F350064
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 237 | 162 | 237 | 102 |
Family's Representative Sequence
| Representative Sequence | 3300025915|Ga0207693_10968971|Ga0207693_109689711 |
| Length | 116 |
| Sequence | MVANHCTVRLNELESFAMLRGGKNETIVVSALSAGANLGRLLRRVEDERRSLVIEKRGTPKAVLLSIRDYVRLAAPEPEVLRLIGEESKRKGTNKLTSRQIDQVIKAARAQKAKRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 2 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 6 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 21 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 23 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 25 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 26 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 27 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 29 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 30 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 31 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 32 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 33 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 34 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 35 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 40 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 41 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 42 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 44 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 45 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 60 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 61 | 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 | Metagenome | Rhizosphere |
| 62 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 93 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 94 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 95 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 96 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 97 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 98 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 99 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 100 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 101 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 102 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 103 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 104 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 105 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 106 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 107 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 108 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 109 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 110 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 111 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 112 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 113 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 114 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 115 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 116 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 117 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 118 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 119 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 120 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 121 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 122 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 123 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 124 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 125 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 126 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 127 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 128 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 129 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 130 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 131 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 132 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 133 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 134 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 135 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 136 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 137 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 138 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 139 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 157 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 158 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 159 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 160 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 162 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.05 |
| Metatranscriptomes | 2.95 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.84 |
| Nodule | 0 |
| Rhizoplane | 1.27 |
| Rhizosphere | 96.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25165J46597_1019683 | 3300003214 | Unclassified | 888 |
| 2 | Ga0058862_11430525 | 3300004803 | Unclassified | 880 |
| 3 | Ga0070658_10011240 | 3300005327 | Bacteria | 7176 |
| 4 | Ga0070683_100134695 | 3300005329 | Unclassified | 2339 |
| 5 | Ga0070683_100695221 | 3300005329 | Unclassified | 974 |
| 6 | Ga0068868_100010102 | 3300005338 | Bacteria | 6819 |
| 7 | Ga0070659_100240418 | 3300005366 | Bacteria | 1498 |
| 8 | Ga0070714_100266597 | 3300005435 | Bacteria | 1587 |
| 9 | Ga0070713_100156245 | 3300005436 | Bacteria | 2033 |
| 10 | Ga0070710_10074902 | 3300005437 | Bacteria | 1960 |
| 11 | Ga0070708_100000935 | 3300005445 | Bacteria | 22108 |
| 12 | Ga0070708_100001412 | 3300005445 | Bacteria | 18343 |
| 13 | Ga0070708_100125661 | 3300005445 | Bacteria | 2370 |
| 14 | Ga0070708_100264723 | 3300005445 | Bacteria | 1616 |
| 15 | Ga0070708_100274685 | 3300005445 | Unclassified | 1585 |
| 16 | Ga0070708_100648238 | 3300005445 | Bacteria | 995 |
| 17 | Ga0070663_100364296 | 3300005455 | Bacteria | 1173 |
| 18 | Ga0070678_101062394 | 3300005456 | Unclassified | 746 |
| 19 | Ga0070706_100010946 | 3300005467 | Bacteria | 8423 |
| 20 | Ga0070706_100265492 | 3300005467 | Bacteria | 1602 |
| 21 | Ga0070706_101362470 | 3300005467 | Unclassified | 650 |
| 22 | Ga0070707_100042212 | 3300005468 | Bacteria | 4366 |
| 23 | Ga0070707_100093948 | 3300005468 | Bacteria | 2904 |
| 24 | Ga0070707_100314961 | 3300005468 | Bacteria | 1521 |
| 25 | Ga0070707_100974116 | 3300005468 | Bacteria | 813 |
| 26 | Ga0070698_100537297 | 3300005471 | Unclassified | 1108 |
| 27 | Ga0070699_100025648 | 3300005518 | Bacteria | 5081 |
| 28 | Ga0070679_100002943 | 3300005530 | Bacteria | 15512 |
| 29 | Ga0070679_100289545 | 3300005530 | Bacteria | 1589 |
| 30 | Ga0070684_100018628 | 3300005535 | Bacteria | 5725 |
| 31 | Ga0070684_100034336 | 3300005535 | Bacteria | 4337 |
| 32 | Ga0070697_100000767 | 3300005536 | Bacteria | 24006 |
| 33 | Ga0070697_100341211 | 3300005536 | Bacteria | 1293 |
| 34 | Ga0068853_100283101 | 3300005539 | Unclassified | 1529 |
| 35 | Ga0070693_100006449 | 3300005547 | Bacteria | 5691 |
| 36 | Ga0068855_100041571 | 3300005563 | Bacteria | 5448 |
| 37 | Ga0068855_100065750 | 3300005563 | Bacteria | 4228 |
| 38 | Ga0070664_100123703 | 3300005564 | Bacteria | 2267 |
| 39 | Ga0068857_100079875 | 3300005577 | Bacteria | 2920 |
| 40 | Ga0068857_100162460 | 3300005577 | Bacteria | 2027 |
| 41 | Ga0068854_100172641 | 3300005578 | Unclassified | 1683 |
| 42 | Ga0068856_100002665 | 3300005614 | Bacteria | 18308 |
| 43 | Ga0070702_100079651 | 3300005615 | Bacteria | 1958 |
| 44 | Ga0068852_100011394 | 3300005616 | Bacteria | 6692 |
| 45 | Ga0068859_100493839 | 3300005617 | Unclassified | 1319 |
| 46 | Ga0068864_100024292 | 3300005618 | Bacteria | 5098 |
| 47 | Ga0068866_10150438 | 3300005718 | Unclassified | 1347 |
| 48 | Ga0068863_100011791 | 3300005841 | Bacteria | 8448 |
| 49 | Ga0068863_100068981 | 3300005841 | Bacteria | 3344 |
| 50 | Ga0068858_100249914 | 3300005842 | Unclassified | 1684 |
| 51 | Ga0068860_102489103 | 3300005843 | Unclassified | 537 |
| 52 | Ga0070717_10011520 | 3300006028 | Bacteria | 6718 |
| 53 | Ga0070717_10144765 | 3300006028 | Bacteria | 2052 |
| 54 | Ga0070717_10185822 | 3300006028 | Bacteria | 1814 |
| 55 | Ga0070717_10271125 | 3300006028 | Bacteria | 1503 |
| 56 | Ga0070716_100216728 | 3300006173 | Unclassified | 1283 |
| 57 | Ga0070716_100367142 | 3300006173 | Unclassified | 1024 |
| 58 | Ga0070716_100505050 | 3300006173 | Bacteria | 893 |
| 59 | Ga0070716_100560762 | 3300006173 | Bacteria | 853 |
| 60 | Ga0070712_100214088 | 3300006175 | Unclassified | 1521 |
| 61 | Ga0070712_101556888 | 3300006175 | Unclassified | 578 |
| 62 | Ga0097621_100023680 | 3300006237 | Bacteria | 4783 |
| 63 | Ga0068871_100000867 | 3300006358 | Bacteria | 20118 |
| 64 | Ga0068871_101329238 | 3300006358 | Unclassified | 676 |
| 65 | Ga0068871_102019549 | 3300006358 | Unclassified | 549 |
| 66 | Ga0068865_100007966 | 3300006881 | Bacteria | 6540 |
| 67 | Ga0075436_100143877 | 3300006914 | Bacteria | 1676 |
| 68 | Ga0097620_100493843 | 3300006931 | Unclassified | 1319 |
| 69 | Ga0099794_10050261 | 3300007265 | Bacteria | 2005 |
| 70 | Ga0099794_10308146 | 3300007265 | Unclassified | 820 |
| 71 | Ga0099794_10486445 | 3300007265 | Unclassified | 649 |
| 72 | Ga0099794_10673500 | 3300007265 | Unclassified | 550 |
| 73 | Ga0099795_10595479 | 3300007788 | Unclassified | 526 |
| 74 | Ga0105240_10002544 | 3300009093 | Bacteria | 29242 |
| 75 | Ga0105240_10040004 | 3300009093 | Bacteria | 6002 |
| 76 | Ga0105240_10052013 | 3300009093 | Bacteria | 5151 |
| 77 | Ga0114129_10799677 | 3300009147 | Bacteria | 1203 |
| 78 | Ga0114129_12181707 | 3300009147 | Unclassified | 667 |
| 79 | Ga0105248_10002654 | 3300009177 | Bacteria | 19851 |
| 80 | Ga0105237_11018201 | 3300009545 | Unclassified | 835 |
| 81 | Ga0105237_11182083 | 3300009545 | Unclassified | 771 |
| 82 | Ga0105238_10125999 | 3300009551 | Bacteria | 2539 |
| 83 | Ga0105239_10404182 | 3300010375 | Bacteria | 1546 |
| 84 | Ga0105239_10436288 | 3300010375 | Bacteria | 1485 |
| 85 | Ga0157371_10139811 | 3300013102 | Unclassified | 1725 |
| 86 | Ga0157370_10148507 | 3300013104 | Unclassified | 2182 |
| 87 | Ga0157369_10555554 | 3300013105 | Bacteria | 1186 |
| 88 | Ga0157374_10001728 | 3300013296 | Bacteria | 18314 |
| 89 | Ga0157378_10000432 | 3300013297 | Bacteria | 40837 |
| 90 | Ga0157372_10008378 | 3300013307 | Bacteria | 10988 |
| 91 | Ga0163163_10755692 | 3300014325 | Unclassified | 1036 |
| 92 | Ga0163163_12612758 | 3300014325 | Unclassified | 562 |
| 93 | Ga0157376_10003880 | 3300014969 | Bacteria | 10339 |
| 94 | Ga0157376_13108319 | 3300014969 | Bacteria | 503 |
| 95 | Ga0224712_10066370 | 3300022467 | Bacteria | 1453 |
| 96 | Ga0224569_101353 | 3300022732 | Bacteria | 2061 |
| 97 | Ga0224571_104817 | 3300022734 | Unclassified | 880 |
| 98 | Ga0209233_1030587 | 3300025261 | Unclassified | 1267 |
| 99 | Ga0207692_11004874 | 3300025898 | Bacteria | 551 |
| 100 | Ga0207647_10404305 | 3300025904 | Unclassified | 769 |
| 101 | Ga0207705_10001676 | 3300025909 | Bacteria | 17636 |
| 102 | Ga0207684_10022139 | 3300025910 | Bacteria | 5427 |
| 103 | Ga0207684_10215130 | 3300025910 | Bacteria | 1658 |
| 104 | Ga0207684_11132311 | 3300025910 | Unclassified | 650 |
| 105 | Ga0207707_10219827 | 3300025912 | Unclassified | 1654 |
| 106 | Ga0207707_10385796 | 3300025912 | Unclassified | 1204 |
| 107 | Ga0207695_10018387 | 3300025913 | Bacteria | 8083 |
| 108 | Ga0207695_10081086 | 3300025913 | Bacteria | 3285 |
| 109 | Ga0207695_10811814 | 3300025913 | Unclassified | 815 |
| 110 | Ga0207695_11237777 | 3300025913 | Unclassified | 627 |
| 111 | Ga0207671_10755021 | 3300025914 | Unclassified | 772 |
| 112 | Ga0207693_10879818 | 3300025915 | Bacteria | 688 |
| 113 | Ga0207693_10968971 | 3300025915 | Unclassified | 650 |
| 114 | Ga0207660_11553606 | 3300025917 | Bacteria | 534 |
| 115 | Ga0207652_10006054 | 3300025921 | Bacteria | 9790 |
| 116 | Ga0207652_10809850 | 3300025921 | Unclassified | 831 |
| 117 | Ga0207646_10697874 | 3300025922 | Unclassified | 907 |
| 118 | Ga0207646_11126019 | 3300025922 | Bacteria | 690 |
| 119 | Ga0207694_10184683 | 3300025924 | Bacteria | 1692 |
| 120 | Ga0207700_10126828 | 3300025928 | Bacteria | 2078 |
| 121 | Ga0207700_11060030 | 3300025928 | Unclassified | 725 |
| 122 | Ga0207664_10237310 | 3300025929 | Bacteria | 1587 |
| 123 | Ga0207704_10112341 | 3300025938 | Unclassified | 1845 |
| 124 | Ga0207665_10189118 | 3300025939 | Unclassified | 1495 |
| 125 | Ga0207665_10332846 | 3300025939 | Unclassified | 1142 |
| 126 | Ga0207711_10016208 | 3300025941 | Bacteria | 6187 |
| 127 | Ga0207661_10446785 | 3300025944 | Unclassified | 1177 |
| 128 | Ga0207661_10569855 | 3300025944 | Unclassified | 1038 |
| 129 | Ga0207679_10524737 | 3300025945 | Unclassified | 1059 |
| 130 | Ga0207667_10025371 | 3300025949 | Bacteria | 6488 |
| 131 | Ga0207667_10082470 | 3300025949 | Bacteria | 3331 |
| 132 | Ga0207667_11472283 | 3300025949 | Bacteria | 653 |
| 133 | Ga0207677_10001597 | 3300026023 | Bacteria | 12026 |
| 134 | Ga0207703_10063681 | 3300026035 | Bacteria | 3024 |
| 135 | Ga0207639_10017900 | 3300026041 | Bacteria | 5026 |
| 136 | Ga0207678_10221297 | 3300026067 | Unclassified | 1620 |
| 137 | Ga0207702_10003391 | 3300026078 | Bacteria | 14594 |
| 138 | Ga0207641_10026058 | 3300026088 | Bacteria | 4824 |
| 139 | Ga0207641_10037574 | 3300026088 | Unclassified | 4045 |
| 140 | Ga0207676_10028846 | 3300026095 | Bacteria | 4150 |
| 141 | Ga0207674_10193087 | 3300026116 | Bacteria | 1986 |
| 142 | Ga0207674_10394257 | 3300026116 | Bacteria | 1338 |
| 143 | Ga0207683_11546480 | 3300026121 | Unclassified | 612 |
| 144 | Ga0265357_1005304 | 3300028023 | Unclassified | 1189 |
| 145 | Ga0265318_10141833 | 3300028577 | Bacteria | 882 |
| 146 | Ga0265336_10015433 | 3300028666 | Unclassified | 2513 |
| 147 | Ga0265336_10086730 | 3300028666 | Unclassified | 933 |
| 148 | Ga0265338_10007162 | 3300028800 | Bacteria | 13965 |
| 149 | Ga0265338_10050875 | 3300028800 | Bacteria | 3739 |
| 150 | Ga0265338_11123673 | 3300028800 | Unclassified | 529 |
| 151 | Ga0265324_10151113 | 3300029957 | Bacteria | 788 |
| 152 | Ga0265770_1022530 | 3300030878 | Unclassified | 1008 |
| 153 | Ga0265760_10006901 | 3300031090 | Bacteria | 3256 |
| 154 | Ga0265760_10009671 | 3300031090 | Bacteria | 2754 |
| 155 | Ga0265760_10114477 | 3300031090 | Bacteria | 861 |
| 156 | Ga0265760_10182747 | 3300031090 | Unclassified | 701 |
| 157 | Ga0265332_10049231 | 3300031238 | Bacteria | 1812 |
| 158 | Ga0265320_10003897 | 3300031240 | Bacteria | 9867 |
| 159 | Ga0265325_10065555 | 3300031241 | Bacteria | 1834 |
| 160 | Ga0265329_10018504 | 3300031242 | Bacteria | 2381 |
| 161 | Ga0265340_10009352 | 3300031247 | Bacteria | 5264 |
| 162 | Ga0265340_10016737 | 3300031247 | Bacteria | 3794 |
| 163 | Ga0265339_10035113 | 3300031249 | Bacteria | 2815 |
| 164 | Ga0265339_10183867 | 3300031249 | Unclassified | 1039 |
| 165 | Ga0265331_10018342 | 3300031250 | Bacteria | 3632 |
| 166 | Ga0265331_10194905 | 3300031250 | Unclassified | 913 |
| 167 | Ga0265316_10002102 | 3300031344 | Bacteria | 20948 |
| 168 | Ga0265316_10010314 | 3300031344 | Bacteria | 8522 |
| 169 | Ga0265314_10071430 | 3300031711 | Bacteria | 2322 |
| 170 | Ga0265314_10141426 | 3300031711 | Unclassified | 1487 |
| 171 | Ga0265342_10084306 | 3300031712 | Bacteria | 1830 |
| 172 | Ga0265342_10198918 | 3300031712 | Unclassified | 1090 |
| 173 | Ga0316212_1016856 | 3300033547 | Bacteria | 1028 |
| 174 | Ga0373926_0019732 | 3300035083 | Bacteria | 2325 |
| 175 | Ga0373934_0019422 | 3300035086 | Bacteria | 2608 |
| 176 | Ga0373944_0062125 | 3300035089 | Bacteria | 1200 |
| 177 | Ga0373923_0050380 | 3300035111 | Bacteria | 1744 |
| 178 | Ga0373936_0069093 | 3300035113 | Bacteria | 1453 |
| 179 | Ga0373945_0020342 | 3300035116 | Bacteria | 2270 |
| 180 | Ga0373945_0473259 | 3300035116 | Unclassified | 556 |
| 181 | Ga0373953_0069901 | 3300035117 | Bacteria | 1447 |
| 182 | Ga0373953_0490592 | 3300035117 | Unclassified | 544 |
| 183 | Ga0373954_0110027 | 3300035118 | Bacteria | 1332 |
| 184 | Ga0373957_0073811 | 3300035120 | Bacteria | 1338 |
| 185 | Ga0373943_0001662 | 3300035170 | Bacteria | 10101 |
| 186 | Ga0373946_0004919 | 3300035171 | Bacteria | 4812 |
| 187 | Ga0373955_0071479 | 3300035172 | Bacteria | 1941 |
| 188 | Ga0373924_0010899 | 3300035410 | Bacteria | 3365 |
| 189 | Ga0373935_0003648 | 3300035692 | Bacteria | 8968 |
| 190 | Ga0373927_0000902 | 3300035695 | Bacteria | 22599 |
| 191 | Ga0373927_0875785 | 3300035695 | Unclassified | 593 |
| 192 | Ga0373933_0073873 | 3300035724 | Bacteria | 2078 |
| 193 | Ga0373947_0000537 | 3300035725 | Bacteria | 22189 |
| 194 | Ga0373937_0033547 | 3300036401 | Bacteria | 4663 |
| 195 | Ga0373937_0101543 | 3300036401 | Unclassified | 2670 |
| 196 | Ga0373937_1031830 | 3300036401 | Unclassified | 771 |
| 197 | Ga0373925_0005764 | 3300037068 | Bacteria | 9206 |
| 198 | Ga0373925_0537211 | 3300037068 | Unclassified | 961 |
| 199 | Ga0436364_0737333 | 3300037853 | Bacteria | 47273 |
| 200 | Ga0436360_0743451 | 3300039438 | Unclassified | 673 |
| 201 | Ga0436360_0879924 | 3300039438 | Bacteria | 5050 |
| 202 | Ga0436362_0897636 | 3300039453 | Bacteria | 1428 |
| 203 | Ga0451577_0039153 | 3300042876 | Unclassified | 4261 |
| 204 | Ga0466969_0531965 | 3300044656 | Unclassified | 537 |
| 205 | Ga0453683_0001681 | 3300044673 | Bacteria | 18448 |
| 206 | Ga0466966_0713705 | 3300044684 | Unclassified | 604 |
| 207 | Ga0466961_0144449 | 3300044693 | Bacteria | 1488 |
| 208 | Ga0453684_0056532 | 3300044712 | Bacteria | 5089 |
| 209 | Ga0466967_2180987 | 3300045976 | Unclassified | 550 |
| 210 | Ga0495603_0719126 | 3300046455 | Unclassified | 571 |
| 211 | Ga0495653_0088121 | 3300046463 | Bacteria | 2278 |
| 212 | Ga0495580_0004544 | 3300046472 | Bacteria | 11653 |
| 213 | Ga0495580_0212974 | 3300046472 | Unclassified | 1329 |
| 214 | Ga0495580_0368253 | 3300046472 | Bacteria | 972 |
| 215 | Ga0495580_0617849 | 3300046472 | Unclassified | 715 |
| 216 | Ga0495639_0065055 | 3300046475 | Bacteria | 1677 |
| 217 | Ga0495662_0107140 | 3300046476 | Unclassified | 1369 |
| 218 | Ga0495664_0048270 | 3300046477 | Bacteria | 2527 |
| 219 | Ga0495608_0347708 | 3300046511 | Unclassified | 913 |
| 220 | Ga0495608_0481035 | 3300046511 | Bacteria | 753 |
| 221 | Ga0495630_0331165 | 3300046517 | Unclassified | 1164 |
| 222 | Ga0495645_0150279 | 3300046543 | Bacteria | 1619 |
| 223 | Ga0495667_0703193 | 3300046559 | Unclassified | 626 |
| 224 | Ga0495657_0248939 | 3300046675 | Unclassified | 1070 |
| 225 | Ga0495658_0819507 | 3300046683 | Unclassified | 596 |
| 226 | Ga0495624_0257282 | 3300046690 | Bacteria | 1055 |
| 227 | Ga0495581_0522171 | 3300047315 | Unclassified | 690 |
| 228 | Ga0495674_0009830 | 3300047319 | Bacteria | 9079 |
| 229 | Ga0495593_0704686 | 3300047673 | Unclassified | 507 |
| 230 | Ga0495602_0270894 | 3300048088 | Bacteria | 1255 |
| 231 | Ga0496104_0120591 | 3300048907 | Bacteria | 2518 |
| 232 | Ga0496111_0044576 | 3300048914 | Bacteria | 3188 |
| 233 | Ga0496113_1400741 | 3300048916 | Unclassified | 541 |
| 234 | Ga0496126_0670460 | 3300048929 | Unclassified | 809 |
| 235 | Ga0501048_1186906 | 3300049582 | Unclassified | 549 |
| 236 | nmdc:mga0rr50_1025104_c1 | 3300050513 | Bacteria | 703 |
| 237 | Ga0530510_1315426 | 3300061734 | Unclassified | 554 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005445 | Ga0070708_100274685 | Ga0070708_1002746852 | 91 |
| 2 | 3300005468 | Ga0070707_100314961 | Ga0070707_1003149611 | 91 |
| 3 | 3300006173 | Ga0070716_100560762 | Ga0070716_1005607621 | 91 |
| 4 | 3300006914 | Ga0075436_100143877 | Ga0075436_1001438772 | 91 |
| 5 | 3300007788 | Ga0099795_10595479 | Ga0099795_105954792 | 91 |
| 6 | 3300009147 | Ga0114129_10799677 | Ga0114129_107996772 | 91 |
| 7 | 3300006028 | Ga0070717_10271125 | Ga0070717_102711252 | 93 |
| 8 | 3300004803 | Ga0058862_11430525 | Ga0058862_114305251 | 95 |
| 9 | 3300005468 | Ga0070707_100974116 | Ga0070707_1009741162 | 95 |
| 10 | 3300006173 | Ga0070716_100367142 | Ga0070716_1003671421 | 95 |
| 11 | 3300006175 | Ga0070712_101556888 | Ga0070712_1015568881 | 95 |
| 12 | 3300025915 | Ga0207693_10879818 | Ga0207693_108798182 | 95 |
| 13 | 3300031090 | Ga0265760_10006901 | Ga0265760_100069013 | 96 |
| 14 | 3300031247 | Ga0265340_10016737 | Ga0265340_100167374 | 96 |
| 15 | 3300031249 | Ga0265339_10035113 | Ga0265339_100351132 | 96 |
| 16 | 3300031250 | Ga0265331_10194905 | Ga0265331_101949052 | 96 |
| 17 | 3300031711 | Ga0265314_10071430 | Ga0265314_100714302 | 96 |
| 18 | 3300031711 | Ga0265314_10141426 | Ga0265314_101414262 | 96 |
| 19 | 3300005329 | Ga0070683_100695221 | Ga0070683_1006952213 | 97 |
| 20 | 3300005445 | Ga0070708_100001412 | Ga0070708_1000014124 | 97 |
| 21 | 3300005467 | Ga0070706_101362470 | Ga0070706_1013624701 | 97 |
| 22 | 3300005518 | Ga0070699_100025648 | Ga0070699_1000256484 | 97 |
| 23 | 3300005535 | Ga0070684_100034336 | Ga0070684_1000343364 | 97 |
| 24 | 3300006028 | Ga0070717_10011520 | Ga0070717_100115205 | 97 |
| 25 | 3300006175 | Ga0070712_100214088 | Ga0070712_1002140882 | 97 |
| 26 | 3300006358 | Ga0068871_102019549 | Ga0068871_1020195492 | 97 |
| 27 | 3300009093 | Ga0105240_10002544 | Ga0105240_1000254422 | 97 |
| 28 | 3300009545 | Ga0105237_11018201 | Ga0105237_110182012 | 97 |
| 29 | 3300009551 | Ga0105238_10125999 | Ga0105238_101259993 | 97 |
| 30 | 3300013105 | Ga0157369_10555554 | Ga0157369_105555541 | 97 |
| 31 | 3300014969 | Ga0157376_13108319 | Ga0157376_131083191 | 97 |
| 32 | 3300022467 | Ga0224712_10066370 | Ga0224712_100663702 | 97 |
| 33 | 3300025910 | Ga0207684_11132311 | Ga0207684_111323111 | 97 |
| 34 | 3300025913 | Ga0207695_10018387 | Ga0207695_100183877 | 97 |
| 35 | 3300025924 | Ga0207694_10184683 | Ga0207694_101846832 | 97 |
| 36 | 3300025944 | Ga0207661_10569855 | Ga0207661_105698552 | 97 |
| 37 | 3300044656 | Ga0466969_0531965 | Ga0466969_0531965_115_408 | 97 |
| 38 | 3300044684 | Ga0466966_0713705 | Ga0466966_0713705_195_488 | 97 |
| 39 | 3300044693 | Ga0466961_0144449 | Ga0466961_0144449_59_352 | 97 |
| 40 | 3300005327 | Ga0070658_10011240 | Ga0070658_100112403 | 98 |
| 41 | 3300005329 | Ga0070683_100134695 | Ga0070683_1001346954 | 98 |
| 42 | 3300005338 | Ga0068868_100010102 | Ga0068868_1000101026 | 98 |
| 43 | 3300005366 | Ga0070659_100240418 | Ga0070659_1002404182 | 98 |
| 44 | 3300005435 | Ga0070714_100266597 | Ga0070714_1002665971 | 98 |
| 45 | 3300005436 | Ga0070713_100156245 | Ga0070713_1001562453 | 98 |
| 46 | 3300005437 | Ga0070710_10074902 | Ga0070710_100749022 | 98 |
| 47 | 3300005445 | Ga0070708_100000935 | Ga0070708_1000009359 | 98 |
| 48 | 3300005445 | Ga0070708_100125661 | Ga0070708_1001256615 | 98 |
| 49 | 3300005445 | Ga0070708_100264723 | Ga0070708_1002647231 | 98 |
| 50 | 3300005445 | Ga0070708_100648238 | Ga0070708_1006482382 | 98 |
| 51 | 3300005455 | Ga0070663_100364296 | Ga0070663_1003642961 | 98 |
| 52 | 3300005456 | Ga0070678_101062394 | Ga0070678_1010623941 | 98 |
| 53 | 3300005467 | Ga0070706_100010946 | Ga0070706_1000109469 | 98 |
| 54 | 3300005467 | Ga0070706_100265492 | Ga0070706_1002654922 | 98 |
| 55 | 3300005468 | Ga0070707_100042212 | Ga0070707_1000422125 | 98 |
| 56 | 3300005468 | Ga0070707_100093948 | Ga0070707_1000939482 | 98 |
| 57 | 3300005471 | Ga0070698_100537297 | Ga0070698_1005372972 | 98 |
| 58 | 3300005530 | Ga0070679_100289545 | Ga0070679_1002895454 | 98 |
| 59 | 3300005535 | Ga0070684_100018628 | Ga0070684_1000186287 | 98 |
| 60 | 3300005536 | Ga0070697_100000767 | Ga0070697_10000076721 | 98 |
| 61 | 3300005536 | Ga0070697_100341211 | Ga0070697_1003412112 | 98 |
| 62 | 3300005539 | Ga0068853_100283101 | Ga0068853_1002831013 | 98 |
| 63 | 3300005547 | Ga0070693_100006449 | Ga0070693_1000064496 | 98 |
| 64 | 3300005563 | Ga0068855_100041571 | Ga0068855_1000415715 | 98 |
| 65 | 3300005563 | Ga0068855_100065750 | Ga0068855_1000657503 | 98 |
| 66 | 3300005564 | Ga0070664_100123703 | Ga0070664_1001237033 | 98 |
| 67 | 3300005577 | Ga0068857_100079875 | Ga0068857_1000798753 | 98 |
| 68 | 3300005577 | Ga0068857_100162460 | Ga0068857_1001624602 | 98 |
| 69 | 3300005578 | Ga0068854_100172641 | Ga0068854_1001726413 | 98 |
| 70 | 3300005614 | Ga0068856_100002665 | Ga0068856_10000266522 | 98 |
| 71 | 3300005615 | Ga0070702_100079651 | Ga0070702_1000796512 | 98 |
| 72 | 3300005616 | Ga0068852_100011394 | Ga0068852_10001139410 | 98 |
| 73 | 3300005617 | Ga0068859_100493839 | Ga0068859_1004938393 | 98 |
| 74 | 3300005618 | Ga0068864_100024292 | Ga0068864_1000242925 | 98 |
| 75 | 3300005718 | Ga0068866_10150438 | Ga0068866_101504382 | 98 |
| 76 | 3300005841 | Ga0068863_100011791 | Ga0068863_1000117917 | 98 |
| 77 | 3300005841 | Ga0068863_100068981 | Ga0068863_1000689815 | 98 |
| 78 | 3300005842 | Ga0068858_100249914 | Ga0068858_1002499144 | 98 |
| 79 | 3300005843 | Ga0068860_102489103 | Ga0068860_1024891031 | 98 |
| 80 | 3300006028 | Ga0070717_10144765 | Ga0070717_101447653 | 98 |
| 81 | 3300006028 | Ga0070717_10185822 | Ga0070717_101858222 | 98 |
| 82 | 3300006173 | Ga0070716_100216728 | Ga0070716_1002167282 | 98 |
| 83 | 3300006173 | Ga0070716_100505050 | Ga0070716_1005050501 | 98 |
| 84 | 3300006237 | Ga0097621_100023680 | Ga0097621_1000236805 | 98 |
| 85 | 3300006358 | Ga0068871_100000867 | Ga0068871_1000008678 | 98 |
| 86 | 3300006358 | Ga0068871_101329238 | Ga0068871_1013292382 | 98 |
| 87 | 3300006881 | Ga0068865_100007966 | Ga0068865_10000796610 | 98 |
| 88 | 3300006931 | Ga0097620_100493843 | Ga0097620_1004938433 | 98 |
| 89 | 3300007265 | Ga0099794_10050261 | Ga0099794_100502612 | 98 |
| 90 | 3300007265 | Ga0099794_10308146 | Ga0099794_103081462 | 98 |
| 91 | 3300007265 | Ga0099794_10486445 | Ga0099794_104864452 | 98 |
| 92 | 3300007265 | Ga0099794_10673500 | Ga0099794_106735001 | 98 |
| 93 | 3300009093 | Ga0105240_10040004 | Ga0105240_100400048 | 98 |
| 94 | 3300009093 | Ga0105240_10052013 | Ga0105240_100520132 | 98 |
| 95 | 3300009147 | Ga0114129_12181707 | Ga0114129_121817071 | 98 |
| 96 | 3300009177 | Ga0105248_10002654 | Ga0105248_100026546 | 98 |
| 97 | 3300009545 | Ga0105237_11182083 | Ga0105237_111820831 | 98 |
| 98 | 3300010375 | Ga0105239_10404182 | Ga0105239_104041823 | 98 |
| 99 | 3300010375 | Ga0105239_10436288 | Ga0105239_104362882 | 98 |
| 100 | 3300013102 | Ga0157371_10139811 | Ga0157371_101398112 | 98 |
| 101 | 3300013104 | Ga0157370_10148507 | Ga0157370_101485072 | 98 |
| 102 | 3300013296 | Ga0157374_10001728 | Ga0157374_1000172820 | 98 |
| 103 | 3300013297 | Ga0157378_10000432 | Ga0157378_1000043220 | 98 |
| 104 | 3300013307 | Ga0157372_10008378 | Ga0157372_100083787 | 98 |
| 105 | 3300014325 | Ga0163163_10755692 | Ga0163163_107556922 | 98 |
| 106 | 3300014325 | Ga0163163_12612758 | Ga0163163_126127581 | 98 |
| 107 | 3300014969 | Ga0157376_10003880 | Ga0157376_100038807 | 98 |
| 108 | 3300022732 | Ga0224569_101353 | Ga0224569_1013532 | 98 |
| 109 | 3300022734 | Ga0224571_104817 | Ga0224571_1048172 | 98 |
| 110 | 3300025898 | Ga0207692_11004874 | Ga0207692_110048742 | 98 |
| 111 | 3300025904 | Ga0207647_10404305 | Ga0207647_104043052 | 98 |
| 112 | 3300025909 | Ga0207705_10001676 | Ga0207705_100016763 | 98 |
| 113 | 3300025910 | Ga0207684_10022139 | Ga0207684_100221394 | 98 |
| 114 | 3300025910 | Ga0207684_10215130 | Ga0207684_102151302 | 98 |
| 115 | 3300025912 | Ga0207707_10219827 | Ga0207707_102198271 | 98 |
| 116 | 3300025913 | Ga0207695_10081086 | Ga0207695_100810864 | 98 |
| 117 | 3300025913 | Ga0207695_11237777 | Ga0207695_112377772 | 98 |
| 118 | 3300025914 | Ga0207671_10755021 | Ga0207671_107550211 | 98 |
| 119 | 3300025915 | Ga0207693_10968971 | Ga0207693_109689711 | 98 |
| 120 | 3300025921 | Ga0207652_10809850 | Ga0207652_108098502 | 98 |
| 121 | 3300025922 | Ga0207646_10697874 | Ga0207646_106978742 | 98 |
| 122 | 3300025922 | Ga0207646_11126019 | Ga0207646_111260192 | 98 |
| 123 | 3300025928 | Ga0207700_10126828 | Ga0207700_101268282 | 98 |
| 124 | 3300025928 | Ga0207700_11060030 | Ga0207700_110600301 | 98 |
| 125 | 3300025929 | Ga0207664_10237310 | Ga0207664_102373103 | 98 |
| 126 | 3300025938 | Ga0207704_10112341 | Ga0207704_101123413 | 98 |
| 127 | 3300025939 | Ga0207665_10189118 | Ga0207665_101891182 | 98 |
| 128 | 3300025939 | Ga0207665_10332846 | Ga0207665_103328461 | 98 |
| 129 | 3300025941 | Ga0207711_10016208 | Ga0207711_100162089 | 98 |
| 130 | 3300025944 | Ga0207661_10446785 | Ga0207661_104467851 | 98 |
| 131 | 3300025945 | Ga0207679_10524737 | Ga0207679_105247372 | 98 |
| 132 | 3300025949 | Ga0207667_10025371 | Ga0207667_100253715 | 98 |
| 133 | 3300025949 | Ga0207667_10082470 | Ga0207667_100824703 | 98 |
| 134 | 3300025949 | Ga0207667_11472283 | Ga0207667_114722832 | 98 |
| 135 | 3300026023 | Ga0207677_10001597 | Ga0207677_1000159715 | 98 |
| 136 | 3300026035 | Ga0207703_10063681 | Ga0207703_100636815 | 98 |
| 137 | 3300026041 | Ga0207639_10017900 | Ga0207639_100179007 | 98 |
| 138 | 3300026067 | Ga0207678_10221297 | Ga0207678_102212971 | 98 |
| 139 | 3300026078 | Ga0207702_10003391 | Ga0207702_100033917 | 98 |
| 140 | 3300026088 | Ga0207641_10026058 | Ga0207641_100260586 | 98 |
| 141 | 3300026088 | Ga0207641_10037574 | Ga0207641_100375744 | 98 |
| 142 | 3300026095 | Ga0207676_10028846 | Ga0207676_100288465 | 98 |
| 143 | 3300026116 | Ga0207674_10193087 | Ga0207674_101930873 | 98 |
| 144 | 3300026116 | Ga0207674_10394257 | Ga0207674_103942573 | 98 |
| 145 | 3300026121 | Ga0207683_11546480 | Ga0207683_115464802 | 98 |
| 146 | 3300028023 | Ga0265357_1005304 | Ga0265357_10053041 | 98 |
| 147 | 3300028577 | Ga0265318_10141833 | Ga0265318_101418332 | 98 |
| 148 | 3300028666 | Ga0265336_10015433 | Ga0265336_100154333 | 98 |
| 149 | 3300028666 | Ga0265336_10086730 | Ga0265336_100867302 | 98 |
| 150 | 3300028800 | Ga0265338_10007162 | Ga0265338_100071626 | 98 |
| 151 | 3300028800 | Ga0265338_10050875 | Ga0265338_100508752 | 98 |
| 152 | 3300028800 | Ga0265338_11123673 | Ga0265338_111236732 | 98 |
| 153 | 3300029957 | Ga0265324_10151113 | Ga0265324_101511132 | 98 |
| 154 | 3300030878 | Ga0265770_1022530 | Ga0265770_10225301 | 98 |
| 155 | 3300031090 | Ga0265760_10009671 | Ga0265760_100096712 | 98 |
| 156 | 3300031090 | Ga0265760_10114477 | Ga0265760_101144772 | 98 |
| 157 | 3300031090 | Ga0265760_10182747 | Ga0265760_101827471 | 98 |
| 158 | 3300031238 | Ga0265332_10049231 | Ga0265332_100492313 | 98 |
| 159 | 3300031240 | Ga0265320_10003897 | Ga0265320_100038972 | 98 |
| 160 | 3300031241 | Ga0265325_10065555 | Ga0265325_100655553 | 98 |
| 161 | 3300031242 | Ga0265329_10018504 | Ga0265329_100185043 | 98 |
| 162 | 3300031247 | Ga0265340_10009352 | Ga0265340_100093524 | 98 |
| 163 | 3300031249 | Ga0265339_10183867 | Ga0265339_101838672 | 98 |
| 164 | 3300031250 | Ga0265331_10018342 | Ga0265331_100183422 | 98 |
| 165 | 3300031344 | Ga0265316_10002102 | Ga0265316_100021021 | 98 |
| 166 | 3300031344 | Ga0265316_10010314 | Ga0265316_100103143 | 98 |
| 167 | 3300031712 | Ga0265342_10084306 | Ga0265342_100843063 | 98 |
| 168 | 3300031712 | Ga0265342_10198918 | Ga0265342_101989183 | 98 |
| 169 | 3300033547 | Ga0316212_1016856 | Ga0316212_10168562 | 98 |
| 170 | 3300035116 | Ga0373945_0473259 | Ga0373945_0473259_162_461 | 98 |
| 171 | 3300035117 | Ga0373953_0490592 | Ga0373953_0490592_215_514 | 98 |
| 172 | 3300035695 | Ga0373927_0875785 | Ga0373927_0875785_173_472 | 98 |
| 173 | 3300036401 | Ga0373937_1031830 | Ga0373937_1031830_335_631 | 98 |
| 174 | 3300037853 | Ga0436364_0737333 | Ga0436364_0737333_46410_46757 | 98 |
| 175 | 3300039438 | Ga0436360_0743451 | Ga0436360_0743451_209_607 | 98 |
| 176 | 3300039438 | Ga0436360_0879924 | Ga0436360_0879924_2066_2368 | 98 |
| 177 | 3300039453 | Ga0436362_0897636 | Ga0436362_0897636_630_932 | 98 |
| 178 | 3300042876 | Ga0451577_0039153 | Ga0451577_0039153_101_397 | 98 |
| 179 | 3300044673 | Ga0453683_0001681 | Ga0453683_0001681_1377_1673 | 98 |
| 180 | 3300044712 | Ga0453684_0056532 | Ga0453684_0056532_4729_5025 | 98 |
| 181 | 3300045976 | Ga0466967_2180987 | Ga0466967_2180987_32_331 | 98 |
| 182 | 3300046455 | Ga0495603_0719126 | Ga0495603_0719126_41_340 | 98 |
| 183 | 3300046472 | Ga0495580_0004544 | Ga0495580_0004544_8794_9093 | 98 |
| 184 | 3300046472 | Ga0495580_0212974 | Ga0495580_0212974_427_729 | 98 |
| 185 | 3300046472 | Ga0495580_0617849 | Ga0495580_0617849_16_321 | 98 |
| 186 | 3300046475 | Ga0495639_0065055 | Ga0495639_0065055_1100_1405 | 98 |
| 187 | 3300046476 | Ga0495662_0107140 | Ga0495662_0107140_985_1290 | 98 |
| 188 | 3300046511 | Ga0495608_0347708 | Ga0495608_0347708_157_453 | 98 |
| 189 | 3300046517 | Ga0495630_0331165 | Ga0495630_0331165_226_522 | 98 |
| 190 | 3300046559 | Ga0495667_0703193 | Ga0495667_0703193_217_513 | 98 |
| 191 | 3300046675 | Ga0495657_0248939 | Ga0495657_0248939_579_875 | 98 |
| 192 | 3300047315 | Ga0495581_0522171 | Ga0495581_0522171_173_478 | 98 |
| 193 | 3300047673 | Ga0495593_0704686 | Ga0495593_0704686_89_385 | 98 |
| 194 | 3300048907 | Ga0496104_0120591 | Ga0496104_0120591_1409_1735 | 98 |
| 195 | 3300048929 | Ga0496126_0670460 | Ga0496126_0670460_194_493 | 98 |
| 196 | 3300049582 | Ga0501048_1186906 | Ga0501048_1186906_167_466 | 98 |
| 197 | 3300050513 | nmdc:mga0rr50_1025104_c1 | nmdc:mga0rr50_1025104_c1_363_668 | 98 |
| 198 | 3300061734 | Ga0530510_1315426 | Ga0530510_1315426_13_312 | 98 |
| 199 | 3300025913 | Ga0207695_10811814 | Ga0207695_108118142 | 100 |
| 200 | 3300035083 | Ga0373926_0019732 | Ga0373926_0019732_1310_1618 | 100 |
| 201 | 3300035086 | Ga0373934_0019422 | Ga0373934_0019422_2155_2466 | 100 |
| 202 | 3300035089 | Ga0373944_0062125 | Ga0373944_0062125_165_473 | 100 |
| 203 | 3300035111 | Ga0373923_0050380 | Ga0373923_0050380_1347_1655 | 100 |
| 204 | 3300035113 | Ga0373936_0069093 | Ga0373936_0069093_1116_1424 | 100 |
| 205 | 3300035116 | Ga0373945_0020342 | Ga0373945_0020342_643_951 | 100 |
| 206 | 3300035117 | Ga0373953_0069901 | Ga0373953_0069901_143_454 | 100 |
| 207 | 3300035118 | Ga0373954_0110027 | Ga0373954_0110027_660_971 | 100 |
| 208 | 3300035120 | Ga0373957_0073811 | Ga0373957_0073811_25_333 | 100 |
| 209 | 3300035170 | Ga0373943_0001662 | Ga0373943_0001662_663_971 | 100 |
| 210 | 3300035171 | Ga0373946_0004919 | Ga0373946_0004919_18_326 | 100 |
| 211 | 3300035172 | Ga0373955_0071479 | Ga0373955_0071479_1490_1798 | 100 |
| 212 | 3300035410 | Ga0373924_0010899 | Ga0373924_0010899_2868_3179 | 100 |
| 213 | 3300035692 | Ga0373935_0003648 | Ga0373935_0003648_1322_1630 | 100 |
| 214 | 3300035695 | Ga0373927_0000902 | Ga0373927_0000902_20965_21273 | 100 |
| 215 | 3300035724 | Ga0373933_0073873 | Ga0373933_0073873_1384_1695 | 100 |
| 216 | 3300035725 | Ga0373947_0000537 | Ga0373947_0000537_1347_1655 | 100 |
| 217 | 3300036401 | Ga0373937_0033547 | Ga0373937_0033547_3857_4168 | 100 |
| 218 | 3300036401 | Ga0373937_0101543 | Ga0373937_0101543_106_411 | 100 |
| 219 | 3300037068 | Ga0373925_0005764 | Ga0373925_0005764_1342_1650 | 100 |
| 220 | 3300037068 | Ga0373925_0537211 | Ga0373925_0537211_113_418 | 100 |
| 221 | 3300046463 | Ga0495653_0088121 | Ga0495653_0088121_1606_1914 | 100 |
| 222 | 3300046472 | Ga0495580_0368253 | Ga0495580_0368253_200_511 | 100 |
| 223 | 3300046477 | Ga0495664_0048270 | Ga0495664_0048270_674_982 | 100 |
| 224 | 3300046511 | Ga0495608_0481035 | Ga0495608_0481035_331_639 | 100 |
| 225 | 3300046543 | Ga0495645_0150279 | Ga0495645_0150279_880_1188 | 100 |
| 226 | 3300046683 | Ga0495658_0819507 | Ga0495658_0819507_192_503 | 100 |
| 227 | 3300046690 | Ga0495624_0257282 | Ga0495624_0257282_724_1032 | 100 |
| 228 | 3300047319 | Ga0495674_0009830 | Ga0495674_0009830_419_727 | 100 |
| 229 | 3300048088 | Ga0495602_0270894 | Ga0495602_0270894_823_1131 | 100 |
| 230 | 3300048914 | Ga0496111_0044576 | Ga0496111_0044576_1888_2193 | 100 |
| 231 | 3300048916 | Ga0496113_1400741 | Ga0496113_1400741_103_408 | 100 |
| 232 | 3300003214 | JGI25165J46597_1019683 | JGI25165J46597_10196832 | 103 |
| 233 | 3300005530 | Ga0070679_100002943 | Ga0070679_10000294317 | 103 |
| 234 | 3300025261 | Ga0209233_1030587 | Ga0209233_10305872 | 103 |
| 235 | 3300025912 | Ga0207707_10385796 | Ga0207707_103857961 | 103 |
| 236 | 3300025917 | Ga0207660_11553606 | Ga0207660_115536062 | 103 |
| 237 | 3300025921 | Ga0207652_10006054 | Ga0207652_100060545 | 103 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar