F350143

General Info

Members Datasets Scaffolds Average Seq Length
237 137 474 154

Family's Representative Sequence

Representative Sequence 3300031852|Ga0307410_10027081|Ga0307410_100270816
Length 170
Sequence VLNDGDGAYPSTSDDLFIPPASPAELDALEAAVDGWLRRALAENPMLVAVDRGEPGERRWYVRLAGEDKDFTTIWFTLRQRALHFESYVMPAPEENEAEFYAHLLRRNLTFHGMAFAVGAEEAIFLVGALPLSAVSEAQLDRVIGSAWAYVERTFRAALRIGFASRFGGG

Samples

Sample ID Description Type Environment
1 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
4 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
5 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
6 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
7 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
8 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
9 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
10 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
11 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
12 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
13 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
14 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
15 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
16 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
17 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
18 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
19 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
21 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
23 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
24 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
25 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
26 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
27 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
28 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
36 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
37 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
40 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
41 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
42 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
43 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
44 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
45 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
46 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
47 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
48 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
49 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
50 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
51 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
52 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
53 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
54 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
55 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
56 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
57 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
58 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
59 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
60 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
61 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
62 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
63 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
64 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
65 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
66 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
67 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
68 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
69 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
70 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
71 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
72 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
73 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
74 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
75 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
76 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
77 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
78 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
79 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
80 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
81 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
82 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
83 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
84 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
85 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
86 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
87 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
88 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
89 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
90 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
91 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
92 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
93 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
94 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
107 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
108 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
109 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
110 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
111 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
112 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
113 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
114 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
115 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
116 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
117 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
118 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
119 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
121 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
122 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
123 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
124 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
125 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
126 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
127 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
128 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
129 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
130 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
131 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
132 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
133 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
134 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
135 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
136 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
137 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.66
Nodule 0
Rhizoplane 2.11
Rhizosphere 83.12
Stem 0
Stem Tuber 0
Unclassified 10.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307410_10027081 3300031852 Bacteria 3619
2 Ga0070670_100412588 3300005331 Unclassified 1193
3 Ga0070661_100158154 3300005344 Bacteria 1715
4 Ga0070678_100937858 3300005456 Unclassified 793
5 Ga0070678_101085764 3300005456 Bacteria 738
6 Ga0070706_100706349 3300005467 Bacteria 935
7 Ga0068853_101522681 3300005539 Bacteria 648
8 Ga0068860_100008677 3300005843 Bacteria 10125
9 Ga0081455_10001515 3300005937 Bacteria 28639
10 Ga0081455_10012914 3300005937 Bacteria 8286
11 Ga0081455_10018912 3300005937 Bacteria 6536
12 Ga0081538_10000033 3300005981 Bacteria 121023
13 Ga0081538_10000913 3300005981 Bacteria 31836
14 Ga0081538_10051779 3300005981 Bacteria 2461
15 Ga0075365_10040684 3300006038 Bacteria 3032
16 Ga0075365_10286767 3300006038 Bacteria 1158
17 Ga0075365_10377024 3300006038 Bacteria 1001
18 Ga0075365_10991625 3300006038 Bacteria 592
19 Ga0075365_10995782 3300006038 Bacteria 591
20 Ga0075363_100257924 3300006048 Unclassified 1005
21 Ga0075363_100378496 3300006048 Bacteria 830
22 Ga0075362_10300599 3300006177 Bacteria 796
23 Ga0075367_10173977 3300006178 Bacteria 1341
24 Ga0075367_10520586 3300006178 Bacteria 755
25 Ga0075367_10597917 3300006178 Bacteria 701
26 Ga0075367_10647334 3300006178 Bacteria 672
27 Ga0075367_10790695 3300006178 Bacteria 604
28 Ga0075427_10023590 3300006194 Unclassified 986
29 Ga0075428_100028954 3300006844 Bacteria 6129
30 Ga0075428_100307521 3300006844 Bacteria 1704
31 Ga0075428_100688788 3300006844 Bacteria 1089
32 Ga0075428_100784467 3300006844 Bacteria 1013
33 Ga0075430_100001405 3300006846 Bacteria 19575
34 Ga0075430_100010200 3300006846 Bacteria 7955
35 Ga0075430_100035599 3300006846 Bacteria 4223
36 Ga0075431_100001012 3300006847 Bacteria 25009
37 Ga0075431_100012975 3300006847 Bacteria 8414
38 Ga0075431_100347042 3300006847 Bacteria 1493
39 Ga0075431_100466062 3300006847 Bacteria 1257
40 Ga0075429_100096721 3300006880 Bacteria 2576
41 Ga0075429_100998600 3300006880 Bacteria 732
42 Ga0111539_10000426 3300009094 Bacteria 52948
43 Ga0111539_10406617 3300009094 Bacteria 1585
44 Ga0105245_10022749 3300009098 Bacteria 5502
45 Ga0105245_10883924 3300009098 Bacteria 935
46 Ga0114129_10225515 3300009147 Bacteria 2526
47 Ga0114129_10596305 3300009147 Bacteria 1432
48 Ga0114129_11375938 3300009147 Bacteria 872
49 Ga0114129_12633346 3300009147 Unclassified 600
50 Ga0105242_10117937 3300009176 Bacteria 2273
51 Ga0105242_10370232 3300009176 Bacteria 1328
52 Ga0105249_10933257 3300009553 Bacteria 935
53 Ga0105239_10562259 3300010375 Bacteria 1299
54 Ga0157378_10328447 3300013297 Bacteria 1488
55 Ga0157378_10675924 3300013297 Bacteria 1050
56 Ga0157375_10395491 3300013308 Unclassified 1549
57 Ga0213876_10039959 3300021384 Bacteria 2478
58 Ga0207707_10877145 3300025912 Unclassified 743
59 Ga0207687_10218319 3300025927 Bacteria 1500
60 Ga0207686_10108398 3300025934 Bacteria 1868
61 Ga0207670_11021931 3300025936 Unclassified 696
62 Ga0207689_11003978 3300025942 Bacteria 704
63 Ga0207651_11071881 3300025960 Bacteria 722
64 Ga0207683_10183208 3300026121 Bacteria 1899
65 Ga0209813_10101300 3300027866 Bacteria 980
66 Ga0209813_10173338 3300027866 Unclassified 785
67 Ga0207428_10028281 3300027907 Bacteria 4659
68 Ga0268266_10377221 3300028379 Bacteria 1337
69 Ga0268265_11418219 3300028380 Bacteria 697
70 Ga0307408_100507563 3300031548 Bacteria 1057
71 Ga0316579_10171587 3300031691 Bacteria 1048
72 Ga0316576_10003509 3300031727 Bacteria 9210
73 Ga0316576_10100774 3300031727 Bacteria 2159
74 Ga0316578_10003491 3300031728 Bacteria 7208
75 Ga0316578_10021537 3300031728 Bacteria 3578
76 Ga0307405_10171081 3300031731 Bacteria 1550
77 Ga0316577_10036956 3300031733 Unclassified 2732
78 Ga0316577_10170295 3300031733 Bacteria 1229
79 Ga0316577_10237620 3300031733 Unclassified 1030
80 Ga0307413_10278523 3300031824 Bacteria 1257
81 Ga0307413_10427663 3300031824 Bacteria 1045
82 Ga0307413_10455940 3300031824 Bacteria 1016
83 Ga0307413_10926106 3300031824 Bacteria 742
84 Ga0307410_10511617 3300031852 Bacteria 989
85 Ga0307406_10312788 3300031901 Bacteria 1212
86 Ga0307407_10102202 3300031903 Bacteria 1782
87 Ga0307407_10263014 3300031903 Bacteria 1187
88 Ga0307412_10723329 3300031911 Bacteria 857
89 Ga0307409_100009715 3300031995 Bacteria 5932
90 Ga0307416_100022910 3300032002 Bacteria 4520
91 Ga0307416_100274439 3300032002 Bacteria 1658
92 Ga0307414_10201584 3300032004 Bacteria 1619
93 Ga0307411_11240478 3300032005 Bacteria 677
94 Ga0316585_10237157 3300032137 Bacteria 604
95 Ga0316580_10011200 3300032139 Bacteria 2719
96 Ga0316596_1032155 3300033541 Bacteria 1365
97 Ga0373948_0019462 3300034817 Bacteria 1284
98 Ga0373950_0022411 3300034818 Bacteria 1123
99 Ga0373951_0074040 3300035091 Bacteria 872
100 Ga0373932_0018915 3300035112 Bacteria 1788
101 Ga0373954_0109637 3300035118 Bacteria 1335
102 Ga0316574_0002448 3300035398 Bacteria 9328
103 Ga0316574_0031209 3300035398 Bacteria 3231
104 Ga0316574_0136037 3300035398 Bacteria 1582
105 Ga0316574_0444038 3300035398 Bacteria 813
106 Ga0373931_0000056 3300035691 Bacteria 56750
107 Ga0373937_0536985 3300036401 Bacteria 1111
108 Ga0316582_0020941 3300036647 Bacteria 3854
109 Ga0316584_0010187 3300036712 Bacteria 6562
110 Ga0316584_0016801 3300036712 Bacteria 5250
111 Ga0316584_0290321 3300036712 Bacteria 1186
112 Ga0436365_0647933 3300039437 Bacteria 12215
113 Ga0451793_0901215 3300041452 Unclassified 630
114 Ga0451837_1533304 3300041494 Bacteria 618
115 Ga0451853_3575927 3300041512 Unclassified 687
116 Ga0451853_3975572 3300041512 Bacteria 727
117 Ga0466965_0429857 3300044683 Unclassified 733
118 Ga0466967_0239577 3300045976 Bacteria 1730
119 Ga0495592_0273912 3300046454 Bacteria 1106
120 Ga0495603_0744613 3300046455 Bacteria 560
121 Ga0495629_0420357 3300046459 Bacteria 907
122 Ga0495653_0107340 3300046463 Bacteria 2012
123 Ga0495608_0017834 3300046511 Bacteria 4906
124 Ga0495628_0132349 3300046516 Bacteria 1907
125 Ga0495621_0030552 3300046539 Bacteria 1843
126 Ga0495667_0179070 3300046559 Bacteria 1361
127 Ga0495634_0358596 3300046642 Bacteria 872
128 Ga0495635_0893767 3300046663 Unclassified 569
129 Ga0495588_0445269 3300046674 Bacteria 680
130 Ga0495657_0263039 3300046675 Bacteria 1036
131 Ga0495657_0310469 3300046675 Bacteria 939
132 Ga0495613_0001988 3300046689 Bacteria 15516
133 Ga0495613_0120317 3300046689 Bacteria 1886
134 Ga0495672_0000470 3300047320 Bacteria 47741
135 Ga0495672_0148543 3300047320 Bacteria 1218
136 Ga0495676_0197663 3300047321 Bacteria 1399
137 Ga0495684_0411090 3300047471 Unclassified 948
138 Ga0495684_0553300 3300047471 Bacteria 783
139 Ga0495593_0434265 3300047673 Bacteria 657
140 Ga0495614_0354303 3300048089 Unclassified 684
141 Ga0496101_1011507 3300048904 Bacteria 654
142 Ga0496102_1475755 3300048905 Unclassified 599
143 Ga0496109_1260222 3300048912 Bacteria 676
144 Ga0496114_0884284 3300048917 Bacteria 774
145 Ga0501031_0012993 3300049568 Bacteria 5434
146 Ga0501031_0104645 3300049568 Unclassified 1847
147 Ga0501031_0458021 3300049568 Bacteria 824
148 Ga0501031_0671491 3300049568 Bacteria 666
149 Ga0501032_0240340 3300049569 Bacteria 1177
150 Ga0501033_0031907 3300049570 Bacteria 3954
151 Ga0501034_0000282 3300049571 Bacteria 91445
152 Ga0501034_0010130 3300049571 Bacteria 9834
153 Ga0501034_0027564 3300049571 Bacteria 5777
154 Ga0501034_0472748 3300049571 Bacteria 1169
155 Ga0501036_0182383 3300049572 Bacteria 1767
156 Ga0501036_0455368 3300049572 Bacteria 1066
157 Ga0501036_0556251 3300049572 Bacteria 953
158 Ga0501039_0218255 3300049575 Bacteria 1499
159 Ga0501039_0246071 3300049575 Bacteria 1406
160 Ga0501040_0231288 3300049576 Bacteria 1316
161 Ga0501040_0365268 3300049576 Bacteria 1035
162 Ga0501041_0230326 3300049577 Bacteria 1163
163 Ga0501042_0047187 3300049578 Bacteria 3071
164 Ga0501042_0403148 3300049578 Bacteria 991
165 Ga0501042_0604171 3300049578 Bacteria 798
166 Ga0501042_0908908 3300049578 Bacteria 641
167 Ga0501043_0585464 3300049579 Bacteria 826
168 Ga0501047_0051227 3300049581 Bacteria 3988
169 Ga0501048_0190452 3300049582 Bacteria 1453
170 Ga0501048_0526684 3300049582 Bacteria 848
171 Ga0501068_0230349 3300049584 Bacteria 1178
172 Ga0501068_0490193 3300049584 Bacteria 797
173 Ga0501068_0908422 3300049584 Bacteria 579
174 Ga0501069_0000754 3300049585 Bacteria 15112
175 Ga0501069_0572033 3300049585 Bacteria 677
176 Ga0501070_0006203 3300049586 Bacteria 10186
177 Ga0501070_1297659 3300049586 Bacteria 556
178 Ga0501071_0009541 3300049587 Bacteria 6470
179 Ga0501071_0114934 3300049587 Bacteria 1991
180 Ga0501072_0073319 3300049588 Bacteria 2707
181 Ga0501072_0266024 3300049588 Bacteria 1364
182 Ga0501072_0381451 3300049588 Unclassified 1118
183 Ga0501073_0000404 3300049589 Bacteria 29460
184 Ga0501073_0127806 3300049589 Bacteria 1762
185 Ga0501074_0114891 3300049590 Bacteria 1926
186 Ga0501074_0144668 3300049590 Bacteria 1700
187 Ga0501075_0204244 3300049591 Bacteria 1507
188 Ga0501075_0269555 3300049591 Bacteria 1297
189 Ga0501076_0056278 3300049592 Bacteria 3121
190 Ga0501076_0295425 3300049592 Bacteria 1328
191 Ga0501076_1790956 3300049592 Bacteria 503
192 Ga0501079_0149305 3300049741 Bacteria 1822
193 Ga0501079_0236208 3300049741 Bacteria 1428
194 Ga0501080_0176521 3300049742 Bacteria 1967
195 Ga0501080_0346970 3300049742 Bacteria 1341
196 Ga0501080_0393657 3300049742 Bacteria 1247
197 Ga0501081_0262228 3300049743 Bacteria 1263
198 Ga0501083_0001352 3300049744 Bacteria 16651
199 Ga0501044_0001341 3300049823 Bacteria 28925
200 Ga0501045_0039884 3300049824 Bacteria 3417
201 nmdc:mga03683_377524_c1 3300050489 Bacteria 674
202 nmdc:mga03683_92759_c1 3300050489 Unclassified 1318
203 nmdc:mga03n38_236819_c1 3300050490 Archaea 959
204 nmdc:mga00v17_353762_c1 3300050491 Bacteria 955
205 nmdc:mga00v17_50995_c1 3300050491 Bacteria 2516
206 nmdc:mga0yw44_1006203_c1 3300050492 Bacteria 564
207 nmdc:mga0yw44_1035107_c1 3300050492 Unclassified 555
208 nmdc:mga0yw44_11249_c1 3300050492 Bacteria 4609
209 nmdc:mga0yw44_5592_c1 3300050492 Bacteria 5969
210 nmdc:mga0yw44_790228_c1 3300050492 Bacteria 644
211 nmdc:mga06z11_237122_c1 3300050494 Bacteria 1070
212 nmdc:mga06z11_569618_c1 3300050494 Bacteria 688
213 nmdc:mga04h51_199686_c1 3300050495 Unclassified 785
214 nmdc:mga05p37_1578975_c1 3300050507 Unclassified 648
215 nmdc:mga05p37_761156_c1 3300050507 Bacteria 1066
216 nmdc:mga05p37_965610_c1 3300050507 Bacteria 910
217 nmdc:mga09592_186843_c1 3300050508 Bacteria 1793
218 nmdc:mga09592_97447_c1 3300050508 Bacteria 2517
219 nmdc:mga0qj67_339155_c1 3300050509 Bacteria 1216
220 nmdc:mga0qj67_4363_c1 3300050509 Bacteria 10245
221 nmdc:mga06r32_1134035_c1 3300050510 Bacteria 730
222 nmdc:mga06r32_127411_c1 3300050510 Bacteria 2515
223 nmdc:mga06r32_2263_c1 3300050510 Bacteria 17213
224 nmdc:mga08y16_110732_c1 3300050511 Bacteria 2859
225 nmdc:mga08y16_9765_c1 3300050511 Bacteria 10079
226 Ga0500635_0209124 3300053080 Bacteria 759
227 Ga0495619_0978932 3300053085 Bacteria 566
228 Ga0500566_0007438 3300053094 Bacteria 6490
229 Ga0501084_0216430 3300054114 Bacteria 1616
230 Ga0501084_0434671 3300054114 Bacteria 1109
231 Ga0501084_0791056 3300054114 Bacteria 799
232 Ga0501082_0140366 3300060353 Bacteria 2097
233 Ga0501082_0148917 3300060353 Bacteria 2033
234 Ga0501082_0187298 3300060353 Bacteria 1801
235 Ga0530510_0015815 3300061734 Bacteria 5334
236 Ga0530510_0420425 3300061734 Bacteria 1009
237 Ga0530510_0624315 3300061734 Bacteria 820
238 Ga0307410_10027081
239 Ga0070670_100412588
240 Ga0070661_100158154
241 Ga0070678_100937858
242 Ga0070678_101085764
243 Ga0070706_100706349
244 Ga0068853_101522681
245 Ga0068860_100008677
246 Ga0081455_10001515
247 Ga0081455_10012914
248 Ga0081455_10018912
249 Ga0081538_10000033
250 Ga0081538_10000913
251 Ga0081538_10051779
252 Ga0075365_10040684
253 Ga0075365_10286767
254 Ga0075365_10377024
255 Ga0075365_10991625
256 Ga0075365_10995782
257 Ga0075363_100257924
258 Ga0075363_100378496
259 Ga0075362_10300599
260 Ga0075367_10173977
261 Ga0075367_10520586
262 Ga0075367_10597917
263 Ga0075367_10647334
264 Ga0075367_10790695
265 Ga0075427_10023590
266 Ga0075428_100028954
267 Ga0075428_100307521
268 Ga0075428_100688788
269 Ga0075428_100784467
270 Ga0075430_100001405
271 Ga0075430_100010200
272 Ga0075430_100035599
273 Ga0075431_100001012
274 Ga0075431_100012975
275 Ga0075431_100347042
276 Ga0075431_100466062
277 Ga0075429_100096721
278 Ga0075429_100998600
279 Ga0111539_10000426
280 Ga0111539_10406617
281 Ga0105245_10022749
282 Ga0105245_10883924
283 Ga0114129_10225515
284 Ga0114129_10596305
285 Ga0114129_11375938
286 Ga0114129_12633346
287 Ga0105242_10117937
288 Ga0105242_10370232
289 Ga0105249_10933257
290 Ga0105239_10562259
291 Ga0157378_10328447
292 Ga0157378_10675924
293 Ga0157375_10395491
294 Ga0213876_10039959
295 Ga0207707_10877145
296 Ga0207687_10218319
297 Ga0207686_10108398
298 Ga0207670_11021931
299 Ga0207689_11003978
300 Ga0207651_11071881
301 Ga0207683_10183208
302 Ga0209813_10101300
303 Ga0209813_10173338
304 Ga0207428_10028281
305 Ga0268266_10377221
306 Ga0268265_11418219
307 Ga0307408_100507563
308 Ga0316579_10171587
309 Ga0316576_10003509
310 Ga0316576_10100774
311 Ga0316578_10003491
312 Ga0316578_10021537
313 Ga0307405_10171081
314 Ga0316577_10036956
315 Ga0316577_10170295
316 Ga0316577_10237620
317 Ga0307413_10278523
318 Ga0307413_10427663
319 Ga0307413_10455940
320 Ga0307413_10926106
321 Ga0307410_10511617
322 Ga0307406_10312788
323 Ga0307407_10102202
324 Ga0307407_10263014
325 Ga0307412_10723329
326 Ga0307409_100009715
327 Ga0307416_100022910
328 Ga0307416_100274439
329 Ga0307414_10201584
330 Ga0307411_11240478
331 Ga0316585_10237157
332 Ga0316580_10011200
333 Ga0316596_1032155
334 Ga0373948_0019462
335 Ga0373950_0022411
336 Ga0373951_0074040
337 Ga0373932_0018915
338 Ga0373954_0109637
339 Ga0316574_0002448
340 Ga0316574_0031209
341 Ga0316574_0136037
342 Ga0316574_0444038
343 Ga0373931_0000056
344 Ga0373937_0536985
345 Ga0316582_0020941
346 Ga0316584_0010187
347 Ga0316584_0016801
348 Ga0316584_0290321
349 Ga0436365_0647933
350 Ga0451793_0901215
351 Ga0451837_1533304
352 Ga0451853_3575927
353 Ga0451853_3975572
354 Ga0466965_0429857
355 Ga0466967_0239577
356 Ga0495592_0273912
357 Ga0495603_0744613
358 Ga0495629_0420357
359 Ga0495653_0107340
360 Ga0495608_0017834
361 Ga0495628_0132349
362 Ga0495621_0030552
363 Ga0495667_0179070
364 Ga0495634_0358596
365 Ga0495635_0893767
366 Ga0495588_0445269
367 Ga0495657_0263039
368 Ga0495657_0310469
369 Ga0495613_0001988
370 Ga0495613_0120317
371 Ga0495672_0000470
372 Ga0495672_0148543
373 Ga0495676_0197663
374 Ga0495684_0411090
375 Ga0495684_0553300
376 Ga0495593_0434265
377 Ga0495614_0354303
378 Ga0496101_1011507
379 Ga0496102_1475755
380 Ga0496109_1260222
381 Ga0496114_0884284
382 Ga0501031_0012993
383 Ga0501031_0104645
384 Ga0501031_0458021
385 Ga0501031_0671491
386 Ga0501032_0240340
387 Ga0501033_0031907
388 Ga0501034_0000282
389 Ga0501034_0010130
390 Ga0501034_0027564
391 Ga0501034_0472748
392 Ga0501036_0182383
393 Ga0501036_0455368
394 Ga0501036_0556251
395 Ga0501039_0218255
396 Ga0501039_0246071
397 Ga0501040_0231288
398 Ga0501040_0365268
399 Ga0501041_0230326
400 Ga0501042_0047187
401 Ga0501042_0403148
402 Ga0501042_0604171
403 Ga0501042_0908908
404 Ga0501043_0585464
405 Ga0501047_0051227
406 Ga0501048_0190452
407 Ga0501048_0526684
408 Ga0501068_0230349
409 Ga0501068_0490193
410 Ga0501068_0908422
411 Ga0501069_0000754
412 Ga0501069_0572033
413 Ga0501070_0006203
414 Ga0501070_1297659
415 Ga0501071_0009541
416 Ga0501071_0114934
417 Ga0501072_0073319
418 Ga0501072_0266024
419 Ga0501072_0381451
420 Ga0501073_0000404
421 Ga0501073_0127806
422 Ga0501074_0114891
423 Ga0501074_0144668
424 Ga0501075_0204244
425 Ga0501075_0269555
426 Ga0501076_0056278
427 Ga0501076_0295425
428 Ga0501076_1790956
429 Ga0501079_0149305
430 Ga0501079_0236208
431 Ga0501080_0176521
432 Ga0501080_0346970
433 Ga0501080_0393657
434 Ga0501081_0262228
435 Ga0501083_0001352
436 Ga0501044_0001341
437 Ga0501045_0039884
438 nmdc:mga03683_377524_c1
439 nmdc:mga03683_92759_c1
440 nmdc:mga03n38_236819_c1
441 nmdc:mga00v17_353762_c1
442 nmdc:mga00v17_50995_c1
443 nmdc:mga0yw44_1006203_c1
444 nmdc:mga0yw44_1035107_c1
445 nmdc:mga0yw44_11249_c1
446 nmdc:mga0yw44_5592_c1
447 nmdc:mga0yw44_790228_c1
448 nmdc:mga06z11_237122_c1
449 nmdc:mga06z11_569618_c1
450 nmdc:mga04h51_199686_c1
451 nmdc:mga05p37_1578975_c1
452 nmdc:mga05p37_761156_c1
453 nmdc:mga05p37_965610_c1
454 nmdc:mga09592_186843_c1
455 nmdc:mga09592_97447_c1
456 nmdc:mga0qj67_339155_c1
457 nmdc:mga0qj67_4363_c1
458 nmdc:mga06r32_1134035_c1
459 nmdc:mga06r32_127411_c1
460 nmdc:mga06r32_2263_c1
461 nmdc:mga08y16_110732_c1
462 nmdc:mga08y16_9765_c1
463 Ga0500635_0209124
464 Ga0495619_0978932
465 Ga0500566_0007438
466 Ga0501084_0216430
467 Ga0501084_0434671
468 Ga0501084_0791056
469 Ga0501082_0140366
470 Ga0501082_0148917
471 Ga0501082_0187298
472 Ga0530510_0015815
473 Ga0530510_0420425
474 Ga0530510_0624315

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10722

YbjN

Putative bacterial sensory transduction regulator

33

160

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1k3s-assembly1.cif.gz_B type iii secretion chaperone sige 0.8063 59 141
2bsh-assembly1.cif.gz_A crystal structure of the type iii secretion chaperone syct from yersinia enterocolitica (crystal form 2) 0.7424 16 146
2plg-assembly1.cif.gz_A crystal structure of t110839 protein from synechococcus elongatus 0.7414 5 147
4akx-assembly1.cif.gz_A structure of the heterodimeric complex exou-spcu from the type iii secretion system (t3ss) of pseudomonas aeruginosa 0.7346 20 145
1xkp-assembly1.cif.gz_C crystal structure of the virulence factor yopn in complex with its heterodimeric chaperone sycn-yscb 0.7306 48 145
ID Description Score Start End Superfamily
af_P9WKU9_42_143_3.30.1460.10 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.9767 59 154 3.30.1460.10
af_P9WKU9_42_143_3.30.1460.10 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.9114 59 154 3.30.1460.10
1k3sB00 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.7876 59 141 3.30.1460.10
af_Q4DSF1_306_445_3.30.1460.10 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.7514 48 147 3.30.1460.10
af_Q9W466_37_196_3.40.1000.30 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A; 0.7498 46 75 3.40.1000.30
ID Description Score Start End GO Terms
AF-A0A7W0LT99-F1-model_v4 YbjN domain-containing protein 0.9877 5 155
AF-A0A6B1E9Y6-F1-model_v4 YbjN domain-containing protein 0.9844 7 156
AF-A0A7K0JZD5-F1-model_v4 deleted 0.9832 42 155
AF-A0A388NVT6-F1-model_v4 YbjN domain-containing protein 0.983 9 152
AF-A0A3D0HHI4-F1-model_v4 YbjN domain-containing protein 0.9817 9 152

Map