449 Ga0501034_0716446
450 nmdc:mga03683_37047_c1
451 nmdc:mga03n38_27379_c1
452 nmdc:mga03n38_66160_c1
453 nmdc:mga00v17_204834_c1
454 nmdc:mga00v17_372052_c1
455 nmdc:mga0yw44_11702_c1
456 nmdc:mga0yw44_263554_c1
457 nmdc:mga0yw44_398218_c1
458 nmdc:mga06z11_164818_c1
459 nmdc:mga06z11_190044_c1
460 nmdc:mga06z11_204936_c1
461 nmdc:mga04h51_1624_c1
462 nmdc:mga04h51_49922_c1
463 nmdc:mga08x19_537471_c1
464 nmdc:mga0sz30_52628_c1
465 Ga0495601_0005970
466 Ga0500635_0013728
467 Ga0495595_0000270
468 Ga0495619_0002116
469 Ga0495619_0006210
470 Ga0500566_0018748
471 Ga0500568_0088725
472 Ga0500636_0019365
473 Ga0500596_008577
474 2509151888

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03734

YkuD

L,D-transpeptidase catalytic domain

63

193

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4a1i-assembly1.cif.gz_A ykud from b.subtilis 0.927 41 171
4lzh-assembly1.cif.gz_A l,d-transpeptidase from klebsiella pneumoniae 0.8708 42 169
2mtz-assembly1.cif.gz_A haddock model of bacillus subtilis l,d-transpeptidase in complex with a peptidoglycan hexamuropeptide 0.8707 41 168
2hkl-assembly3.cif.gz_C crystal structure of enterococcus faecium l,d-transpeptidase c442s mutant 0.8265 38 170
5uwv-assembly4.cif.gz_E crystal structure of mycobacterium abscessus l,d-transpeptidase 2 0.8224 41 171
ID Description Score Start End Superfamily
4a1iC02 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.9236 41 171 2.40.440.10
af_P75954_98_241_2.40.440.10 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.8901 37 170 2.40.440.10
4a1iC02 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.8484 41 171 2.40.440.10
af_P75954_98_241_2.40.440.10 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.8255 37 170 2.40.440.10
5uwvD03 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.8059 41 171 2.40.440.10
ID Description Score Start End GO Terms
AF-A0A7G6U4F9-F1-model_v4 L,D-transpeptidase 0.9745 30 170 GO:0005576
GO:0008360
GO:0016757
GO:0018104
GO:0071555
GO:0071972
AF-A0A508T3Z4-F1-model_v4 Putative L,D-transpeptidase ErfK/SrfK (EC 2.-.-.-) 0.9676 37 171 GO:0005576
GO:0008360
GO:0016757
GO:0018104
GO:0071555
GO:0071972
AF-A0A537Q9P5-F1-model_v4 L,D-transpeptidase 0.9667 26 171 GO:0005576
GO:0008360
GO:0016757
GO:0018104
GO:0071555
GO:0071972
AF-A0A2R4MH01-F1-model_v4 Putative L,D-transpeptidase YkuD 0.9666 29 170 GO:0005576
GO:0008360
GO:0016757
GO:0018104
GO:0071555
GO:0071972
AF-A0A0S3PNN0-F1-model_v4 Putative L,D-transpeptidase YbiS (EC 2.-.-.-) 0.9663 26 171 GO:0005576
GO:0008360
GO:0016757
GO:0018104
GO:0071555
GO:0071972

Map