F350156

General Info

Members Datasets Scaffolds Average Seq Length
237 190 474 148

Family's Representative Sequence

Representative Sequence 3300032004|Ga0307414_11276662|Ga0307414_112766621
Length 169
Sequence VGPNTRHSRLERLMTYRYTSPMPSQSPMDLALSLAEEAASLGEAPVGAVVMEGDTVLAAERNRMKALGDPTAHAEMLAIRAALAKRGTGRLDGCDLYVTLEPCAMCAGAIAHTRLRRVYFAAEDTKAGAVENGIRLFEQPTCHHSPEVIGGLGEGRSEALLRDFFRALR

Samples

Sample ID Description Type Environment
1 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
65 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
66 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
67 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
68 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
69 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
110 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
111 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
112 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
113 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
115 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
119 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
120 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
121 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
122 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
123 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
124 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
125 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
126 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
127 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
130 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
131 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
132 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
133 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
134 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
135 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
136 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
137 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
138 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
139 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
140 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
141 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
142 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
147 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
152 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
153 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
154 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
167 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
168 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
169 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
170 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
171 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
172 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
173 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
174 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
175 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
176 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
177 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
180 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
183 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
184 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
185 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
186 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
187 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
188 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
189 2643221580 Devosia sp. Root635 Isolate Unclassified
190 2643221674 Devosia sp. Root436 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.31
Metatranscriptomes 0.84
Isolates 0.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.95
Nodule 0
Rhizoplane 5.49
Rhizosphere 87.34
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307414_11276662 3300032004 Bacteria 681
2 JGI25151J46595_10000482 3300003187 Bacteria 37729
3 rootH2_10021643 3300003320 Bacteria 4809
4 Ga0070658_10129167 3300005327 Bacteria 2105
5 Ga0070676_10208345 3300005328 Bacteria 1285
6 Ga0070683_100054808 3300005329 Bacteria 3697
7 Ga0070680_100018102 3300005336 Bacteria 5565
8 Ga0068868_101006645 3300005338 Bacteria 762
9 Ga0070660_100076607 3300005339 Bacteria 2620
10 Ga0070691_10025803 3300005341 Bacteria 2738
11 Ga0070687_100441459 3300005343 Bacteria 863
12 Ga0070661_100065563 3300005344 Bacteria 2668
13 Ga0070675_101029601 3300005354 Bacteria 756
14 Ga0070671_100407659 3300005355 Bacteria 1163
15 Ga0070674_100274783 3300005356 Bacteria 1333
16 Ga0070688_100412738 3300005365 Bacteria 1002
17 Ga0070659_100133732 3300005366 Bacteria 2016
18 Ga0070667_100180224 3300005367 Bacteria 1868
19 Ga0070713_100004534 3300005436 Bacteria 9356
20 Ga0070711_100018215 3300005439 Bacteria 4480
21 Ga0070705_100028092 3300005440 Bacteria 3078
22 Ga0070700_100367788 3300005441 Bacteria 1071
23 Ga0070694_100497171 3300005444 Bacteria 970
24 Ga0070681_10062887 3300005458 Bacteria 3684
25 Ga0068853_100042983 3300005539 Bacteria 3865
26 Ga0068853_100155566 3300005539 Bacteria 2060
27 Ga0068853_101170002 3300005539 Bacteria 742
28 Ga0070695_100043701 3300005545 Bacteria 2850
29 Ga0070696_100352710 3300005546 Bacteria 1140
30 Ga0070693_101236039 3300005547 Bacteria 575
31 Ga0070704_101803241 3300005549 Bacteria 566
32 Ga0068855_100127471 3300005563 Bacteria 2909
33 Ga0070664_100893405 3300005564 Bacteria 833
34 Ga0068857_100060005 3300005577 Bacteria 3379
35 Ga0068856_100074079 3300005614 Bacteria 3371
36 Ga0070702_100600460 3300005615 Bacteria 825
37 Ga0068852_100088898 3300005616 Bacteria 2760
38 Ga0068859_100032487 3300005617 Bacteria 5242
39 Ga0068859_100665530 3300005617 Bacteria 1133
40 Ga0068864_101822972 3300005618 Bacteria 614
41 Ga0068851_10016255 3300005834 Bacteria 3559
42 Ga0068858_100193058 3300005842 Bacteria 1924
43 Ga0068860_100194327 3300005843 Bacteria 1965
44 Ga0068862_100273472 3300005844 Bacteria 1546
45 Ga0068862_100494447 3300005844 Bacteria 1160
46 Ga0081455_10001157 3300005937 Bacteria 33069
47 Ga0081455_10039433 3300005937 Bacteria 4174
48 Ga0070717_10369546 3300006028 Bacteria 1285
49 Ga0070715_10609034 3300006163 Bacteria 641
50 Ga0070712_100236988 3300006175 Bacteria 1452
51 Ga0075428_100840521 3300006844 Bacteria 975
52 Ga0075431_100938405 3300006847 Bacteria 834
53 Ga0075433_10163790 3300006852 Bacteria 1979
54 Ga0097620_100032489 3300006931 Bacteria 5242
55 Ga0097620_100665498 3300006931 Bacteria 1133
56 Ga0099794_10032972 3300007265 Bacteria 2433
57 Ga0111539_10098066 3300009094 Bacteria 3443
58 Ga0105247_10348984 3300009101 Bacteria 1040
59 Ga0114129_10762147 3300009147 Bacteria 1238
60 Ga0105248_10199313 3300009177 Bacteria 2255
61 Ga0105237_10734535 3300009545 Bacteria 994
62 Ga0105237_10922803 3300009545 Bacteria 880
63 Ga0105238_10019952 3300009551 Bacteria 6824
64 Ga0105238_10030804 3300009551 Bacteria 5460
65 Ga0105249_10215888 3300009553 Bacteria 1885
66 Ga0105239_10073489 3300010375 Bacteria 3759
67 Ga0157370_10047145 3300013104 Bacteria 4131
68 Ga0157374_10138982 3300013296 Bacteria 2357
69 Ga0157378_10084604 3300013297 Bacteria 2872
70 Ga0157378_13192227 3300013297 Bacteria 509
71 Ga0163162_11576762 3300013306 Bacteria 749
72 Ga0157372_11286415 3300013307 Bacteria 844
73 Ga0213872_10000649 3300021361 Bacteria 26344
74 Ga0213872_10001068 3300021361 Bacteria 18918
75 Ga0213872_10004066 3300021361 Bacteria 7878
76 Ga0213872_10015096 3300021361 Bacteria 3593
77 Ga0213872_10029122 3300021361 Bacteria 2532
78 Ga0213872_10187092 3300021361 Bacteria 892
79 Ga0213872_10218606 3300021361 Bacteria 811
80 Ga0209130_1000126 3300025284 Bacteria 123694
81 Ga0209025_1000712 3300025294 Bacteria 56550
82 Ga0209758_1001872 3300025297 Bacteria 23052
83 Ga0207426_1000046 3300025302 Bacteria 422271
84 Ga0207656_10203385 3300025321 Bacteria 957
85 Ga0207692_10493488 3300025898 Bacteria 776
86 Ga0207645_10251152 3300025907 Bacteria 1170
87 Ga0207705_10099628 3300025909 Bacteria 2137
88 Ga0207654_10990657 3300025911 Bacteria 611
89 Ga0207707_10013936 3300025912 Bacteria 7011
90 Ga0207671_10230545 3300025914 Bacteria 1453
91 Ga0207693_10009385 3300025915 Bacteria 7979
92 Ga0207693_10043211 3300025915 Bacteria 3546
93 Ga0207663_10913755 3300025916 Bacteria 702
94 Ga0207660_10013674 3300025917 Bacteria 5324
95 Ga0207662_10110349 3300025918 Bacteria 1714
96 Ga0207662_10422729 3300025918 Bacteria 907
97 Ga0207657_10009073 3300025919 Bacteria 10041
98 Ga0207652_10052397 3300025921 Bacteria 3502
99 Ga0207694_10005914 3300025924 Bacteria 9380
100 Ga0207694_10052089 3300025924 Bacteria 3173
101 Ga0207694_10413022 3300025924 Bacteria 1123
102 Ga0207650_11552717 3300025925 Bacteria 562
103 Ga0207690_10740955 3300025932 Bacteria 810
104 Ga0207706_10550785 3300025933 Bacteria 993
105 Ga0207669_10275122 3300025937 Bacteria 1267
106 Ga0207665_10723321 3300025939 Bacteria 783
107 Ga0207711_10054295 3300025941 Bacteria 3438
108 Ga0207711_10109018 3300025941 Bacteria 2460
109 Ga0207661_10115813 3300025944 Bacteria 2274
110 Ga0207679_10229756 3300025945 Bacteria 1565
111 Ga0207667_10078115 3300025949 Bacteria 3431
112 Ga0207712_10165454 3300025961 Bacteria 1723
113 Ga0207668_10153766 3300025972 Bacteria 1784
114 Ga0207640_11178534 3300025981 Bacteria 680
115 Ga0207658_10135841 3300025986 Bacteria 1983
116 Ga0207639_10015132 3300026041 Bacteria 5436
117 Ga0207639_10093200 3300026041 Bacteria 2415
118 Ga0207639_11022278 3300026041 Bacteria 774
119 Ga0207708_10152330 3300026075 Bacteria 1821
120 Ga0207702_10067484 3300026078 Bacteria 3070
121 Ga0207702_10559418 3300026078 Bacteria 1119
122 Ga0207674_10036237 3300026116 Bacteria 5142
123 Ga0207698_10056041 3300026142 Bacteria 3041
124 Ga0209588_1018202 3300027671 Bacteria 2186
125 Ga0209998_10003924 3300027717 Bacteria 3206
126 Ga0268265_10188256 3300028380 Bacteria 1780
127 Ga0268265_10371809 3300028380 Bacteria 1312
128 Ga0268264_10313150 3300028381 Bacteria 1482
129 Ga0265770_1003517 3300030878 Bacteria 2129
130 Ga0265760_10152170 3300031090 Bacteria 759
131 Ga0265314_10048538 3300031711 Bacteria 2978
132 Ga0307409_102844702 3300031995 Bacteria 511
133 Ga0307414_10252815 3300032004 Bacteria 1466
134 Ga0307414_10475778 3300032004 Bacteria 1101
135 Ga0307414_10486426 3300032004 Bacteria 1089
136 Ga0307411_11851543 3300032005 Bacteria 561
137 Ga0373934_0117330 3300035086 Bacteria 1082
138 Ga0373931_0125555 3300035691 Bacteria 1471
139 Ga0373935_0389339 3300035692 Bacteria 999
140 Ga0373925_0155456 3300037068 Bacteria 1798
141 Ga0395900_0280225 3300037418 Bacteria 1659
142 Ga0395900_0770918 3300037418 Bacteria 891
143 Ga0436364_1070857 3300037853 Bacteria 509
144 Ga0395901_0389141 3300038443 Bacteria 1434
145 Ga0436365_0716247 3300039437 Bacteria 21548
146 Ga0436360_0325558 3300039438 Bacteria 810
147 Ga0436361_0020118 3300039447 Bacteria 10483
148 Ga0436361_0114455 3300039447 Bacteria 4879
149 Ga0436361_0169644 3300039447 Bacteria 41174
150 Ga0436361_0174867 3300039447 Bacteria 736
151 Ga0436361_0214900 3300039447 Bacteria 36416
152 Ga0436361_0411999 3300039447 Bacteria 907
153 Ga0436361_0470895 3300039447 Bacteria 1546
154 Ga0436361_0568061 3300039447 Bacteria 2050
155 Ga0436361_0975377 3300039447 Bacteria 930
156 Ga0436361_1030003 3300039447 Bacteria 1233
157 Ga0436362_0051654 3300039453 Bacteria 1480
158 Ga0451797_0843923 3300041453 Bacteria 849
159 Ga0451807_0601778 3300041486 Bacteria 514
160 Ga0439448_0029821 3300042005 Bacteria 1728
161 Ga0439458_0118926 3300042157 Bacteria 695
162 Ga0439460_0012602 3300042461 Bacteria 2198
163 Ga0466963_0921190 3300044694 Bacteria 616
164 Ga0466971_0007671 3300044719 Bacteria 4706
165 Ga0466957_0018239 3300044842 Bacteria 4119
166 Ga0466959_0491119 3300045049 Bacteria 830
167 Ga0466958_0000735 3300045836 Bacteria 14323
168 Ga0495590_0197382 3300046457 Bacteria 739
169 Ga0495584_0008335 3300046491 Bacteria 5368
170 Ga0495607_0397913 3300046501 Bacteria 627
171 Ga0495608_0100738 3300046511 Bacteria 1862
172 Ga0495637_0168128 3300046520 Bacteria 819
173 Ga0495597_0084634 3300046542 Bacteria 1352
174 Ga0495633_0466663 3300046558 Bacteria 570
175 Ga0495625_0094853 3300046660 Bacteria 2058
176 Ga0495635_0336517 3300046663 Bacteria 1008
177 Ga0495600_0054554 3300046809 Bacteria 2610
178 Ga0495660_0160283 3300046810 Bacteria 1104
179 Ga0496100_1687080 3300048903 Bacteria 501
180 Ga0496102_0069594 3300048905 Bacteria 3230
181 Ga0496102_1131048 3300048905 Bacteria 703
182 Ga0496103_0003492 3300048906 Bacteria 9614
183 Ga0496104_0325398 3300048907 Bacteria 1450
184 Ga0496104_1569111 3300048907 Bacteria 561
185 Ga0496106_0008422 3300048909 Bacteria 7629
186 Ga0496107_0128016 3300048910 Bacteria 1873
187 Ga0496109_0213169 3300048912 Bacteria 1816
188 Ga0496110_0214056 3300048913 Bacteria 1752
189 Ga0496112_0764925 3300048915 Bacteria 892
190 Ga0496121_0034958 3300048924 Bacteria 4511
191 Ga0496121_0504077 3300048924 Bacteria 768
192 Ga0496125_0385730 3300048928 Bacteria 824
193 Ga0496126_0090671 3300048929 Bacteria 2689
194 Ga0496126_0271159 3300048929 Bacteria 1408
195 Ga0501032_0871131 3300049569 Bacteria 567
196 Ga0501033_0116085 3300049570 Bacteria 1945
197 Ga0501034_0001128 3300049571 Bacteria 37285
198 Ga0501034_0188461 3300049571 Bacteria 2025
199 Ga0501036_0096063 3300049572 Bacteria 2505
200 Ga0501038_0096302 3300049574 Bacteria 2471
201 Ga0501038_0145036 3300049574 Bacteria 1939
202 Ga0501039_0664563 3300049575 Bacteria 815
203 Ga0501040_0013429 3300049576 Bacteria 5382
204 Ga0501042_0064657 3300049578 Bacteria 2614
205 Ga0501043_0139291 3300049579 Bacteria 1900
206 Ga0501046_0097458 3300049580 Bacteria 2259
207 Ga0501047_0691472 3300049581 Bacteria 838
208 Ga0501048_0845652 3300049582 Bacteria 658
209 Ga0501070_0266397 3300049586 Bacteria 1400
210 Ga0501071_0046792 3300049587 Bacteria 3107
211 Ga0501071_0063454 3300049587 Bacteria 2678
212 Ga0501072_0272467 3300049588 Bacteria 1346
213 Ga0501074_0158093 3300049590 Bacteria 1618
214 Ga0501076_0075454 3300049592 Bacteria 2702
215 Ga0501077_0045235 3300049593 Bacteria 2796
216 Ga0501225_0241973 3300049705 Bacteria 590
217 Ga0501079_0173295 3300049741 Bacteria 1682
218 Ga0501080_0080581 3300049742 Bacteria 3026
219 Ga0501081_0701940 3300049743 Bacteria 759
220 Ga0501083_0188797 3300049744 Bacteria 1345
221 Ga0501083_0335398 3300049744 Bacteria 983
222 Ga0501035_0163809 3300049822 Bacteria 1924
223 Ga0501044_0000228 3300049823 Bacteria 70615
224 nmdc:mga05p37_1002536_c1 3300050507 Bacteria 887
225 nmdc:mga06r32_679588_c1 3300050510 Bacteria 996
226 nmdc:mga08y16_450300_c1 3300050511 Bacteria 1313
227 nmdc:mga0n895_1370850_c1 3300050512 Bacteria 676
228 nmdc:mga0n895_150229_c1 3300050512 Bacteria 2359
229 nmdc:mga0a205_110154_c1 3300050515 Bacteria 2652
230 Ga0495655_0001559 3300053083 Bacteria 3528
231 Ga0500646_0011919 3300053090 Bacteria 2240
232 Ga0500627_0200620 3300053158 Bacteria 894
233 Ga0501084_0010455 3300054114 Bacteria 7670
234 Ga0501082_0074670 3300060353 Bacteria 2920
235 Ga0501082_0638572 3300060353 Bacteria 932
236 2643909728 2643221580 Bacteria 3816678
237 2644413585 2643221674 Bacteria 3919126
238 Ga0307414_11276662
239 JGI25151J46595_10000482
240 rootH2_10021643
241 Ga0070658_10129167
242 Ga0070676_10208345
243 Ga0070683_100054808
244 Ga0070680_100018102
245 Ga0068868_101006645
246 Ga0070660_100076607
247 Ga0070691_10025803
248 Ga0070687_100441459
249 Ga0070661_100065563
250 Ga0070675_101029601
251 Ga0070671_100407659
252 Ga0070674_100274783
253 Ga0070688_100412738
254 Ga0070659_100133732
255 Ga0070667_100180224
256 Ga0070713_100004534
257 Ga0070711_100018215
258 Ga0070705_100028092
259 Ga0070700_100367788
260 Ga0070694_100497171
261 Ga0070681_10062887
262 Ga0068853_100042983
263 Ga0068853_100155566
264 Ga0068853_101170002
265 Ga0070695_100043701
266 Ga0070696_100352710
267 Ga0070693_101236039
268 Ga0070704_101803241
269 Ga0068855_100127471
270 Ga0070664_100893405
271 Ga0068857_100060005
272 Ga0068856_100074079
273 Ga0070702_100600460
274 Ga0068852_100088898
275 Ga0068859_100032487
276 Ga0068859_100665530
277 Ga0068864_101822972
278 Ga0068851_10016255
279 Ga0068858_100193058
280 Ga0068860_100194327
281 Ga0068862_100273472
282 Ga0068862_100494447
283 Ga0081455_10001157
284 Ga0081455_10039433
285 Ga0070717_10369546
286 Ga0070715_10609034
287 Ga0070712_100236988
288 Ga0075428_100840521
289 Ga0075431_100938405
290 Ga0075433_10163790
291 Ga0097620_100032489
292 Ga0097620_100665498
293 Ga0099794_10032972
294 Ga0111539_10098066
295 Ga0105247_10348984
296 Ga0114129_10762147
297 Ga0105248_10199313
298 Ga0105237_10734535
299 Ga0105237_10922803
300 Ga0105238_10019952
301 Ga0105238_10030804
302 Ga0105249_10215888
303 Ga0105239_10073489
304 Ga0157370_10047145
305 Ga0157374_10138982
306 Ga0157378_10084604
307 Ga0157378_13192227
308 Ga0163162_11576762
309 Ga0157372_11286415
310 Ga0213872_10000649
311 Ga0213872_10001068
312 Ga0213872_10004066
313 Ga0213872_10015096
314 Ga0213872_10029122
315 Ga0213872_10187092
316 Ga0213872_10218606
317 Ga0209130_1000126
318 Ga0209025_1000712
319 Ga0209758_1001872
320 Ga0207426_1000046
321 Ga0207656_10203385
322 Ga0207692_10493488
323 Ga0207645_10251152
324 Ga0207705_10099628
325 Ga0207654_10990657
326 Ga0207707_10013936
327 Ga0207671_10230545
328 Ga0207693_10009385
329 Ga0207693_10043211
330 Ga0207663_10913755
331 Ga0207660_10013674
332 Ga0207662_10110349
333 Ga0207662_10422729
334 Ga0207657_10009073
335 Ga0207652_10052397
336 Ga0207694_10005914
337 Ga0207694_10052089
338 Ga0207694_10413022
339 Ga0207650_11552717
340 Ga0207690_10740955
341 Ga0207706_10550785
342 Ga0207669_10275122
343 Ga0207665_10723321
344 Ga0207711_10054295
345 Ga0207711_10109018
346 Ga0207661_10115813
347 Ga0207679_10229756
348 Ga0207667_10078115
349 Ga0207712_10165454
350 Ga0207668_10153766
351 Ga0207640_11178534
352 Ga0207658_10135841
353 Ga0207639_10015132
354 Ga0207639_10093200
355 Ga0207639_11022278
356 Ga0207708_10152330
357 Ga0207702_10067484
358 Ga0207702_10559418
359 Ga0207674_10036237
360 Ga0207698_10056041
361 Ga0209588_1018202
362 Ga0209998_10003924
363 Ga0268265_10188256
364 Ga0268265_10371809
365 Ga0268264_10313150
366 Ga0265770_1003517
367 Ga0265760_10152170
368 Ga0265314_10048538
369 Ga0307409_102844702
370 Ga0307414_10252815
371 Ga0307414_10475778
372 Ga0307414_10486426
373 Ga0307411_11851543
374 Ga0373934_0117330
375 Ga0373931_0125555
376 Ga0373935_0389339
377 Ga0373925_0155456
378 Ga0395900_0280225
379 Ga0395900_0770918
380 Ga0436364_1070857
381 Ga0395901_0389141
382 Ga0436365_0716247
383 Ga0436360_0325558
384 Ga0436361_0020118
385 Ga0436361_0114455
386 Ga0436361_0169644
387 Ga0436361_0174867
388 Ga0436361_0214900
389 Ga0436361_0411999
390 Ga0436361_0470895
391 Ga0436361_0568061
392 Ga0436361_0975377
393 Ga0436361_1030003
394 Ga0436362_0051654
395 Ga0451797_0843923
396 Ga0451807_0601778
397 Ga0439448_0029821
398 Ga0439458_0118926
399 Ga0439460_0012602
400 Ga0466963_0921190
401 Ga0466971_0007671
402 Ga0466957_0018239
403 Ga0466959_0491119
404 Ga0466958_0000735
405 Ga0495590_0197382
406 Ga0495584_0008335
407 Ga0495607_0397913
408 Ga0495608_0100738
409 Ga0495637_0168128
410 Ga0495597_0084634
411 Ga0495633_0466663
412 Ga0495625_0094853
413 Ga0495635_0336517
414 Ga0495600_0054554
415 Ga0495660_0160283
416 Ga0496100_1687080
417 Ga0496102_0069594
418 Ga0496102_1131048
419 Ga0496103_0003492
420 Ga0496104_0325398
421 Ga0496104_1569111
422 Ga0496106_0008422
423 Ga0496107_0128016
424 Ga0496109_0213169
425 Ga0496110_0214056
426 Ga0496112_0764925
427 Ga0496121_0034958
428 Ga0496121_0504077
429 Ga0496125_0385730
430 Ga0496126_0090671
431 Ga0496126_0271159
432 Ga0501032_0871131
433 Ga0501033_0116085
434 Ga0501034_0001128
435 Ga0501034_0188461
436 Ga0501036_0096063
437 Ga0501038_0096302
438 Ga0501038_0145036
439 Ga0501039_0664563
440 Ga0501040_0013429
441 Ga0501042_0064657
442 Ga0501043_0139291
443 Ga0501046_0097458
444 Ga0501047_0691472
445 Ga0501048_0845652
446 Ga0501070_0266397
447 Ga0501071_0046792
448 Ga0501071_0063454
449 Ga0501072_0272467
450 Ga0501074_0158093
451 Ga0501076_0075454
452 Ga0501077_0045235
453 Ga0501225_0241973
454 Ga0501079_0173295
455 Ga0501080_0080581
456 Ga0501081_0701940
457 Ga0501083_0188797
458 Ga0501083_0335398
459 Ga0501035_0163809
460 Ga0501044_0000228
461 nmdc:mga05p37_1002536_c1
462 nmdc:mga06r32_679588_c1
463 nmdc:mga08y16_450300_c1
464 nmdc:mga0n895_1370850_c1
465 nmdc:mga0n895_150229_c1
466 nmdc:mga0a205_110154_c1
467 Ga0495655_0001559
468 Ga0500646_0011919
469 Ga0500627_0200620
470 Ga0501084_0010455
471 Ga0501082_0074670
472 Ga0501082_0638572
473 2643909728
474 2644413585

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00383

dCMP_cyt_deam_1

Cytidine and deoxycytidylate deaminase zinc-binding region

22

122

0.95

PF14437

MafB19-deam

MafB19-like deaminase

22

169

0.95

Map