F350186
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 237 | 48 | 474 | 73 |
Family's Representative Sequence
| Representative Sequence | 3300036647|Ga0316582_0702530|Ga0316582_0702530_300_557 |
| Length | 85 |
| Sequence | LISFDPGKGDMIMREKVEEAIEKIRPMLQADGGDVELVDVKEGVVTVRLQGACAGCPMSQMTLKNGIEKILKKEIPEVVSVESAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 2 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 4 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 5 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 6 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 7 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 8 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 9 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 10 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 11 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 12 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 13 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 14 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 15 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 16 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 17 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 18 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 19 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 20 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 21 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 22 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 23 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 24 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 25 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 26 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 27 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 28 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 29 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 30 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 31 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 32 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 33 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 34 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 35 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 36 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 37 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 38 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 39 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 40 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 41 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 42 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 43 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 44 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 45 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 46 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 47 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 48 | 2523533628 | Maridesulfovibrio zosterae DSM 11974 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.14 |
| Metatranscriptomes | 8.44 |
| Isolates | 0.42 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 87.76 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.39 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0316582_0702530 | 3300036647 | Bacteria | 694 |
| 2 | Ga0065704_10212855 | 3300005289 | Bacteria | 1102 |
| 3 | Ga0265330_10266458 | 3300031235 | Bacteria | 722 |
| 4 | Ga0265327_10412530 | 3300031251 | Bacteria | 586 |
| 5 | Ga0265316_10101205 | 3300031344 | Bacteria | 2190 |
| 6 | Ga0265316_10288447 | 3300031344 | Unclassified | 1198 |
| 7 | Ga0316575_10000227 | 3300031665 | Bacteria | 15051 |
| 8 | Ga0316575_10016845 | 3300031665 | Bacteria | 2769 |
| 9 | Ga0316575_10061450 | 3300031665 | Bacteria | 1501 |
| 10 | Ga0316575_10168768 | 3300031665 | Bacteria | 906 |
| 11 | Ga0316575_10467031 | 3300031665 | Bacteria | 545 |
| 12 | Ga0316575_10491768 | 3300031665 | Unclassified | 532 |
| 13 | Ga0316579_10000809 | 3300031691 | Bacteria | 10800 |
| 14 | Ga0316579_10003453 | 3300031691 | Bacteria | 6159 |
| 15 | Ga0316579_10009559 | 3300031691 | Bacteria | 4081 |
| 16 | Ga0316579_10014300 | 3300031691 | Bacteria | 3428 |
| 17 | Ga0316579_10038909 | 3300031691 | Bacteria | 2201 |
| 18 | Ga0316579_10053326 | 3300031691 | Bacteria | 1894 |
| 19 | Ga0316579_10120863 | 3300031691 | Bacteria | 1258 |
| 20 | Ga0316579_10149443 | 3300031691 | Unclassified | 1127 |
| 21 | Ga0316579_10153989 | 3300031691 | Unclassified | 1110 |
| 22 | Ga0316579_10423333 | 3300031691 | Bacteria | 644 |
| 23 | Ga0316579_10447359 | 3300031691 | Bacteria | 625 |
| 24 | Ga0316579_10449939 | 3300031691 | Bacteria | 623 |
| 25 | Ga0316579_10609939 | 3300031691 | Bacteria | 528 |
| 26 | Ga0265314_10426562 | 3300031711 | Bacteria | 711 |
| 27 | Ga0316576_10002135 | 3300031727 | Bacteria | 11137 |
| 28 | Ga0316576_10003303 | 3300031727 | Bacteria | 9415 |
| 29 | Ga0316576_10008807 | 3300031727 | Bacteria | 6469 |
| 30 | Ga0316576_10031736 | 3300031727 | Bacteria | 3750 |
| 31 | Ga0316576_10036502 | 3300031727 | Bacteria | 3514 |
| 32 | Ga0316576_10086355 | 3300031727 | Bacteria | 2333 |
| 33 | Ga0316576_10092122 | 3300031727 | Bacteria | 2258 |
| 34 | Ga0316576_10092780 | 3300031727 | Bacteria | 2250 |
| 35 | Ga0316576_10094031 | 3300031727 | Bacteria | 2235 |
| 36 | Ga0316576_10113984 | 3300031727 | Bacteria | 2028 |
| 37 | Ga0316576_10154140 | 3300031727 | Bacteria | 1732 |
| 38 | Ga0316576_10261506 | 3300031727 | Bacteria | 1298 |
| 39 | Ga0316576_10400230 | 3300031727 | Bacteria | 1017 |
| 40 | Ga0316576_10450287 | 3300031727 | Bacteria | 951 |
| 41 | Ga0316576_10516521 | 3300031727 | Bacteria | 878 |
| 42 | Ga0316576_10537870 | 3300031727 | Unclassified | 857 |
| 43 | Ga0316576_10567018 | 3300031727 | Bacteria | 831 |
| 44 | Ga0316576_10569754 | 3300031727 | Bacteria | 828 |
| 45 | Ga0316576_10652528 | 3300031727 | Unclassified | 765 |
| 46 | Ga0316576_11220426 | 3300031727 | Bacteria | 531 |
| 47 | Ga0316578_10001732 | 3300031728 | Bacteria | 9119 |
| 48 | Ga0316578_10004649 | 3300031728 | Bacteria | 6511 |
| 49 | Ga0316578_10071383 | 3300031728 | Bacteria | 2056 |
| 50 | Ga0316578_10071770 | 3300031728 | Bacteria | 2050 |
| 51 | Ga0316578_10123170 | 3300031728 | Bacteria | 1559 |
| 52 | Ga0316578_10126715 | 3300031728 | Bacteria | 1535 |
| 53 | Ga0316578_10148349 | 3300031728 | Bacteria | 1413 |
| 54 | Ga0316578_10148807 | 3300031728 | Bacteria | 1410 |
| 55 | Ga0316578_10369437 | 3300031728 | Bacteria | 852 |
| 56 | Ga0316578_10551591 | 3300031728 | Unclassified | 677 |
| 57 | Ga0316578_10593660 | 3300031728 | Unclassified | 649 |
| 58 | Ga0316577_10007407 | 3300031733 | Bacteria | 5855 |
| 59 | Ga0316577_10013060 | 3300031733 | Bacteria | 4531 |
| 60 | Ga0316577_10037184 | 3300031733 | Bacteria | 2723 |
| 61 | Ga0316577_10045522 | 3300031733 | Bacteria | 2452 |
| 62 | Ga0316577_10058307 | 3300031733 | Bacteria | 2155 |
| 63 | Ga0316577_10061670 | 3300031733 | Bacteria | 2093 |
| 64 | Ga0316577_10068168 | 3300031733 | Bacteria | 1986 |
| 65 | Ga0316577_10088845 | 3300031733 | Bacteria | 1730 |
| 66 | Ga0316577_10121309 | 3300031733 | Bacteria | 1469 |
| 67 | Ga0316577_10201718 | 3300031733 | Unclassified | 1124 |
| 68 | Ga0316577_10215970 | 3300031733 | Bacteria | 1084 |
| 69 | Ga0316577_10277790 | 3300031733 | Bacteria | 948 |
| 70 | Ga0316577_10334881 | 3300031733 | Bacteria | 858 |
| 71 | Ga0316577_10341070 | 3300031733 | Bacteria | 850 |
| 72 | Ga0316577_10448690 | 3300031733 | Bacteria | 733 |
| 73 | Ga0316577_10643453 | 3300031733 | Bacteria | 603 |
| 74 | Ga0316577_10874026 | 3300031733 | Unclassified | 510 |
| 75 | Ga0316583_10000283 | 3300032133 | Bacteria | 14154 |
| 76 | Ga0316583_10006779 | 3300032133 | Bacteria | 4126 |
| 77 | Ga0316583_10031018 | 3300032133 | Bacteria | 1903 |
| 78 | Ga0316583_10037277 | 3300032133 | Bacteria | 1723 |
| 79 | Ga0316583_10040361 | 3300032133 | Bacteria | 1652 |
| 80 | Ga0316583_10203936 | 3300032133 | Bacteria | 686 |
| 81 | Ga0316583_10357067 | 3300032133 | Bacteria | 505 |
| 82 | Ga0316585_10011867 | 3300032137 | Bacteria | 2573 |
| 83 | Ga0316585_10020260 | 3300032137 | Bacteria | 2034 |
| 84 | Ga0316585_10025805 | 3300032137 | Bacteria | 1824 |
| 85 | Ga0316585_10325711 | 3300032137 | Bacteria | 511 |
| 86 | Ga0316580_10000105 | 3300032139 | Bacteria | 15372 |
| 87 | Ga0316580_10005206 | 3300032139 | Bacteria | 3786 |
| 88 | Ga0316580_10008103 | 3300032139 | Bacteria | 3144 |
| 89 | Ga0316580_10026764 | 3300032139 | Bacteria | 1783 |
| 90 | Ga0316580_10026788 | 3300032139 | Unclassified | 1783 |
| 91 | Ga0316580_10065657 | 3300032139 | Bacteria | 1113 |
| 92 | Ga0316593_10042129 | 3300032168 | Bacteria | 1522 |
| 93 | Ga0316593_10049581 | 3300032168 | Bacteria | 1415 |
| 94 | Ga0316593_10062813 | 3300032168 | Bacteria | 1272 |
| 95 | Ga0316593_10095259 | 3300032168 | Unclassified | 1051 |
| 96 | Ga0316593_10165517 | 3300032168 | Bacteria | 809 |
| 97 | Ga0316593_10165698 | 3300032168 | Bacteria | 809 |
| 98 | Ga0316593_10396132 | 3300032168 | Bacteria | 533 |
| 99 | Ga0316593_10443433 | 3300032168 | Bacteria | 506 |
| 100 | Ga0316592_1014858 | 3300033524 | Bacteria | 1618 |
| 101 | Ga0316592_1029928 | 3300033524 | Bacteria | 1182 |
| 102 | Ga0316586_1008766 | 3300033527 | Bacteria | 1504 |
| 103 | Ga0316588_1116529 | 3300033528 | Bacteria | 674 |
| 104 | Ga0316588_1218520 | 3300033528 | Unclassified | 501 |
| 105 | Ga0316587_1016396 | 3300033529 | Bacteria | 1236 |
| 106 | Ga0316596_1014041 | 3300033541 | Bacteria | 1982 |
| 107 | Ga0316596_1126800 | 3300033541 | Bacteria | 696 |
| 108 | Ga0316596_1138498 | 3300033541 | Bacteria | 666 |
| 109 | Ga0316596_1163316 | 3300033541 | Bacteria | 614 |
| 110 | Ga0316596_1179968 | 3300033541 | Bacteria | 585 |
| 111 | Ga0316596_1224084 | 3300033541 | Unclassified | 527 |
| 112 | Ga0316574_0004375 | 3300035398 | Bacteria | 7388 |
| 113 | Ga0316574_0005178 | 3300035398 | Bacteria | 6938 |
| 114 | Ga0316574_0008386 | 3300035398 | Bacteria | 5738 |
| 115 | Ga0316574_0020090 | 3300035398 | Bacteria | 3949 |
| 116 | Ga0316574_0064111 | 3300035398 | Bacteria | 2311 |
| 117 | Ga0316574_0131645 | 3300035398 | Bacteria | 1609 |
| 118 | Ga0316574_0185922 | 3300035398 | Bacteria | 1336 |
| 119 | Ga0316574_0243824 | 3300035398 | Bacteria | 1148 |
| 120 | Ga0316574_0321523 | 3300035398 | Bacteria | 982 |
| 121 | Ga0316574_0503753 | 3300035398 | Bacteria | 755 |
| 122 | Ga0316574_0728684 | 3300035398 | Bacteria | 607 |
| 123 | Ga0316582_0000418 | 3300036647 | Bacteria | 15553 |
| 124 | Ga0316582_0008005 | 3300036647 | Bacteria | 5656 |
| 125 | Ga0316582_0012255 | 3300036647 | Bacteria | 4776 |
| 126 | Ga0316582_0024081 | 3300036647 | Bacteria | 3638 |
| 127 | Ga0316582_0035229 | 3300036647 | Bacteria | 3088 |
| 128 | Ga0316582_0080353 | 3300036647 | Unclassified | 2128 |
| 129 | Ga0316582_0081011 | 3300036647 | Bacteria | 2120 |
| 130 | Ga0316582_0103010 | 3300036647 | Unclassified | 1893 |
| 131 | Ga0316582_0110988 | 3300036647 | Unclassified | 1825 |
| 132 | Ga0316582_0135054 | 3300036647 | Bacteria | 1659 |
| 133 | Ga0316582_0143798 | 3300036647 | Bacteria | 1609 |
| 134 | Ga0316582_0255362 | 3300036647 | Bacteria | 1201 |
| 135 | Ga0316582_0259115 | 3300036647 | Bacteria | 1192 |
| 136 | Ga0316582_0338288 | 3300036647 | Bacteria | 1035 |
| 137 | Ga0316582_0411285 | 3300036647 | Bacteria | 932 |
| 138 | Ga0316582_0450974 | 3300036647 | Bacteria | 887 |
| 139 | Ga0316582_0471552 | 3300036647 | Bacteria | 865 |
| 140 | Ga0316582_0549944 | 3300036647 | Bacteria | 795 |
| 141 | Ga0316582_0678395 | 3300036647 | Unclassified | 708 |
| 142 | Ga0316582_0710785 | 3300036647 | Bacteria | 690 |
| 143 | Ga0316582_0763367 | 3300036647 | Unclassified | 663 |
| 144 | Ga0316582_0808487 | 3300036647 | Unclassified | 642 |
| 145 | Ga0316582_0961838 | 3300036647 | Unclassified | 583 |
| 146 | Ga0316582_0987807 | 3300036647 | Unclassified | 575 |
| 147 | Ga0316582_1159716 | 3300036647 | Bacteria | 526 |
| 148 | Ga0316582_1237324 | 3300036647 | Bacteria | 508 |
| 149 | Ga0316584_0003747 | 3300036712 | Bacteria | 9958 |
| 150 | Ga0316584_0006484 | 3300036712 | Bacteria | 7925 |
| 151 | Ga0316584_0009589 | 3300036712 | Bacteria | 6727 |
| 152 | Ga0316584_0013108 | 3300036712 | Bacteria | 5861 |
| 153 | Ga0316584_0025170 | 3300036712 | Bacteria | 4362 |
| 154 | Ga0316584_0034539 | 3300036712 | Bacteria | 3748 |
| 155 | Ga0316584_0036501 | 3300036712 | Bacteria | 3648 |
| 156 | Ga0316584_0043412 | 3300036712 | Bacteria | 3352 |
| 157 | Ga0316584_0056698 | 3300036712 | Bacteria | 2932 |
| 158 | Ga0316584_0063333 | 3300036712 | Bacteria | 2768 |
| 159 | Ga0316584_0101776 | 3300036712 | Bacteria | 2151 |
| 160 | Ga0316584_0105869 | 3300036712 | Bacteria | 2105 |
| 161 | Ga0316584_0118589 | 3300036712 | Bacteria | 1978 |
| 162 | Ga0316584_0366753 | 3300036712 | Bacteria | 1031 |
| 163 | Ga0316584_0409166 | 3300036712 | Bacteria | 965 |
| 164 | Ga0316584_0425298 | 3300036712 | Bacteria | 943 |
| 165 | Ga0316584_0477687 | 3300036712 | Bacteria | 878 |
| 166 | Ga0316584_0557387 | 3300036712 | Bacteria | 799 |
| 167 | Ga0316584_0738692 | 3300036712 | Bacteria | 672 |
| 168 | Ga0316584_1150512 | 3300036712 | Bacteria | 513 |
| 169 | Ga0316581_0012672 | 3300037588 | Bacteria | 2377 |
| 170 | Ga0316581_0018860 | 3300037588 | Bacteria | 2008 |
| 171 | Ga0316581_0042761 | 3300037588 | Bacteria | 1382 |
| 172 | Ga0316581_0057290 | 3300037588 | Bacteria | 1195 |
| 173 | Ga0316581_0068211 | 3300037588 | Unclassified | 1092 |
| 174 | Ga0400484_05887 | 3300038725 | Bacteria | 7645 |
| 175 | Ga0400490_10531 | 3300038726 | Bacteria | 32214 |
| 176 | Ga0400490_17984 | 3300038726 | Bacteria | 4313 |
| 177 | Ga0400490_32086 | 3300038726 | Bacteria | 1001 |
| 178 | Ga0400490_51844 | 3300038726 | Bacteria | 14520 |
| 179 | Ga0400491_09716 | 3300038727 | Bacteria | 1019 |
| 180 | Ga0400491_13126 | 3300038727 | Bacteria | 1078 |
| 181 | Ga0400491_16662 | 3300038727 | Bacteria | 1254 |
| 182 | Ga0400485_14641 | 3300038735 | Bacteria | 14006 |
| 183 | Ga0400485_16561 | 3300038735 | Bacteria | 1927 |
| 184 | Ga0400485_21688 | 3300038735 | Bacteria | 6854 |
| 185 | Ga0400488_15992 | 3300038741 | Bacteria | 1880 |
| 186 | Ga0400488_30738 | 3300038741 | Bacteria | 11478 |
| 187 | Ga0400488_50819 | 3300038741 | Bacteria | 11063 |
| 188 | Ga0400486_17636 | 3300038742 | Bacteria | 14413 |
| 189 | Ga0400486_20934 | 3300038742 | Bacteria | 2297 |
| 190 | Ga0400486_21293 | 3300038742 | Bacteria | 16460 |
| 191 | Ga0400483_035049 | 3300039062 | Bacteria | 2939 |
| 192 | Ga0400483_071935 | 3300039062 | Bacteria | 165886 |
| 193 | Ga0400483_143920 | 3300039062 | Unclassified | 1423 |
| 194 | Ga0400483_281303 | 3300039062 | Bacteria | 3300 |
| 195 | Ga0400489_06520 | 3300039093 | Bacteria | 64056 |
| 196 | Ga0400489_36940 | 3300039093 | Bacteria | 24345 |
| 197 | Ga0400489_39658 | 3300039093 | Bacteria | 1034 |
| 198 | Ga0400489_58669 | 3300039093 | Bacteria | 13957 |
| 199 | Ga0400489_84424 | 3300039093 | Bacteria | 14051 |
| 200 | Ga0400487_32881 | 3300039110 | Bacteria | 13687 |
| 201 | Ga0400487_39758 | 3300039110 | Bacteria | 1115 |
| 202 | Ga0400487_58619 | 3300039110 | Bacteria | 1131 |
| 203 | Ga0451577_0000141 | 3300042876 | Bacteria | 161372 |
| 204 | Ga0451577_0001745 | 3300042876 | Bacteria | 28026 |
| 205 | Ga0451577_0157573 | 3300042876 | Unclassified | 2044 |
| 206 | Ga0451577_1022606 | 3300042876 | Bacteria | 741 |
| 207 | Ga0453683_0004620 | 3300044673 | Bacteria | 9725 |
| 208 | Ga0453683_0156412 | 3300044673 | Bacteria | 1441 |
| 209 | Ga0453684_0000463 | 3300044712 | Bacteria | 161665 |
| 210 | Ga0453684_0000614 | 3300044712 | Bacteria | 130471 |
| 211 | Ga0453684_0003717 | 3300044712 | Bacteria | 33777 |
| 212 | Ga0453684_0068932 | 3300044712 | Bacteria | 4489 |
| 213 | Ga0453684_0072461 | 3300044712 | Bacteria | 4349 |
| 214 | Ga0453684_0075818 | 3300044712 | Bacteria | 4224 |
| 215 | Ga0453684_0112359 | 3300044712 | Bacteria | 3307 |
| 216 | Ga0453684_0249042 | 3300044712 | Bacteria | 2041 |
| 217 | Ga0453684_0536817 | 3300044712 | Bacteria | 1290 |
| 218 | Ga0453684_0643584 | 3300044712 | Bacteria | 1157 |
| 219 | Ga0453684_2151659 | 3300044712 | Unclassified | 558 |
| 220 | Ga0451576_0010120 | 3300045051 | Bacteria | 10860 |
| 221 | Ga0451576_0116187 | 3300045051 | Bacteria | 2786 |
| 222 | Ga0451576_0293877 | 3300045051 | Bacteria | 1699 |
| 223 | Ga0451576_0772883 | 3300045051 | Bacteria | 1009 |
| 224 | Ga0451576_1403783 | 3300045051 | Bacteria | 727 |
| 225 | Ga0501036_1580147 | 3300049572 | Bacteria | 530 |
| 226 | Ga0501041_0531730 | 3300049577 | Bacteria | 749 |
| 227 | Ga0501047_0758806 | 3300049581 | Bacteria | 786 |
| 228 | Ga0501048_0799204 | 3300049582 | Bacteria | 678 |
| 229 | Ga0501068_0350244 | 3300049584 | Bacteria | 949 |
| 230 | Ga0501076_1455571 | 3300049592 | Bacteria | 563 |
| 231 | Ga0501079_1024336 | 3300049741 | Bacteria | 650 |
| 232 | Ga0501080_0285782 | 3300049742 | Bacteria | 1498 |
| 233 | Ga0501081_1100657 | 3300049743 | Bacteria | 601 |
| 234 | Ga0501081_1309695 | 3300049743 | Unclassified | 549 |
| 235 | Ga0501044_0177077 | 3300049823 | Bacteria | 2101 |
| 236 | Ga0501082_1755569 | 3300060353 | Bacteria | 541 |
| 237 | 2524003509 | 2523533628 | Bacteria | 4098242 |
| 238 | Ga0316582_0702530 | |||
| 239 | Ga0065704_10212855 | |||
| 240 | Ga0265330_10266458 | |||
| 241 | Ga0265327_10412530 | |||
| 242 | Ga0265316_10101205 | |||
| 243 | Ga0265316_10288447 | |||
| 244 | Ga0316575_10000227 | |||
| 245 | Ga0316575_10016845 | |||
| 246 | Ga0316575_10061450 | |||
| 247 | Ga0316575_10168768 | |||
| 248 | Ga0316575_10467031 | |||
| 249 | Ga0316575_10491768 | |||
| 250 | Ga0316579_10000809 | |||
| 251 | Ga0316579_10003453 | |||
| 252 | Ga0316579_10009559 | |||
| 253 | Ga0316579_10014300 | |||
| 254 | Ga0316579_10038909 | |||
| 255 | Ga0316579_10053326 | |||
| 256 | Ga0316579_10120863 | |||
| 257 | Ga0316579_10149443 | |||
| 258 | Ga0316579_10153989 | |||
| 259 | Ga0316579_10423333 | |||
| 260 | Ga0316579_10447359 | |||
| 261 | Ga0316579_10449939 | |||
| 262 | Ga0316579_10609939 | |||
| 263 | Ga0265314_10426562 | |||
| 264 | Ga0316576_10002135 | |||
| 265 | Ga0316576_10003303 | |||
| 266 | Ga0316576_10008807 | |||
| 267 | Ga0316576_10031736 | |||
| 268 | Ga0316576_10036502 | |||
| 269 | Ga0316576_10086355 | |||
| 270 | Ga0316576_10092122 | |||
| 271 | Ga0316576_10092780 | |||
| 272 | Ga0316576_10094031 | |||
| 273 | Ga0316576_10113984 | |||
| 274 | Ga0316576_10154140 | |||
| 275 | Ga0316576_10261506 | |||
| 276 | Ga0316576_10400230 | |||
| 277 | Ga0316576_10450287 | |||
| 278 | Ga0316576_10516521 | |||
| 279 | Ga0316576_10537870 | |||
| 280 | Ga0316576_10567018 | |||
| 281 | Ga0316576_10569754 | |||
| 282 | Ga0316576_10652528 | |||
| 283 | Ga0316576_11220426 | |||
| 284 | Ga0316578_10001732 | |||
| 285 | Ga0316578_10004649 | |||
| 286 | Ga0316578_10071383 | |||
| 287 | Ga0316578_10071770 | |||
| 288 | Ga0316578_10123170 | |||
| 289 | Ga0316578_10126715 | |||
| 290 | Ga0316578_10148349 | |||
| 291 | Ga0316578_10148807 | |||
| 292 | Ga0316578_10369437 | |||
| 293 | Ga0316578_10551591 | |||
| 294 | Ga0316578_10593660 | |||
| 295 | Ga0316577_10007407 | |||
| 296 | Ga0316577_10013060 | |||
| 297 | Ga0316577_10037184 | |||
| 298 | Ga0316577_10045522 | |||
| 299 | Ga0316577_10058307 | |||
| 300 | Ga0316577_10061670 | |||
| 301 | Ga0316577_10068168 | |||
| 302 | Ga0316577_10088845 | |||
| 303 | Ga0316577_10121309 | |||
| 304 | Ga0316577_10201718 | |||
| 305 | Ga0316577_10215970 | |||
| 306 | Ga0316577_10277790 | |||
| 307 | Ga0316577_10334881 | |||
| 308 | Ga0316577_10341070 | |||
| 309 | Ga0316577_10448690 | |||
| 310 | Ga0316577_10643453 | |||
| 311 | Ga0316577_10874026 | |||
| 312 | Ga0316583_10000283 | |||
| 313 | Ga0316583_10006779 | |||
| 314 | Ga0316583_10031018 | |||
| 315 | Ga0316583_10037277 | |||
| 316 | Ga0316583_10040361 | |||
| 317 | Ga0316583_10203936 | |||
| 318 | Ga0316583_10357067 | |||
| 319 | Ga0316585_10011867 | |||
| 320 | Ga0316585_10020260 | |||
| 321 | Ga0316585_10025805 | |||
| 322 | Ga0316585_10325711 | |||
| 323 | Ga0316580_10000105 | |||
| 324 | Ga0316580_10005206 | |||
| 325 | Ga0316580_10008103 | |||
| 326 | Ga0316580_10026764 | |||
| 327 | Ga0316580_10026788 | |||
| 328 | Ga0316580_10065657 | |||
| 329 | Ga0316593_10042129 | |||
| 330 | Ga0316593_10049581 | |||
| 331 | Ga0316593_10062813 | |||
| 332 | Ga0316593_10095259 | |||
| 333 | Ga0316593_10165517 | |||
| 334 | Ga0316593_10165698 | |||
| 335 | Ga0316593_10396132 | |||
| 336 | Ga0316593_10443433 | |||
| 337 | Ga0316592_1014858 | |||
| 338 | Ga0316592_1029928 | |||
| 339 | Ga0316586_1008766 | |||
| 340 | Ga0316588_1116529 | |||
| 341 | Ga0316588_1218520 | |||
| 342 | Ga0316587_1016396 | |||
| 343 | Ga0316596_1014041 | |||
| 344 | Ga0316596_1126800 | |||
| 345 | Ga0316596_1138498 | |||
| 346 | Ga0316596_1163316 | |||
| 347 | Ga0316596_1179968 | |||
| 348 | Ga0316596_1224084 | |||
| 349 | Ga0316574_0004375 | |||
| 350 | Ga0316574_0005178 | |||
| 351 | Ga0316574_0008386 | |||
| 352 | Ga0316574_0020090 | |||
| 353 | Ga0316574_0064111 | |||
| 354 | Ga0316574_0131645 | |||
| 355 | Ga0316574_0185922 | |||
| 356 | Ga0316574_0243824 | |||
| 357 | Ga0316574_0321523 | |||
| 358 | Ga0316574_0503753 | |||
| 359 | Ga0316574_0728684 | |||
| 360 | Ga0316582_0000418 | |||
| 361 | Ga0316582_0008005 | |||
| 362 | Ga0316582_0012255 | |||
| 363 | Ga0316582_0024081 | |||
| 364 | Ga0316582_0035229 | |||
| 365 | Ga0316582_0080353 | |||
| 366 | Ga0316582_0081011 | |||
| 367 | Ga0316582_0103010 | |||
| 368 | Ga0316582_0110988 | |||
| 369 | Ga0316582_0135054 | |||
| 370 | Ga0316582_0143798 | |||
| 371 | Ga0316582_0255362 | |||
| 372 | Ga0316582_0259115 | |||
| 373 | Ga0316582_0338288 | |||
| 374 | Ga0316582_0411285 | |||
| 375 | Ga0316582_0450974 | |||
| 376 | Ga0316582_0471552 | |||
| 377 | Ga0316582_0549944 | |||
| 378 | Ga0316582_0678395 | |||
| 379 | Ga0316582_0710785 | |||
| 380 | Ga0316582_0763367 | |||
| 381 | Ga0316582_0808487 | |||
| 382 | Ga0316582_0961838 | |||
| 383 | Ga0316582_0987807 | |||
| 384 | Ga0316582_1159716 | |||
| 385 | Ga0316582_1237324 | |||
| 386 | Ga0316584_0003747 | |||
| 387 | Ga0316584_0006484 | |||
| 388 | Ga0316584_0009589 | |||
| 389 | Ga0316584_0013108 | |||
| 390 | Ga0316584_0025170 | |||
| 391 | Ga0316584_0034539 | |||
| 392 | Ga0316584_0036501 | |||
| 393 | Ga0316584_0043412 | |||
| 394 | Ga0316584_0056698 | |||
| 395 | Ga0316584_0063333 | |||
| 396 | Ga0316584_0101776 | |||
| 397 | Ga0316584_0105869 | |||
| 398 | Ga0316584_0118589 | |||
| 399 | Ga0316584_0366753 | |||
| 400 | Ga0316584_0409166 | |||
| 401 | Ga0316584_0425298 | |||
| 402 | Ga0316584_0477687 | |||
| 403 | Ga0316584_0557387 | |||
| 404 | Ga0316584_0738692 | |||
| 405 | Ga0316584_1150512 | |||
| 406 | Ga0316581_0012672 | |||
| 407 | Ga0316581_0018860 | |||
| 408 | Ga0316581_0042761 | |||
| 409 | Ga0316581_0057290 | |||
| 410 | Ga0316581_0068211 | |||
| 411 | Ga0400484_05887 | |||
| 412 | Ga0400490_10531 | |||
| 413 | Ga0400490_17984 | |||
| 414 | Ga0400490_32086 | |||
| 415 | Ga0400490_51844 | |||
| 416 | Ga0400491_09716 | |||
| 417 | Ga0400491_13126 | |||
| 418 | Ga0400491_16662 | |||
| 419 | Ga0400485_14641 | |||
| 420 | Ga0400485_16561 | |||
| 421 | Ga0400485_21688 | |||
| 422 | Ga0400488_15992 | |||
| 423 | Ga0400488_30738 | |||
| 424 | Ga0400488_50819 | |||
| 425 | Ga0400486_17636 | |||
| 426 | Ga0400486_20934 | |||
| 427 | Ga0400486_21293 | |||
| 428 | Ga0400483_035049 | |||
| 429 | Ga0400483_071935 | |||
| 430 | Ga0400483_143920 | |||
| 431 | Ga0400483_281303 | |||
| 432 | Ga0400489_06520 | |||
| 433 | Ga0400489_36940 | |||
| 434 | Ga0400489_39658 | |||
| 435 | Ga0400489_58669 | |||
| 436 | Ga0400489_84424 | |||
| 437 | Ga0400487_32881 | |||
| 438 | Ga0400487_39758 | |||
| 439 | Ga0400487_58619 | |||
| 440 | Ga0451577_0000141 | |||
| 441 | Ga0451577_0001745 | |||
| 442 | Ga0451577_0157573 | |||
| 443 | Ga0451577_1022606 | |||
| 444 | Ga0453683_0004620 | |||
| 445 | Ga0453683_0156412 | |||
| 446 | Ga0453684_0000463 | |||
| 447 | Ga0453684_0000614 | |||
| 448 | Ga0453684_0003717 | |||
| 449 | Ga0453684_0068932 | |||
| 450 | Ga0453684_0072461 | |||
| 451 | Ga0453684_0075818 | |||
| 452 | Ga0453684_0112359 | |||
| 453 | Ga0453684_0249042 | |||
| 454 | Ga0453684_0536817 | |||
| 455 | Ga0453684_0643584 | |||
| 456 | Ga0453684_2151659 | |||
| 457 | Ga0451576_0010120 | |||
| 458 | Ga0451576_0116187 | |||
| 459 | Ga0451576_0293877 | |||
| 460 | Ga0451576_0772883 | |||
| 461 | Ga0451576_1403783 | |||
| 462 | Ga0501036_1580147 | |||
| 463 | Ga0501041_0531730 | |||
| 464 | Ga0501047_0758806 | |||
| 465 | Ga0501048_0799204 | |||
| 466 | Ga0501068_0350244 | |||
| 467 | Ga0501076_1455571 | |||
| 468 | Ga0501079_1024336 | |||
| 469 | Ga0501080_0285782 | |||
| 470 | Ga0501081_1100657 | |||
| 471 | Ga0501081_1309695 | |||
| 472 | Ga0501044_0177077 | |||
| 473 | Ga0501082_1755569 | |||
| 474 | 2524003509 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2z51-assembly1.cif.gz_A-2 | crystal structure of arabidopsis cnfu involved in iron-sulfur cluster biosynthesis | 0.9121 | 3 | 73 |
| 2z51-assembly1.cif.gz_A-2 | crystal structure of arabidopsis cnfu involved in iron-sulfur cluster biosynthesis | 0.8661 | 3 | 73 |
| 2m5o-assembly1.cif.gz_A | solution nmr structure ctd domain of nfu1 iron-sulfur cluster scaffold homolog from homo sapiens, northeast structural genomics consortium (nesg) target hr2876c | 0.8576 | 5 | 73 |
| 2jnv-assembly1.cif.gz_A | solution structure of c-terminal domain of nifu-like protein from oryza sativa | 0.8175 | 5 | 73 |
| 2m5o-assembly1.cif.gz_A | solution nmr structure ctd domain of nfu1 iron-sulfur cluster scaffold homolog from homo sapiens, northeast structural genomics consortium (nesg) target hr2876c | 0.8055 | 5 | 73 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2z51A01 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) | 0.9121 | 3 | 73 | 3.30.300.130 |
| af_Q2FZW2_1_80_3.30.300.130 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) | 0.9106 | 2 | 73 | 3.30.300.130 |
| af_C0H578_105_189_3.30.300.130 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) | 0.9103 | 2 | 73 | 3.30.300.130 |
| af_P63020_101_188_3.30.300.130 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) | 0.9081 | 1 | 72 | 3.30.300.130 |
| af_P32860_146_234_3.30.300.130 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) | 0.9061 | 3 | 73 | 3.30.300.130 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-R5FPB9-F1-model_v4 | deleted | 0.9574 | 3 | 73 |
|
| AF-A0A3P2AM21-F1-model_v4 | NifU family protein | 0.9555 | 3 | 73 |
GO:0005506
GO:0016226 GO:0051536 |
| AF-A0A7V0VFJ6-F1-model_v4 | NifU family protein | 0.9552 | 2 | 73 |
GO:0005506
GO:0016226 GO:0051536 |
| AF-A0A0U5B5A7-F1-model_v4 | Fe/S biogenesis protein NfuA | 0.9548 | 3 | 73 |
GO:0005506
GO:0016226 GO:0051536 |
| AF-A0A0Q9XV35-F1-model_v4 | Nitrogen fixation protein NifU | 0.9531 | 1 | 73 |
GO:0005506
GO:0016226 GO:0051536 |