F350064

General Info

Members Datasets Scaffolds Average Seq Length
237 162 237 102

Family's Representative Sequence

Representative Sequence 3300025915|Ga0207693_10968971|Ga0207693_109689711
Length 116
Sequence MVANHCTVRLNELESFAMLRGGKNETIVVSALSAGANLGRLLRRVEDERRSLVIEKRGTPKAVLLSIRDYVRLAAPEPEVLRLIGEESKRKGTNKLTSRQIDQVIKAARAQKAKRG

Samples

Sample ID Description Type Environment
1 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
44 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
61 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
62 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
63 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
93 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
94 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
97 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
100 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
101 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
102 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
103 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
104 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
105 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
106 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
107 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
108 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
109 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
110 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
111 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
112 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
113 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
115 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
116 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
117 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
118 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
119 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
120 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
121 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
122 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
123 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
124 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
125 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
130 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
131 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
132 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
133 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
134 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
135 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
136 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
137 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
140 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
143 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
144 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
145 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
146 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
147 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
148 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
149 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
150 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
151 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
152 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
155 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
160 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
161 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
162 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.05
Metatranscriptomes 2.95
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.84
Nodule 0
Rhizoplane 1.27
Rhizosphere 96.62
Stem 0
Stem Tuber 0
Unclassified 1.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1019683 3300003214 Unclassified 888
2 Ga0058862_11430525 3300004803 Unclassified 880
3 Ga0070658_10011240 3300005327 Bacteria 7176
4 Ga0070683_100134695 3300005329 Unclassified 2339
5 Ga0070683_100695221 3300005329 Unclassified 974
6 Ga0068868_100010102 3300005338 Bacteria 6819
7 Ga0070659_100240418 3300005366 Bacteria 1498
8 Ga0070714_100266597 3300005435 Bacteria 1587
9 Ga0070713_100156245 3300005436 Bacteria 2033
10 Ga0070710_10074902 3300005437 Bacteria 1960
11 Ga0070708_100000935 3300005445 Bacteria 22108
12 Ga0070708_100001412 3300005445 Bacteria 18343
13 Ga0070708_100125661 3300005445 Bacteria 2370
14 Ga0070708_100264723 3300005445 Bacteria 1616
15 Ga0070708_100274685 3300005445 Unclassified 1585
16 Ga0070708_100648238 3300005445 Bacteria 995
17 Ga0070663_100364296 3300005455 Bacteria 1173
18 Ga0070678_101062394 3300005456 Unclassified 746
19 Ga0070706_100010946 3300005467 Bacteria 8423
20 Ga0070706_100265492 3300005467 Bacteria 1602
21 Ga0070706_101362470 3300005467 Unclassified 650
22 Ga0070707_100042212 3300005468 Bacteria 4366
23 Ga0070707_100093948 3300005468 Bacteria 2904
24 Ga0070707_100314961 3300005468 Bacteria 1521
25 Ga0070707_100974116 3300005468 Bacteria 813
26 Ga0070698_100537297 3300005471 Unclassified 1108
27 Ga0070699_100025648 3300005518 Bacteria 5081
28 Ga0070679_100002943 3300005530 Bacteria 15512
29 Ga0070679_100289545 3300005530 Bacteria 1589
30 Ga0070684_100018628 3300005535 Bacteria 5725
31 Ga0070684_100034336 3300005535 Bacteria 4337
32 Ga0070697_100000767 3300005536 Bacteria 24006
33 Ga0070697_100341211 3300005536 Bacteria 1293
34 Ga0068853_100283101 3300005539 Unclassified 1529
35 Ga0070693_100006449 3300005547 Bacteria 5691
36 Ga0068855_100041571 3300005563 Bacteria 5448
37 Ga0068855_100065750 3300005563 Bacteria 4228
38 Ga0070664_100123703 3300005564 Bacteria 2267
39 Ga0068857_100079875 3300005577 Bacteria 2920
40 Ga0068857_100162460 3300005577 Bacteria 2027
41 Ga0068854_100172641 3300005578 Unclassified 1683
42 Ga0068856_100002665 3300005614 Bacteria 18308
43 Ga0070702_100079651 3300005615 Bacteria 1958
44 Ga0068852_100011394 3300005616 Bacteria 6692
45 Ga0068859_100493839 3300005617 Unclassified 1319
46 Ga0068864_100024292 3300005618 Bacteria 5098
47 Ga0068866_10150438 3300005718 Unclassified 1347
48 Ga0068863_100011791 3300005841 Bacteria 8448
49 Ga0068863_100068981 3300005841 Bacteria 3344
50 Ga0068858_100249914 3300005842 Unclassified 1684
51 Ga0068860_102489103 3300005843 Unclassified 537
52 Ga0070717_10011520 3300006028 Bacteria 6718
53 Ga0070717_10144765 3300006028 Bacteria 2052
54 Ga0070717_10185822 3300006028 Bacteria 1814
55 Ga0070717_10271125 3300006028 Bacteria 1503
56 Ga0070716_100216728 3300006173 Unclassified 1283
57 Ga0070716_100367142 3300006173 Unclassified 1024
58 Ga0070716_100505050 3300006173 Bacteria 893
59 Ga0070716_100560762 3300006173 Bacteria 853
60 Ga0070712_100214088 3300006175 Unclassified 1521
61 Ga0070712_101556888 3300006175 Unclassified 578
62 Ga0097621_100023680 3300006237 Bacteria 4783
63 Ga0068871_100000867 3300006358 Bacteria 20118
64 Ga0068871_101329238 3300006358 Unclassified 676
65 Ga0068871_102019549 3300006358 Unclassified 549
66 Ga0068865_100007966 3300006881 Bacteria 6540
67 Ga0075436_100143877 3300006914 Bacteria 1676
68 Ga0097620_100493843 3300006931 Unclassified 1319
69 Ga0099794_10050261 3300007265 Bacteria 2005
70 Ga0099794_10308146 3300007265 Unclassified 820
71 Ga0099794_10486445 3300007265 Unclassified 649
72 Ga0099794_10673500 3300007265 Unclassified 550
73 Ga0099795_10595479 3300007788 Unclassified 526
74 Ga0105240_10002544 3300009093 Bacteria 29242
75 Ga0105240_10040004 3300009093 Bacteria 6002
76 Ga0105240_10052013 3300009093 Bacteria 5151
77 Ga0114129_10799677 3300009147 Bacteria 1203
78 Ga0114129_12181707 3300009147 Unclassified 667
79 Ga0105248_10002654 3300009177 Bacteria 19851
80 Ga0105237_11018201 3300009545 Unclassified 835
81 Ga0105237_11182083 3300009545 Unclassified 771
82 Ga0105238_10125999 3300009551 Bacteria 2539
83 Ga0105239_10404182 3300010375 Bacteria 1546
84 Ga0105239_10436288 3300010375 Bacteria 1485
85 Ga0157371_10139811 3300013102 Unclassified 1725
86 Ga0157370_10148507 3300013104 Unclassified 2182
87 Ga0157369_10555554 3300013105 Bacteria 1186
88 Ga0157374_10001728 3300013296 Bacteria 18314
89 Ga0157378_10000432 3300013297 Bacteria 40837
90 Ga0157372_10008378 3300013307 Bacteria 10988
91 Ga0163163_10755692 3300014325 Unclassified 1036
92 Ga0163163_12612758 3300014325 Unclassified 562
93 Ga0157376_10003880 3300014969 Bacteria 10339
94 Ga0157376_13108319 3300014969 Bacteria 503
95 Ga0224712_10066370 3300022467 Bacteria 1453
96 Ga0224569_101353 3300022732 Bacteria 2061
97 Ga0224571_104817 3300022734 Unclassified 880
98 Ga0209233_1030587 3300025261 Unclassified 1267
99 Ga0207692_11004874 3300025898 Bacteria 551
100 Ga0207647_10404305 3300025904 Unclassified 769
101 Ga0207705_10001676 3300025909 Bacteria 17636
102 Ga0207684_10022139 3300025910 Bacteria 5427
103 Ga0207684_10215130 3300025910 Bacteria 1658
104 Ga0207684_11132311 3300025910 Unclassified 650
105 Ga0207707_10219827 3300025912 Unclassified 1654
106 Ga0207707_10385796 3300025912 Unclassified 1204
107 Ga0207695_10018387 3300025913 Bacteria 8083
108 Ga0207695_10081086 3300025913 Bacteria 3285
109 Ga0207695_10811814 3300025913 Unclassified 815
110 Ga0207695_11237777 3300025913 Unclassified 627
111 Ga0207671_10755021 3300025914 Unclassified 772
112 Ga0207693_10879818 3300025915 Bacteria 688
113 Ga0207693_10968971 3300025915 Unclassified 650
114 Ga0207660_11553606 3300025917 Bacteria 534
115 Ga0207652_10006054 3300025921 Bacteria 9790
116 Ga0207652_10809850 3300025921 Unclassified 831
117 Ga0207646_10697874 3300025922 Unclassified 907
118 Ga0207646_11126019 3300025922 Bacteria 690
119 Ga0207694_10184683 3300025924 Bacteria 1692
120 Ga0207700_10126828 3300025928 Bacteria 2078
121 Ga0207700_11060030 3300025928 Unclassified 725
122 Ga0207664_10237310 3300025929 Bacteria 1587
123 Ga0207704_10112341 3300025938 Unclassified 1845
124 Ga0207665_10189118 3300025939 Unclassified 1495
125 Ga0207665_10332846 3300025939 Unclassified 1142
126 Ga0207711_10016208 3300025941 Bacteria 6187
127 Ga0207661_10446785 3300025944 Unclassified 1177
128 Ga0207661_10569855 3300025944 Unclassified 1038
129 Ga0207679_10524737 3300025945 Unclassified 1059
130 Ga0207667_10025371 3300025949 Bacteria 6488
131 Ga0207667_10082470 3300025949 Bacteria 3331
132 Ga0207667_11472283 3300025949 Bacteria 653
133 Ga0207677_10001597 3300026023 Bacteria 12026
134 Ga0207703_10063681 3300026035 Bacteria 3024
135 Ga0207639_10017900 3300026041 Bacteria 5026
136 Ga0207678_10221297 3300026067 Unclassified 1620
137 Ga0207702_10003391 3300026078 Bacteria 14594
138 Ga0207641_10026058 3300026088 Bacteria 4824
139 Ga0207641_10037574 3300026088 Unclassified 4045
140 Ga0207676_10028846 3300026095 Bacteria 4150
141 Ga0207674_10193087 3300026116 Bacteria 1986
142 Ga0207674_10394257 3300026116 Bacteria 1338
143 Ga0207683_11546480 3300026121 Unclassified 612
144 Ga0265357_1005304 3300028023 Unclassified 1189
145 Ga0265318_10141833 3300028577 Bacteria 882
146 Ga0265336_10015433 3300028666 Unclassified 2513
147 Ga0265336_10086730 3300028666 Unclassified 933
148 Ga0265338_10007162 3300028800 Bacteria 13965
149 Ga0265338_10050875 3300028800 Bacteria 3739
150 Ga0265338_11123673 3300028800 Unclassified 529
151 Ga0265324_10151113 3300029957 Bacteria 788
152 Ga0265770_1022530 3300030878 Unclassified 1008
153 Ga0265760_10006901 3300031090 Bacteria 3256
154 Ga0265760_10009671 3300031090 Bacteria 2754
155 Ga0265760_10114477 3300031090 Bacteria 861
156 Ga0265760_10182747 3300031090 Unclassified 701
157 Ga0265332_10049231 3300031238 Bacteria 1812
158 Ga0265320_10003897 3300031240 Bacteria 9867
159 Ga0265325_10065555 3300031241 Bacteria 1834
160 Ga0265329_10018504 3300031242 Bacteria 2381
161 Ga0265340_10009352 3300031247 Bacteria 5264
162 Ga0265340_10016737 3300031247 Bacteria 3794
163 Ga0265339_10035113 3300031249 Bacteria 2815
164 Ga0265339_10183867 3300031249 Unclassified 1039
165 Ga0265331_10018342 3300031250 Bacteria 3632
166 Ga0265331_10194905 3300031250 Unclassified 913
167 Ga0265316_10002102 3300031344 Bacteria 20948
168 Ga0265316_10010314 3300031344 Bacteria 8522
169 Ga0265314_10071430 3300031711 Bacteria 2322
170 Ga0265314_10141426 3300031711 Unclassified 1487
171 Ga0265342_10084306 3300031712 Bacteria 1830
172 Ga0265342_10198918 3300031712 Unclassified 1090
173 Ga0316212_1016856 3300033547 Bacteria 1028
174 Ga0373926_0019732 3300035083 Bacteria 2325
175 Ga0373934_0019422 3300035086 Bacteria 2608
176 Ga0373944_0062125 3300035089 Bacteria 1200
177 Ga0373923_0050380 3300035111 Bacteria 1744
178 Ga0373936_0069093 3300035113 Bacteria 1453
179 Ga0373945_0020342 3300035116 Bacteria 2270
180 Ga0373945_0473259 3300035116 Unclassified 556
181 Ga0373953_0069901 3300035117 Bacteria 1447
182 Ga0373953_0490592 3300035117 Unclassified 544
183 Ga0373954_0110027 3300035118 Bacteria 1332
184 Ga0373957_0073811 3300035120 Bacteria 1338
185 Ga0373943_0001662 3300035170 Bacteria 10101
186 Ga0373946_0004919 3300035171 Bacteria 4812
187 Ga0373955_0071479 3300035172 Bacteria 1941
188 Ga0373924_0010899 3300035410 Bacteria 3365
189 Ga0373935_0003648 3300035692 Bacteria 8968
190 Ga0373927_0000902 3300035695 Bacteria 22599
191 Ga0373927_0875785 3300035695 Unclassified 593
192 Ga0373933_0073873 3300035724 Bacteria 2078
193 Ga0373947_0000537 3300035725 Bacteria 22189
194 Ga0373937_0033547 3300036401 Bacteria 4663
195 Ga0373937_0101543 3300036401 Unclassified 2670
196 Ga0373937_1031830 3300036401 Unclassified 771
197 Ga0373925_0005764 3300037068 Bacteria 9206
198 Ga0373925_0537211 3300037068 Unclassified 961
199 Ga0436364_0737333 3300037853 Bacteria 47273
200 Ga0436360_0743451 3300039438 Unclassified 673
201 Ga0436360_0879924 3300039438 Bacteria 5050
202 Ga0436362_0897636 3300039453 Bacteria 1428
203 Ga0451577_0039153 3300042876 Unclassified 4261
204 Ga0466969_0531965 3300044656 Unclassified 537
205 Ga0453683_0001681 3300044673 Bacteria 18448
206 Ga0466966_0713705 3300044684 Unclassified 604
207 Ga0466961_0144449 3300044693 Bacteria 1488
208 Ga0453684_0056532 3300044712 Bacteria 5089
209 Ga0466967_2180987 3300045976 Unclassified 550
210 Ga0495603_0719126 3300046455 Unclassified 571
211 Ga0495653_0088121 3300046463 Bacteria 2278
212 Ga0495580_0004544 3300046472 Bacteria 11653
213 Ga0495580_0212974 3300046472 Unclassified 1329
214 Ga0495580_0368253 3300046472 Bacteria 972
215 Ga0495580_0617849 3300046472 Unclassified 715
216 Ga0495639_0065055 3300046475 Bacteria 1677
217 Ga0495662_0107140 3300046476 Unclassified 1369
218 Ga0495664_0048270 3300046477 Bacteria 2527
219 Ga0495608_0347708 3300046511 Unclassified 913
220 Ga0495608_0481035 3300046511 Bacteria 753
221 Ga0495630_0331165 3300046517 Unclassified 1164
222 Ga0495645_0150279 3300046543 Bacteria 1619
223 Ga0495667_0703193 3300046559 Unclassified 626
224 Ga0495657_0248939 3300046675 Unclassified 1070
225 Ga0495658_0819507 3300046683 Unclassified 596
226 Ga0495624_0257282 3300046690 Bacteria 1055
227 Ga0495581_0522171 3300047315 Unclassified 690
228 Ga0495674_0009830 3300047319 Bacteria 9079
229 Ga0495593_0704686 3300047673 Unclassified 507
230 Ga0495602_0270894 3300048088 Bacteria 1255
231 Ga0496104_0120591 3300048907 Bacteria 2518
232 Ga0496111_0044576 3300048914 Bacteria 3188
233 Ga0496113_1400741 3300048916 Unclassified 541
234 Ga0496126_0670460 3300048929 Unclassified 809
235 Ga0501048_1186906 3300049582 Unclassified 549
236 nmdc:mga0rr50_1025104_c1 3300050513 Bacteria 703
237 Ga0530510_1315426 3300061734 Unclassified 554

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005445 Ga0070708_100274685 Ga0070708_1002746852 91
2 3300005468 Ga0070707_100314961 Ga0070707_1003149611 91
3 3300006173 Ga0070716_100560762 Ga0070716_1005607621 91
4 3300006914 Ga0075436_100143877 Ga0075436_1001438772 91
5 3300007788 Ga0099795_10595479 Ga0099795_105954792 91
6 3300009147 Ga0114129_10799677 Ga0114129_107996772 91
7 3300006028 Ga0070717_10271125 Ga0070717_102711252 93
8 3300004803 Ga0058862_11430525 Ga0058862_114305251 95
9 3300005468 Ga0070707_100974116 Ga0070707_1009741162 95
10 3300006173 Ga0070716_100367142 Ga0070716_1003671421 95
11 3300006175 Ga0070712_101556888 Ga0070712_1015568881 95
12 3300025915 Ga0207693_10879818 Ga0207693_108798182 95
13 3300031090 Ga0265760_10006901 Ga0265760_100069013 96
14 3300031247 Ga0265340_10016737 Ga0265340_100167374 96
15 3300031249 Ga0265339_10035113 Ga0265339_100351132 96
16 3300031250 Ga0265331_10194905 Ga0265331_101949052 96
17 3300031711 Ga0265314_10071430 Ga0265314_100714302 96
18 3300031711 Ga0265314_10141426 Ga0265314_101414262 96
19 3300005329 Ga0070683_100695221 Ga0070683_1006952213 97
20 3300005445 Ga0070708_100001412 Ga0070708_1000014124 97
21 3300005467 Ga0070706_101362470 Ga0070706_1013624701 97
22 3300005518 Ga0070699_100025648 Ga0070699_1000256484 97
23 3300005535 Ga0070684_100034336 Ga0070684_1000343364 97
24 3300006028 Ga0070717_10011520 Ga0070717_100115205 97
25 3300006175 Ga0070712_100214088 Ga0070712_1002140882 97
26 3300006358 Ga0068871_102019549 Ga0068871_1020195492 97
27 3300009093 Ga0105240_10002544 Ga0105240_1000254422 97
28 3300009545 Ga0105237_11018201 Ga0105237_110182012 97
29 3300009551 Ga0105238_10125999 Ga0105238_101259993 97
30 3300013105 Ga0157369_10555554 Ga0157369_105555541 97
31 3300014969 Ga0157376_13108319 Ga0157376_131083191 97
32 3300022467 Ga0224712_10066370 Ga0224712_100663702 97
33 3300025910 Ga0207684_11132311 Ga0207684_111323111 97
34 3300025913 Ga0207695_10018387 Ga0207695_100183877 97
35 3300025924 Ga0207694_10184683 Ga0207694_101846832 97
36 3300025944 Ga0207661_10569855 Ga0207661_105698552 97
37 3300044656 Ga0466969_0531965 Ga0466969_0531965_115_408 97
38 3300044684 Ga0466966_0713705 Ga0466966_0713705_195_488 97
39 3300044693 Ga0466961_0144449 Ga0466961_0144449_59_352 97
40 3300005327 Ga0070658_10011240 Ga0070658_100112403 98
41 3300005329 Ga0070683_100134695 Ga0070683_1001346954 98
42 3300005338 Ga0068868_100010102 Ga0068868_1000101026 98
43 3300005366 Ga0070659_100240418 Ga0070659_1002404182 98
44 3300005435 Ga0070714_100266597 Ga0070714_1002665971 98
45 3300005436 Ga0070713_100156245 Ga0070713_1001562453 98
46 3300005437 Ga0070710_10074902 Ga0070710_100749022 98
47 3300005445 Ga0070708_100000935 Ga0070708_1000009359 98
48 3300005445 Ga0070708_100125661 Ga0070708_1001256615 98
49 3300005445 Ga0070708_100264723 Ga0070708_1002647231 98
50 3300005445 Ga0070708_100648238 Ga0070708_1006482382 98
51 3300005455 Ga0070663_100364296 Ga0070663_1003642961 98
52 3300005456 Ga0070678_101062394 Ga0070678_1010623941 98
53 3300005467 Ga0070706_100010946 Ga0070706_1000109469 98
54 3300005467 Ga0070706_100265492 Ga0070706_1002654922 98
55 3300005468 Ga0070707_100042212 Ga0070707_1000422125 98
56 3300005468 Ga0070707_100093948 Ga0070707_1000939482 98
57 3300005471 Ga0070698_100537297 Ga0070698_1005372972 98
58 3300005530 Ga0070679_100289545 Ga0070679_1002895454 98
59 3300005535 Ga0070684_100018628 Ga0070684_1000186287 98
60 3300005536 Ga0070697_100000767 Ga0070697_10000076721 98
61 3300005536 Ga0070697_100341211 Ga0070697_1003412112 98
62 3300005539 Ga0068853_100283101 Ga0068853_1002831013 98
63 3300005547 Ga0070693_100006449 Ga0070693_1000064496 98
64 3300005563 Ga0068855_100041571 Ga0068855_1000415715 98
65 3300005563 Ga0068855_100065750 Ga0068855_1000657503 98
66 3300005564 Ga0070664_100123703 Ga0070664_1001237033 98
67 3300005577 Ga0068857_100079875 Ga0068857_1000798753 98
68 3300005577 Ga0068857_100162460 Ga0068857_1001624602 98
69 3300005578 Ga0068854_100172641 Ga0068854_1001726413 98
70 3300005614 Ga0068856_100002665 Ga0068856_10000266522 98
71 3300005615 Ga0070702_100079651 Ga0070702_1000796512 98
72 3300005616 Ga0068852_100011394 Ga0068852_10001139410 98
73 3300005617 Ga0068859_100493839 Ga0068859_1004938393 98
74 3300005618 Ga0068864_100024292 Ga0068864_1000242925 98
75 3300005718 Ga0068866_10150438 Ga0068866_101504382 98
76 3300005841 Ga0068863_100011791 Ga0068863_1000117917 98
77 3300005841 Ga0068863_100068981 Ga0068863_1000689815 98
78 3300005842 Ga0068858_100249914 Ga0068858_1002499144 98
79 3300005843 Ga0068860_102489103 Ga0068860_1024891031 98
80 3300006028 Ga0070717_10144765 Ga0070717_101447653 98
81 3300006028 Ga0070717_10185822 Ga0070717_101858222 98
82 3300006173 Ga0070716_100216728 Ga0070716_1002167282 98
83 3300006173 Ga0070716_100505050 Ga0070716_1005050501 98
84 3300006237 Ga0097621_100023680 Ga0097621_1000236805 98
85 3300006358 Ga0068871_100000867 Ga0068871_1000008678 98
86 3300006358 Ga0068871_101329238 Ga0068871_1013292382 98
87 3300006881 Ga0068865_100007966 Ga0068865_10000796610 98
88 3300006931 Ga0097620_100493843 Ga0097620_1004938433 98
89 3300007265 Ga0099794_10050261 Ga0099794_100502612 98
90 3300007265 Ga0099794_10308146 Ga0099794_103081462 98
91 3300007265 Ga0099794_10486445 Ga0099794_104864452 98
92 3300007265 Ga0099794_10673500 Ga0099794_106735001 98
93 3300009093 Ga0105240_10040004 Ga0105240_100400048 98
94 3300009093 Ga0105240_10052013 Ga0105240_100520132 98
95 3300009147 Ga0114129_12181707 Ga0114129_121817071 98
96 3300009177 Ga0105248_10002654 Ga0105248_100026546 98
97 3300009545 Ga0105237_11182083 Ga0105237_111820831 98
98 3300010375 Ga0105239_10404182 Ga0105239_104041823 98
99 3300010375 Ga0105239_10436288 Ga0105239_104362882 98
100 3300013102 Ga0157371_10139811 Ga0157371_101398112 98
101 3300013104 Ga0157370_10148507 Ga0157370_101485072 98
102 3300013296 Ga0157374_10001728 Ga0157374_1000172820 98
103 3300013297 Ga0157378_10000432 Ga0157378_1000043220 98
104 3300013307 Ga0157372_10008378 Ga0157372_100083787 98
105 3300014325 Ga0163163_10755692 Ga0163163_107556922 98
106 3300014325 Ga0163163_12612758 Ga0163163_126127581 98
107 3300014969 Ga0157376_10003880 Ga0157376_100038807 98
108 3300022732 Ga0224569_101353 Ga0224569_1013532 98
109 3300022734 Ga0224571_104817 Ga0224571_1048172 98
110 3300025898 Ga0207692_11004874 Ga0207692_110048742 98
111 3300025904 Ga0207647_10404305 Ga0207647_104043052 98
112 3300025909 Ga0207705_10001676 Ga0207705_100016763 98
113 3300025910 Ga0207684_10022139 Ga0207684_100221394 98
114 3300025910 Ga0207684_10215130 Ga0207684_102151302 98
115 3300025912 Ga0207707_10219827 Ga0207707_102198271 98
116 3300025913 Ga0207695_10081086 Ga0207695_100810864 98
117 3300025913 Ga0207695_11237777 Ga0207695_112377772 98
118 3300025914 Ga0207671_10755021 Ga0207671_107550211 98
119 3300025915 Ga0207693_10968971 Ga0207693_109689711 98
120 3300025921 Ga0207652_10809850 Ga0207652_108098502 98
121 3300025922 Ga0207646_10697874 Ga0207646_106978742 98
122 3300025922 Ga0207646_11126019 Ga0207646_111260192 98
123 3300025928 Ga0207700_10126828 Ga0207700_101268282 98
124 3300025928 Ga0207700_11060030 Ga0207700_110600301 98
125 3300025929 Ga0207664_10237310 Ga0207664_102373103 98
126 3300025938 Ga0207704_10112341 Ga0207704_101123413 98
127 3300025939 Ga0207665_10189118 Ga0207665_101891182 98
128 3300025939 Ga0207665_10332846 Ga0207665_103328461 98
129 3300025941 Ga0207711_10016208 Ga0207711_100162089 98
130 3300025944 Ga0207661_10446785 Ga0207661_104467851 98
131 3300025945 Ga0207679_10524737 Ga0207679_105247372 98
132 3300025949 Ga0207667_10025371 Ga0207667_100253715 98
133 3300025949 Ga0207667_10082470 Ga0207667_100824703 98
134 3300025949 Ga0207667_11472283 Ga0207667_114722832 98
135 3300026023 Ga0207677_10001597 Ga0207677_1000159715 98
136 3300026035 Ga0207703_10063681 Ga0207703_100636815 98
137 3300026041 Ga0207639_10017900 Ga0207639_100179007 98
138 3300026067 Ga0207678_10221297 Ga0207678_102212971 98
139 3300026078 Ga0207702_10003391 Ga0207702_100033917 98
140 3300026088 Ga0207641_10026058 Ga0207641_100260586 98
141 3300026088 Ga0207641_10037574 Ga0207641_100375744 98
142 3300026095 Ga0207676_10028846 Ga0207676_100288465 98
143 3300026116 Ga0207674_10193087 Ga0207674_101930873 98
144 3300026116 Ga0207674_10394257 Ga0207674_103942573 98
145 3300026121 Ga0207683_11546480 Ga0207683_115464802 98
146 3300028023 Ga0265357_1005304 Ga0265357_10053041 98
147 3300028577 Ga0265318_10141833 Ga0265318_101418332 98
148 3300028666 Ga0265336_10015433 Ga0265336_100154333 98
149 3300028666 Ga0265336_10086730 Ga0265336_100867302 98
150 3300028800 Ga0265338_10007162 Ga0265338_100071626 98
151 3300028800 Ga0265338_10050875 Ga0265338_100508752 98
152 3300028800 Ga0265338_11123673 Ga0265338_111236732 98
153 3300029957 Ga0265324_10151113 Ga0265324_101511132 98
154 3300030878 Ga0265770_1022530 Ga0265770_10225301 98
155 3300031090 Ga0265760_10009671 Ga0265760_100096712 98
156 3300031090 Ga0265760_10114477 Ga0265760_101144772 98
157 3300031090 Ga0265760_10182747 Ga0265760_101827471 98
158 3300031238 Ga0265332_10049231 Ga0265332_100492313 98
159 3300031240 Ga0265320_10003897 Ga0265320_100038972 98
160 3300031241 Ga0265325_10065555 Ga0265325_100655553 98
161 3300031242 Ga0265329_10018504 Ga0265329_100185043 98
162 3300031247 Ga0265340_10009352 Ga0265340_100093524 98
163 3300031249 Ga0265339_10183867 Ga0265339_101838672 98
164 3300031250 Ga0265331_10018342 Ga0265331_100183422 98
165 3300031344 Ga0265316_10002102 Ga0265316_100021021 98
166 3300031344 Ga0265316_10010314 Ga0265316_100103143 98
167 3300031712 Ga0265342_10084306 Ga0265342_100843063 98
168 3300031712 Ga0265342_10198918 Ga0265342_101989183 98
169 3300033547 Ga0316212_1016856 Ga0316212_10168562 98
170 3300035116 Ga0373945_0473259 Ga0373945_0473259_162_461 98
171 3300035117 Ga0373953_0490592 Ga0373953_0490592_215_514 98
172 3300035695 Ga0373927_0875785 Ga0373927_0875785_173_472 98
173 3300036401 Ga0373937_1031830 Ga0373937_1031830_335_631 98
174 3300037853 Ga0436364_0737333 Ga0436364_0737333_46410_46757 98
175 3300039438 Ga0436360_0743451 Ga0436360_0743451_209_607 98
176 3300039438 Ga0436360_0879924 Ga0436360_0879924_2066_2368 98
177 3300039453 Ga0436362_0897636 Ga0436362_0897636_630_932 98
178 3300042876 Ga0451577_0039153 Ga0451577_0039153_101_397 98
179 3300044673 Ga0453683_0001681 Ga0453683_0001681_1377_1673 98
180 3300044712 Ga0453684_0056532 Ga0453684_0056532_4729_5025 98
181 3300045976 Ga0466967_2180987 Ga0466967_2180987_32_331 98
182 3300046455 Ga0495603_0719126 Ga0495603_0719126_41_340 98
183 3300046472 Ga0495580_0004544 Ga0495580_0004544_8794_9093 98
184 3300046472 Ga0495580_0212974 Ga0495580_0212974_427_729 98
185 3300046472 Ga0495580_0617849 Ga0495580_0617849_16_321 98
186 3300046475 Ga0495639_0065055 Ga0495639_0065055_1100_1405 98
187 3300046476 Ga0495662_0107140 Ga0495662_0107140_985_1290 98
188 3300046511 Ga0495608_0347708 Ga0495608_0347708_157_453 98
189 3300046517 Ga0495630_0331165 Ga0495630_0331165_226_522 98
190 3300046559 Ga0495667_0703193 Ga0495667_0703193_217_513 98
191 3300046675 Ga0495657_0248939 Ga0495657_0248939_579_875 98
192 3300047315 Ga0495581_0522171 Ga0495581_0522171_173_478 98
193 3300047673 Ga0495593_0704686 Ga0495593_0704686_89_385 98
194 3300048907 Ga0496104_0120591 Ga0496104_0120591_1409_1735 98
195 3300048929 Ga0496126_0670460 Ga0496126_0670460_194_493 98
196 3300049582 Ga0501048_1186906 Ga0501048_1186906_167_466 98
197 3300050513 nmdc:mga0rr50_1025104_c1 nmdc:mga0rr50_1025104_c1_363_668 98
198 3300061734 Ga0530510_1315426 Ga0530510_1315426_13_312 98
199 3300025913 Ga0207695_10811814 Ga0207695_108118142 100
200 3300035083 Ga0373926_0019732 Ga0373926_0019732_1310_1618 100
201 3300035086 Ga0373934_0019422 Ga0373934_0019422_2155_2466 100
202 3300035089 Ga0373944_0062125 Ga0373944_0062125_165_473 100
203 3300035111 Ga0373923_0050380 Ga0373923_0050380_1347_1655 100
204 3300035113 Ga0373936_0069093 Ga0373936_0069093_1116_1424 100
205 3300035116 Ga0373945_0020342 Ga0373945_0020342_643_951 100
206 3300035117 Ga0373953_0069901 Ga0373953_0069901_143_454 100
207 3300035118 Ga0373954_0110027 Ga0373954_0110027_660_971 100
208 3300035120 Ga0373957_0073811 Ga0373957_0073811_25_333 100
209 3300035170 Ga0373943_0001662 Ga0373943_0001662_663_971 100
210 3300035171 Ga0373946_0004919 Ga0373946_0004919_18_326 100
211 3300035172 Ga0373955_0071479 Ga0373955_0071479_1490_1798 100
212 3300035410 Ga0373924_0010899 Ga0373924_0010899_2868_3179 100
213 3300035692 Ga0373935_0003648 Ga0373935_0003648_1322_1630 100
214 3300035695 Ga0373927_0000902 Ga0373927_0000902_20965_21273 100
215 3300035724 Ga0373933_0073873 Ga0373933_0073873_1384_1695 100
216 3300035725 Ga0373947_0000537 Ga0373947_0000537_1347_1655 100
217 3300036401 Ga0373937_0033547 Ga0373937_0033547_3857_4168 100
218 3300036401 Ga0373937_0101543 Ga0373937_0101543_106_411 100
219 3300037068 Ga0373925_0005764 Ga0373925_0005764_1342_1650 100
220 3300037068 Ga0373925_0537211 Ga0373925_0537211_113_418 100
221 3300046463 Ga0495653_0088121 Ga0495653_0088121_1606_1914 100
222 3300046472 Ga0495580_0368253 Ga0495580_0368253_200_511 100
223 3300046477 Ga0495664_0048270 Ga0495664_0048270_674_982 100
224 3300046511 Ga0495608_0481035 Ga0495608_0481035_331_639 100
225 3300046543 Ga0495645_0150279 Ga0495645_0150279_880_1188 100
226 3300046683 Ga0495658_0819507 Ga0495658_0819507_192_503 100
227 3300046690 Ga0495624_0257282 Ga0495624_0257282_724_1032 100
228 3300047319 Ga0495674_0009830 Ga0495674_0009830_419_727 100
229 3300048088 Ga0495602_0270894 Ga0495602_0270894_823_1131 100
230 3300048914 Ga0496111_0044576 Ga0496111_0044576_1888_2193 100
231 3300048916 Ga0496113_1400741 Ga0496113_1400741_103_408 100
232 3300003214 JGI25165J46597_1019683 JGI25165J46597_10196832 103
233 3300005530 Ga0070679_100002943 Ga0070679_10000294317 103
234 3300025261 Ga0209233_1030587 Ga0209233_10305872 103
235 3300025912 Ga0207707_10385796 Ga0207707_103857961 103
236 3300025917 Ga0207660_11553606 Ga0207660_115536062 103
237 3300025921 Ga0207652_10006054 Ga0207652_100060545 103

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02604

PhdYeFM_antitox

Antitoxin Phd_YefM, type II toxin-antitoxin system

26

100

0.88

Feature Viewer

pLDDT pTM Quality
69.31 0.35 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map