F350012

General Info

Members Datasets Scaffolds Average Seq Length
237 156 474 256

Family's Representative Sequence

Representative Sequence 3300013250|Ga0171462_1001|Ga0171462_1001159
Length 290
Sequence VLNVPYVRRDGAMPLPECNPEYPLRVTSDLVPGADHTADEVTADQEVPQDPEAPARRMGLTYAFGRMILAPLARVVYRPHIEGKGNVPKSGPVIFASNHLSFIDSIAIPVAAPRPVHFLAKASYFEKPASRWFFTAIGAIPVQRGAGQAALDALDQQRELLDEGSAVALYPEGTRSLDGRLYKGRTGVAFLALQTGAPVVPVGLIGTDKAMPVGAKMPSRTHRVTVRFGAPIDLSHHGPASSGKARRLATDEIMTAIHALSGQELANAYNEVPAQNPIDRIKQVLPHERR

Samples

Sample ID Description Type Environment
1 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
14 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
15 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
16 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
17 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
18 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
19 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
20 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
21 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
22 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
23 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
24 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
25 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
26 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
27 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
28 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
29 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
30 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
31 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
33 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
34 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
35 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
36 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
41 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
42 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
43 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
44 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
45 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
46 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
47 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
48 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
49 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
50 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
51 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
52 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
53 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
54 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
55 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
56 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
57 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
58 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
59 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
60 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
61 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
62 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
63 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
64 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
65 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
66 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
67 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
68 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
69 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
70 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
71 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
72 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
73 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
74 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
75 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
76 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
77 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
78 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
79 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
80 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
81 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
82 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
83 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
84 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
85 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
86 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
91 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
92 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
93 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
94 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
95 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
96 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
97 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
98 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
99 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
100 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
101 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
102 2643221546 Microbacterium sp. Root53 Isolate Unclassified
103 2643221553 Microbacterium sp. Root553 Isolate Unclassified
104 2643221566 Microbacterium sp. Root166 Isolate Unclassified
105 2643221597 Microbacterium sp. Root180 Isolate Unclassified
106 2643221616 Leifsonia sp. Root227 Isolate Unclassified
107 2643221630 Microbacterium sp. Root322 Isolate Unclassified
108 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
109 2643221649 Leifsonia sp. Root4 Isolate Unclassified
110 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
111 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
112 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
113 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
114 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
115 2773857759 Microbacterium sp. 1294 Isolate Unclassified
116 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
117 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
118 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
119 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
120 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
121 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
122 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
123 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
124 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
125 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
126 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
127 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
128 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
129 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
130 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
131 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
132 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
133 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
134 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
135 2919069694 Microbacterium sp. 1154 Isolate Unclassified
136 2919395869 Microbacterium resistens 2980 Isolate Unclassified
137 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
138 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
139 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
140 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
141 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
142 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
143 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
144 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
145 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
146 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
147 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
148 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
149 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
150 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
151 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
152 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
153 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
154 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
155 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
156 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 73.84
Metatranscriptomes 1.69
Isolates 24.47

Biome Distribution

Category Percentage (%)
Aerial Root 0.84
Bulb 0
Endosphere 12.66
Nodule 0
Rhizoplane 13.08
Rhizosphere 35.44
Stem 0
Stem Tuber 0.42
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0171462_1001 3300013250 Bacteria 1135406
2 JGI25154J39366_1006860 3300002738 Bacteria 1618
3 JGI25164J39214_1000498 3300002772 Bacteria 19187
4 JGI25165J46597_1000002 3300003214 Bacteria 765387
5 Ga0006562J51391_1010188 3300003578 Bacteria 13150
6 Ga0006562J51391_1010192 3300003578 Bacteria 5720
7 Ga0065714_10129394 3300005288 Bacteria 1265
8 Ga0065714_10147868 3300005288 Bacteria 1125
9 Ga0070658_10008436 3300005327 Bacteria 8287
10 Ga0070660_100136156 3300005339 Bacteria 1968
11 Ga0070674_100666370 3300005356 Bacteria 886
12 Ga0070713_100328473 3300005436 Bacteria 1414
13 Ga0068853_100378843 3300005539 Bacteria 1321
14 Ga0068856_100579518 3300005614 Bacteria 1143
15 Ga0070702_100024368 3300005615 Bacteria 3228
16 Ga0070717_10069368 3300006028 Bacteria 2936
17 Ga0075368_10006755 3300006042 Bacteria 4030
18 Ga0075363_100100496 3300006048 Bacteria 1600
19 Ga0075364_10003628 3300006051 Bacteria 8802
20 Ga0075364_10004659 3300006051 Bacteria 7911
21 Ga0075364_10026835 3300006051 Bacteria 3677
22 Ga0075364_10126940 3300006051 Bacteria 1711
23 Ga0075364_10366062 3300006051 Bacteria 983
24 Ga0075367_10013111 3300006178 Bacteria 4443
25 Ga0075369_10006437 3300006186 Bacteria 4438
26 Ga0075370_10032520 3300006353 Bacteria 2917
27 Ga0075370_10118952 3300006353 Bacteria 1537
28 Ga0105244_10059185 3300009036 Bacteria 1932
29 Ga0105243_10009163 3300009148 Bacteria 7557
30 Ga0105243_10107940 3300009148 Bacteria 2323
31 Ga0105243_10137212 3300009148 Bacteria 2082
32 Ga0157371_10001372 3300013102 Bacteria 25534
33 Ga0157371_10066512 3300013102 Bacteria 2552
34 Ga0157369_10000631 3300013105 Bacteria 45670
35 Ga0157369_10028736 3300013105 Bacteria 6150
36 Ga0157369_10073115 3300013105 Bacteria 3679
37 Ga0157369_10206566 3300013105 Bacteria 2060
38 Ga0163162_10079359 3300013306 Bacteria 3349
39 Ga0163162_10222733 3300013306 Bacteria 2016
40 Ga0157372_10102050 3300013307 Bacteria 3276
41 Ga0157372_10290365 3300013307 Bacteria 1902
42 Ga0157380_10083368 3300014326 Bacteria 2619
43 Ga0163161_10241790 3300017792 Bacteria 1404
44 Ga0206354_11422283 3300020081 Bacteria 1112
45 Ga0206353_10028762 3300020082 Bacteria 4142
46 Ga0209147_100847 3300025229 Bacteria 14356
47 Ga0207427_100099 3300025231 Bacteria 121767
48 Ga0209437_100360 3300025233 Bacteria 50855
49 Ga0209646_1000098 3300025246 Bacteria 180711
50 Ga0209233_1000001 3300025261 Bacteria 2992747
51 Ga0207655_1003512 3300025728 Bacteria 11627
52 Ga0207705_10058703 3300025909 Bacteria 2776
53 Ga0207664_10003068 3300025929 Bacteria 11095
54 Ga0207709_10077988 3300025935 Bacteria 2125
55 Ga0207709_10256718 3300025935 Bacteria 1279
56 Ga0209813_10004265 3300027866 Bacteria 3401
57 Ga0307408_100253040 3300031548 Bacteria 1454
58 Ga0307405_10078997 3300031731 Bacteria 2143
59 Ga0307406_10001104 3300031901 Bacteria 15047
60 Ga0307406_10007875 3300031901 Bacteria 5932
61 Ga0307412_10016768 3300031911 Bacteria 4372
62 Ga0307409_100648033 3300031995 Bacteria 1050
63 Ga0307414_10240219 3300032004 Bacteria 1499
64 Ga0307414_10489065 3300032004 Bacteria 1087
65 Ga0395898_0000131 3300037466 Bacteria 192369
66 Ga0395898_0115420 3300037466 Bacteria 2573
67 Ga0395901_0645411 3300038443 Bacteria 1062
68 Ga0451789_0335517 3300041443 Bacteria 903
69 Ga0451791_1659240 3300041451 Bacteria 1179
70 Ga0451795_1624542 3300041456 Bacteria 1307
71 Ga0451806_359850 3300041462 Bacteria 1221
72 Ga0451837_0239383 3300041494 Bacteria 1794
73 Ga0439449_0088987 3300042007 Bacteria 1140
74 Ga0466972_0088303 3300044658 Bacteria 1472
75 Ga0466965_0089022 3300044683 Bacteria 1568
76 Ga0466968_0131434 3300044735 Bacteria 1139
77 Ga0466970_0000558 3300044765 Bacteria 18194
78 Ga0466960_0105975 3300044901 Bacteria 1454
79 Ga0466967_0222489 3300045976 Bacteria 1794
80 Ga0495627_001707 3300046453 Bacteria 12003
81 Ga0495645_0080139 3300046543 Bacteria 2344
82 Ga0495681_0045726 3300047470 Bacteria 2093
83 Ga0495686_0130128 3300047472 Bacteria 1493
84 Ga0496101_0012673 3300048904 Bacteria 5634
85 Ga0496101_0184862 3300048904 Bacteria 1606
86 Ga0496102_0040750 3300048905 Bacteria 4203
87 Ga0496104_0145225 3300048907 Bacteria 2278
88 Ga0496104_0153591 3300048907 Bacteria 2209
89 Ga0496104_0211057 3300048907 Bacteria 1853
90 Ga0496105_0069985 3300048908 Bacteria 2900
91 Ga0496105_0155865 3300048908 Bacteria 1876
92 Ga0496107_0103447 3300048910 Bacteria 2089
93 Ga0496108_0000034 3300048911 Bacteria 157614
94 Ga0496109_0007755 3300048912 Bacteria 9090
95 Ga0496109_0431696 3300048912 Bacteria 1244
96 Ga0496110_0359225 3300048913 Bacteria 1327
97 Ga0496112_0089687 3300048915 Bacteria 3043
98 Ga0496113_0124733 3300048916 Bacteria 2016
99 Ga0496114_0009976 3300048917 Bacteria 7550
100 Ga0496114_0036278 3300048917 Bacteria 4074
101 Ga0496114_0070266 3300048917 Bacteria 2940
102 Ga0496114_0211105 3300048917 Bacteria 1703
103 Ga0496114_0279454 3300048917 Bacteria 1472
104 Ga0496114_0296809 3300048917 Bacteria 1426
105 Ga0496115_0096794 3300048918 Bacteria 2417
106 Ga0496115_0132147 3300048918 Bacteria 2057
107 Ga0496115_0257797 3300048918 Bacteria 1434
108 Ga0496115_0391042 3300048918 Bacteria 1129
109 Ga0496115_0496845 3300048918 Bacteria 981
110 Ga0496115_0609470 3300048918 Bacteria 867
111 Ga0496117_0000028 3300048920 Bacteria 407392
112 Ga0496117_0004308 3300048920 Bacteria 15841
113 Ga0496117_0077879 3300048920 Bacteria 2191
114 Ga0496118_0005737 3300048921 Bacteria 13968
115 Ga0496118_0043545 3300048921 Bacteria 3526
116 Ga0496119_0002984 3300048922 Bacteria 17964
117 Ga0496119_0005398 3300048922 Bacteria 12278
118 Ga0496119_0005762 3300048922 Bacteria 11735
119 Ga0496119_0006986 3300048922 Bacteria 10287
120 Ga0496119_0024624 3300048922 Bacteria 4228
121 Ga0496119_0034473 3300048922 Bacteria 3333
122 Ga0496120_0003107 3300048923 Bacteria 15604
123 Ga0496120_0005308 3300048923 Bacteria 10332
124 Ga0496120_0011258 3300048923 Bacteria 6166
125 Ga0496120_0035106 3300048923 Bacteria 2998
126 Ga0496120_0043943 3300048923 Bacteria 2600
127 Ga0496122_0000055 3300048925 Bacteria 258485
128 Ga0496122_0000377 3300048925 Bacteria 95371
129 Ga0496122_0028807 3300048925 Bacteria 4700
130 Ga0496122_0041877 3300048925 Bacteria 3612
131 Ga0496122_0054563 3300048925 Bacteria 3000
132 Ga0496122_0107209 3300048925 Bacteria 1847
133 Ga0496122_0169514 3300048925 Bacteria 1318
134 Ga0496123_0000003 3300048926 Bacteria 866556
135 Ga0496123_0000169 3300048926 Bacteria 130983
136 Ga0496123_0002373 3300048926 Bacteria 23616
137 Ga0496123_0032946 3300048926 Bacteria 3738
138 Ga0496124_0001749 3300048927 Bacteria 30385
139 Ga0496124_0015007 3300048927 Bacteria 7456
140 Ga0496124_0031101 3300048927 Bacteria 4729
141 Ga0496124_0056862 3300048927 Bacteria 3298
142 Ga0496124_0057134 3300048927 Bacteria 3289
143 Ga0496125_0000120 3300048928 Bacteria 175991
144 Ga0496125_0002995 3300048928 Bacteria 21140
145 Ga0496125_0005171 3300048928 Bacteria 14672
146 Ga0496125_0011301 3300048928 Bacteria 8947
147 Ga0496125_0015940 3300048928 Bacteria 7238
148 Ga0496125_0020710 3300048928 Bacteria 6167
149 Ga0496125_0099353 3300048928 Bacteria 2150
150 Ga0496125_0192977 3300048928 Bacteria 1343
151 Ga0496125_0228597 3300048928 Bacteria 1192
152 Ga0496126_0000436 3300048929 Bacteria 83469
153 Ga0496126_0006051 3300048929 Bacteria 13576
154 Ga0496126_0020565 3300048929 Bacteria 6464
155 Ga0496126_0021079 3300048929 Bacteria 6374
156 Ga0496126_0037717 3300048929 Bacteria 4506
157 Ga0496126_0172920 3300048929 Bacteria 1839
158 Ga0496126_0280709 3300048929 Bacteria 1380
159 Ga0496126_0406421 3300048929 Bacteria 1103
160 Ga0501033_0521048 3300049570 Bacteria 821
161 Ga0501034_0000851 3300049571 Bacteria 45168
162 Ga0501034_0099463 3300049571 Bacteria 2903
163 Ga0501038_0130356 3300049574 Bacteria 2065
164 Ga0501038_0156595 3300049574 Bacteria 1855
165 Ga0501039_0796655 3300049575 Bacteria 737
166 Ga0501070_0000483 3300049586 Bacteria 36192
167 Ga0501070_0001533 3300049586 Bacteria 20556
168 nmdc:mga03n38_18658_c1 3300050490 Bacteria 2742
169 nmdc:mga00v17_113952_c1 3300050491 Bacteria 1717
170 nmdc:mga00v17_146928_c1 3300050491 Bacteria 1513
171 nmdc:mga00v17_1824_c1 3300050491 Bacteria 8619
172 nmdc:mga0yw44_39997_c1 3300050492 Bacteria 2783
173 nmdc:mga0yw44_59325_c1 3300050492 Bacteria 2341
174 nmdc:mga06z11_12419_c1 3300050494 Bacteria 3704
175 nmdc:mga04h51_1683_c1 3300050495 Bacteria 5158
176 nmdc:mga07m45_26245_c2 3300050496 Bacteria 2606
177 nmdc:mga0sz30_27143_c1 3300050516 Bacteria 2350
178 nmdc:mga0sz30_4543_c2 3300050516 Bacteria 2463
179 Ga0500635_0000015 3300053080 Bacteria 125195
180 2587863049 2585428094 Bacteria 3604039
181 2588106658 2585428157 Bacteria 3018951
182 2643734063 2643221542 Bacteria 3563959
183 2643754117 2643221546 Bacteria 2910897
184 2643785375 2643221553 Bacteria 3544260
185 2643849468 2643221566 Bacteria 3460379
186 2643996305 2643221597 Bacteria 3347721
187 2644095393 2643221616 Bacteria 4066575
188 2644170651 2643221630 Bacteria 3601215
189 2644184018 2643221632 Bacteria 3406696
190 2644277430 2643221649 Bacteria 3867359
191 2644679727 2643221724 Bacteria 3593515
192 2730229254 2728369380 Bacteria 3620317
193 2747953337 2747842429 Bacteria 3914386
194 2758224316 2757320536 Bacteria 3629334
195 2774381414 2773857758 Bacteria 3592392
196 2774383746 2773857759 Bacteria 2963774
197 2774400111 2773857763 Bacteria 4180068
198 2808631656 2808606306 Bacteria 3608896
199 2808885150 2808606368 Bacteria 3174172
200 2809226943 2808606447 Bacteria 3572005
201 2812322543 2811994872 Bacteria 4121241
202 2821269469 2821268502 Bacteria 3750023
203 2833710370 2833709550 Bacteria 4008291
204 2852633134 2852632344 Bacteria 3463163
205 2852646965 2852646457 Bacteria 3408613
206 2852664825 2852663356 Bacteria 4090475
207 2857722591 2857720070 Bacteria 3189373
208 2857723418 2857723135 Bacteria 4217853
209 2857732357 2857729791 Bacteria 4040535
210 2857734763 2857733635 Bacteria 3532004
211 2870629817 2870628048 Bacteria 3696012
212 2884764767 2884763398 Bacteria 4091164
213 2904509905 2904509784 Bacteria 3520416
214 2906801140 2906799679 Bacteria 4031749
215 2908678882 2908678064 Bacteria 3482747
216 2919071233 2919069694 Bacteria 3622919
217 2919396937 2919395869 Bacteria 3704152
218 2928091298 2928090899 Bacteria 3158267
219 2928124751 2928121344 Bacteria 3972376
220 2939663526 2939660829 Bacteria 3784848
221 2945971416 2945968032 Bacteria 4111363
222 2946034179 2946033335 Bacteria 3835514
223 2946043750 2946041624 Bacteria 4191385
224 2946081336 2946080515 Bacteria 4310960
225 2966921659 2966921586 Bacteria 3092803
226 2974297935 2974294766 Bacteria 3767688
227 2974325826 2974324384 Bacteria 3750535
228 2977230784 2977228692 Bacteria 3450105
229 2977239578 2977236895 Bacteria 3569373
230 2977251745 2977251589 Bacteria 2952848
231 2977266010 2977264416 Bacteria 3750737
232 2984546152 2984542743 Bacteria 3569378
233 2984581951 2984580707 Bacteria 3351387
234 8004185519 8004182704 Bacteria 3391155
235 8004214593 8004212874 Bacteria 2861420
236 8016254593 8016254467 Bacteria 3797036
237 8045832601 8045830549 Bacteria 4444727
238 Ga0171462_1001
239 JGI25154J39366_1006860
240 JGI25164J39214_1000498
241 JGI25165J46597_1000002
242 Ga0006562J51391_1010188
243 Ga0006562J51391_1010192
244 Ga0065714_10129394
245 Ga0065714_10147868
246 Ga0070658_10008436
247 Ga0070660_100136156
248 Ga0070674_100666370
249 Ga0070713_100328473
250 Ga0068853_100378843
251 Ga0068856_100579518
252 Ga0070702_100024368
253 Ga0070717_10069368
254 Ga0075368_10006755
255 Ga0075363_100100496
256 Ga0075364_10003628
257 Ga0075364_10004659
258 Ga0075364_10026835
259 Ga0075364_10126940
260 Ga0075364_10366062
261 Ga0075367_10013111
262 Ga0075369_10006437
263 Ga0075370_10032520
264 Ga0075370_10118952
265 Ga0105244_10059185
266 Ga0105243_10009163
267 Ga0105243_10107940
268 Ga0105243_10137212
269 Ga0157371_10001372
270 Ga0157371_10066512
271 Ga0157369_10000631
272 Ga0157369_10028736
273 Ga0157369_10073115
274 Ga0157369_10206566
275 Ga0163162_10079359
276 Ga0163162_10222733
277 Ga0157372_10102050
278 Ga0157372_10290365
279 Ga0157380_10083368
280 Ga0163161_10241790
281 Ga0206354_11422283
282 Ga0206353_10028762
283 Ga0209147_100847
284 Ga0207427_100099
285 Ga0209437_100360
286 Ga0209646_1000098
287 Ga0209233_1000001
288 Ga0207655_1003512
289 Ga0207705_10058703
290 Ga0207664_10003068
291 Ga0207709_10077988
292 Ga0207709_10256718
293 Ga0209813_10004265
294 Ga0307408_100253040
295 Ga0307405_10078997
296 Ga0307406_10001104
297 Ga0307406_10007875
298 Ga0307412_10016768
299 Ga0307409_100648033
300 Ga0307414_10240219
301 Ga0307414_10489065
302 Ga0395898_0000131
303 Ga0395898_0115420
304 Ga0395901_0645411
305 Ga0451789_0335517
306 Ga0451791_1659240
307 Ga0451795_1624542
308 Ga0451806_359850
309 Ga0451837_0239383
310 Ga0439449_0088987
311 Ga0466972_0088303
312 Ga0466965_0089022
313 Ga0466968_0131434
314 Ga0466970_0000558
315 Ga0466960_0105975
316 Ga0466967_0222489
317 Ga0495627_001707
318 Ga0495645_0080139
319 Ga0495681_0045726
320 Ga0495686_0130128
321 Ga0496101_0012673
322 Ga0496101_0184862
323 Ga0496102_0040750
324 Ga0496104_0145225
325 Ga0496104_0153591
326 Ga0496104_0211057
327 Ga0496105_0069985
328 Ga0496105_0155865
329 Ga0496107_0103447
330 Ga0496108_0000034
331 Ga0496109_0007755
332 Ga0496109_0431696
333 Ga0496110_0359225
334 Ga0496112_0089687
335 Ga0496113_0124733
336 Ga0496114_0009976
337 Ga0496114_0036278
338 Ga0496114_0070266
339 Ga0496114_0211105
340 Ga0496114_0279454
341 Ga0496114_0296809
342 Ga0496115_0096794
343 Ga0496115_0132147
344 Ga0496115_0257797
345 Ga0496115_0391042
346 Ga0496115_0496845
347 Ga0496115_0609470
348 Ga0496117_0000028
349 Ga0496117_0004308
350 Ga0496117_0077879
351 Ga0496118_0005737
352 Ga0496118_0043545
353 Ga0496119_0002984
354 Ga0496119_0005398
355 Ga0496119_0005762
356 Ga0496119_0006986
357 Ga0496119_0024624
358 Ga0496119_0034473
359 Ga0496120_0003107
360 Ga0496120_0005308
361 Ga0496120_0011258
362 Ga0496120_0035106
363 Ga0496120_0043943
364 Ga0496122_0000055
365 Ga0496122_0000377
366 Ga0496122_0028807
367 Ga0496122_0041877
368 Ga0496122_0054563
369 Ga0496122_0107209
370 Ga0496122_0169514
371 Ga0496123_0000003
372 Ga0496123_0000169
373 Ga0496123_0002373
374 Ga0496123_0032946
375 Ga0496124_0001749
376 Ga0496124_0015007
377 Ga0496124_0031101
378 Ga0496124_0056862
379 Ga0496124_0057134
380 Ga0496125_0000120
381 Ga0496125_0002995
382 Ga0496125_0005171
383 Ga0496125_0011301
384 Ga0496125_0015940
385 Ga0496125_0020710
386 Ga0496125_0099353
387 Ga0496125_0192977
388 Ga0496125_0228597
389 Ga0496126_0000436
390 Ga0496126_0006051
391 Ga0496126_0020565
392 Ga0496126_0021079
393 Ga0496126_0037717
394 Ga0496126_0172920
395 Ga0496126_0280709
396 Ga0496126_0406421
397 Ga0501033_0521048
398 Ga0501034_0000851
399 Ga0501034_0099463
400 Ga0501038_0130356
401 Ga0501038_0156595
402 Ga0501039_0796655
403 Ga0501070_0000483
404 Ga0501070_0001533
405 nmdc:mga03n38_18658_c1
406 nmdc:mga00v17_113952_c1
407 nmdc:mga00v17_146928_c1
408 nmdc:mga00v17_1824_c1
409 nmdc:mga0yw44_39997_c1
410 nmdc:mga0yw44_59325_c1
411 nmdc:mga06z11_12419_c1
412 nmdc:mga04h51_1683_c1
413 nmdc:mga07m45_26245_c2
414 nmdc:mga0sz30_27143_c1
415 nmdc:mga0sz30_4543_c2
416 Ga0500635_0000015
417 2587863049
418 2588106658
419 2643734063
420 2643754117
421 2643785375
422 2643849468
423 2643996305
424 2644095393
425 2644170651
426 2644184018
427 2644277430
428 2644679727
429 2730229254
430 2747953337
431 2758224316
432 2774381414
433 2774383746
434 2774400111
435 2808631656
436 2808885150
437 2809226943
438 2812322543
439 2821269469
440 2833710370
441 2852633134
442 2852646965
443 2852664825
444 2857722591
445 2857723418
446 2857732357
447 2857734763
448 2870629817
449 2884764767
450 2904509905
451 2906801140
452 2908678882
453 2919071233
454 2919396937
455 2928091298
456 2928124751
457 2939663526
458 2945971416
459 2946034179
460 2946043750
461 2946081336
462 2966921659
463 2974297935
464 2974325826
465 2977230784
466 2977239578
467 2977251745
468 2977266010
469 2984546152
470 2984581951
471 8004185519
472 8004214593
473 8016254593
474 8045832601

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01553

Acyltransferase

Acyltransferase

78

205

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7nnt-assembly1.cif.gz_B cryo-em structure of the folate-specific ecf transporter complex in ddm micelles 0.719 117 170
5kym-assembly1.cif.gz_A crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.6857 22 229
5kym-assembly2.cif.gz_B crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.6666 23 232
5lj6-assembly1.cif.gz_A structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p6522) 0.6609 116 170
8e50-assembly1.cif.gz_A cryo-em structure of human glycerol-3-phosphate acyltransferase 1 (gpat1) in complex with coa and palmitoyl-lpa 0.653 28 206
ID Description Score Start End Superfamily
af_O53516_20_152_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8896 42 170 3.40.50.2000
af_O53516_20_152_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8591 42 170 3.40.50.2000
af_Q8GXU8_180_307_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8345 44 170 3.40.50.2000
af_O07809_23_150_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8078 46 170 3.40.50.2000
af_Q54EU4_95_228_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7995 55 170 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A1G9UC27-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9614 30 242 GO:0003841
GO:0005886
GO:0006654
AF-A0A2N1JM31-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9549 32 259 GO:0003841
GO:0005886
GO:0006654
AF-A0A1G9UC27-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9482 30 242 GO:0003841
GO:0005886
GO:0006654
AF-C5C5G9-F1-model_v4 Phospholipid/glycerol acyltransferase 0.9477 25 238 GO:0003841
GO:0005886
GO:0006654
AF-A0A1M6VKN3-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9473 26 243 GO:0003841
GO:0005886
GO:0006654

Map