F349830

General Info

Members Datasets Scaffolds Average Seq Length
237 185 158 186

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100073764|Ga0070665_1000737644
Length 208
Sequence MTIIMIGFKYDSHHVNVNDHVGRIVKMKVSREQMAENRRRILDVASRLFRDKGFDAVSVAEVMKAAGLTHGGFYGHFSSKDDLVAETLAHALASDSVGGGNFSDFVKSYLAPRHRDNAAGGCPTAGLAAAIRHQTPPARSAMTEGLRAQISRIEKALPQLDPADRRRTAIGSWAAMVGAVILARAIDDPELSDEILEQTHAWIDNSIS

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
3 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
4 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
5 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
6 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
7 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
8 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
9 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
10 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
11 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
12 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
13 2643221568 Rhizobium sp. Root564 Isolate Unclassified
14 2643221593 Lysobacter sp. Root690 Isolate Unclassified
15 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
16 2643221693 Rhizobium sp. Root491 Isolate Unclassified
17 2643221719 Rhizobium sp. Root274 Isolate Unclassified
18 2643221723 Ensifer sp. Root278 Isolate Unclassified
19 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
20 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
21 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
22 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
23 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
24 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
25 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
26 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
27 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
28 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
29 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
30 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
31 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
32 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
33 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
34 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
35 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
36 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
37 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
38 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
39 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
40 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
41 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
42 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
43 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
44 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
45 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
46 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
47 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
48 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
49 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
50 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
51 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
52 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
53 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
54 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
55 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
56 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
57 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
58 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
59 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
60 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
61 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
62 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
63 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
64 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
65 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
66 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
67 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
68 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
69 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
70 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
71 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
72 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
73 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
74 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
75 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
76 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
77 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
78 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
79 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
80 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
81 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
82 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
83 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
84 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
85 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
86 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
87 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
88 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
98 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
99 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
100 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
101 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
108 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
117 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
118 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
119 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
120 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
123 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
124 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
125 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
126 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
128 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
129 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
130 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
131 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
132 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
133 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
134 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
135 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
136 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
137 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
138 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
139 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
140 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
141 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
142 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
143 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
144 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
145 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
146 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
147 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
148 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
149 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
150 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
151 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
152 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
153 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
154 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
155 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
156 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
157 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
158 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
159 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
162 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
163 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
164 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
165 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
166 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
167 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
168 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
169 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
170 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
171 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
172 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
173 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
174 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
175 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
176 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
177 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
178 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
179 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
180 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
181 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
182 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
183 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
184 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
185 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 66.67
Metatranscriptomes 0
Isolates 33.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 29.11
Nodule 17.3
Rhizoplane 1.27
Rhizosphere 24.89
Stem 0
Stem Tuber 0
Unclassified 27.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000148 3300003187 Bacteria 92040
2 JGI25151J46595_10000373 3300003187 Bacteria 46885
3 JGI25165J46597_1020118 3300003214 Bacteria 876
4 Ga0055526_1000032 3300003771 Bacteria 143118
5 Ga0055526_1001636 3300003771 Bacteria 15732
6 Ga0055537_1000308 3300003773 Bacteria 33643
7 Ga0055524_1000054 3300003775 Bacteria 143118
8 Ga0055524_1043893 3300003775 Bacteria 1093
9 Ga0055536_1004041 3300003781 Bacteria 7639
10 Ga0055536_1009025 3300003781 Bacteria 4194
11 Ga0055534_1000224 3300003784 Bacteria 41130
12 Ga0055528_1000021 3300003790 Bacteria 143118
13 Ga0055530_10037580 3300003791 Bacteria 1210
14 Ga0055531_10000965 3300003794 Bacteria 23016
15 Ga0055531_10003972 3300003794 Bacteria 9174
16 Ga0070670_100002591 3300005331 Bacteria 14942
17 Ga0070665_100073764 3300005548 Bacteria 3418
18 Ga0075364_10032961 3300006051 Bacteria 3332
19 Ga0075364_10093725 3300006051 Bacteria 1994
20 Ga0075364_10429824 3300006051 Bacteria 902
21 Ga0075362_10004176 3300006177 Bacteria 5152
22 Ga0075367_10007813 3300006178 Bacteria 5501
23 Ga0075369_10000717 3300006186 Bacteria 10677
24 Ga0075369_10033318 3300006186 Bacteria 2183
25 Ga0075369_10079257 3300006186 Bacteria 1455
26 Ga0075366_10153401 3300006195 Bacteria 1395
27 Ga0105243_10080694 3300009148 Bacteria 2654
28 Ga0105248_10267576 3300009177 Bacteria 1924
29 Ga0105237_10818146 3300009545 Bacteria 938
30 Ga0105246_10242521 3300011119 Bacteria 1426
31 Ga0157373_10006868 3300013100 Bacteria 8472
32 Ga0157371_10000031 3300013102 Bacteria 230441
33 Ga0157371_10004697 3300013102 Bacteria 11803
34 Ga0157370_10056689 3300013104 Bacteria 3729
35 Ga0182008_10169713 3300014497 Bacteria 1101
36 Ga0183360_10001 3300015689 Bacteria 3943671
37 Ga0213872_10293758 3300021361 Bacteria 676
38 Ga0207425_1001459 3300025245 Bacteria 9875
39 Ga0209233_1004005 3300025261 Bacteria 5103
40 Ga0209565_1000001 3300025263 Bacteria 2950419
41 Ga0209565_1004007 3300025263 Bacteria 4595
42 Ga0209673_1000001 3300025273 Bacteria 3176258
43 Ga0209673_1074373 3300025273 Bacteria 798
44 Ga0209675_1000001 3300025291 Bacteria 2950293
45 Ga0209676_1002653 3300025292 Bacteria 12156
46 Ga0209025_1000005 3300025294 Bacteria 1272149
47 Ga0209025_1000969 3300025294 Bacteria 43045
48 Ga0209564_1000001 3300025295 Bacteria 3176258
49 Ga0209564_1000692 3300025295 Bacteria 49341
50 Ga0209758_1016229 3300025297 Bacteria 3796
51 Ga0209050_1014799 3300025298 Bacteria 3331
52 Ga0209256_1000002 3300025299 Bacteria 1906740
53 Ga0209256_1002119 3300025299 Bacteria 17238
54 Ga0209051_1007607 3300025303 Bacteria 5897
55 Ga0209257_1002219 3300025304 Bacteria 19974
56 Ga0207650_10003085 3300025925 Bacteria 11473
57 Ga0207711_10513143 3300025941 Bacteria 1118
58 Ga0207675_100276676 3300026118 Bacteria 1630
59 Ga0268266_10055740 3300028379 Bacteria 3398
60 Ga0307515_10000420 3300028794 Bacteria 102216
61 Ga0316181_1190811 3300030744 Bacteria 2380
62 Ga0307513_10010326 3300031456 Bacteria 11710
63 Ga0307508_10000637 3300031616 Bacteria 42208
64 Ga0307508_10208133 3300031616 Bacteria 1556
65 Ga0307516_10204552 3300031730 Bacteria 1692
66 Ga0307410_10766184 3300031852 Bacteria 818
67 Ga0307406_10000616 3300031901 Bacteria 20312
68 Ga0316583_10061834 3300032133 Unclassified 1312
69 Ga0307510_10107929 3300033180 Bacteria 2540
70 Ga0373927_0000706 3300035695 Bacteria 25593
71 Ga0373925_0000597 3300037068 Bacteria 34700
72 Ga0395899_0000018 3300037312 Bacteria 423194
73 Ga0436361_1177045 3300039447 Unclassified 2580
74 Ga0439438_021584 3300041405 Bacteria 1794
75 Ga0439439_0015969 3300041406 Bacteria 1836
76 Ga0439466_0034374 3300041411 Bacteria 1719
77 Ga0439465_0000386 3300041413 Bacteria 12739
78 Ga0439445_0040177 3300042004 Bacteria 1241
79 Ga0439452_065532 3300042010 Bacteria 807
80 Ga0439462_0147443 3300042015 Bacteria 660
81 Ga0439434_0031959 3300042435 Bacteria 1601
82 Ga0439435_0017254 3300042436 Bacteria 1822
83 Ga0439459_0065405 3300042438 Bacteria 830
84 Ga0450918_011558 3300042531 Bacteria 1538
85 Ga0495627_064831 3300046453 Bacteria 1074
86 Ga0495638_0010122 3300046460 Bacteria 6569
87 Ga0495632_0099066 3300046519 Bacteria 1375
88 Ga0495643_0101064 3300046522 Bacteria 1478
89 Ga0495633_0007118 3300046558 Bacteria 6500
90 Ga0495668_0011978 3300046616 Bacteria 5163
91 Ga0495625_0001248 3300046660 Bacteria 32129
92 Ga0495625_0110789 3300046660 Bacteria 1876
93 Ga0495681_0041573 3300047470 Bacteria 2231
94 Ga0496113_0042340 3300048916 Bacteria 3365
95 Ga0496116_0013697 3300048919 Bacteria 6520
96 Ga0496116_0256504 3300048919 Bacteria 866
97 Ga0496117_0000030 3300048920 Bacteria 389141
98 Ga0496117_0011425 3300048920 Bacteria 7954
99 Ga0496117_0041281 3300048920 Bacteria 3383
100 Ga0496118_0000938 3300048921 Bacteria 45493
101 Ga0496118_0016837 3300048921 Bacteria 6681
102 Ga0496119_0089823 3300048922 Bacteria 1748
103 Ga0496119_0201128 3300048922 Bacteria 1031
104 Ga0496120_0000986 3300048923 Bacteria 38646
105 Ga0496120_0015235 3300048923 Bacteria 5082
106 Ga0496120_0200317 3300048923 Bacteria 967
107 Ga0496121_0000174 3300048924 Bacteria 143186
108 Ga0496121_0007358 3300048924 Bacteria 13309
109 Ga0496121_0444754 3300048924 Bacteria 837
110 Ga0496121_0589434 3300048924 Bacteria 688
111 Ga0496122_0000076 3300048925 Bacteria 218690
112 Ga0496122_0018269 3300048925 Bacteria 6491
113 Ga0496122_0024578 3300048925 Bacteria 5267
114 Ga0496122_0130322 3300048925 Bacteria 1600
115 Ga0496123_0000023 3300048926 Bacteria 346894
116 Ga0496123_0020443 3300048926 Bacteria 5178
117 Ga0496123_0050644 3300048926 Bacteria 2773
118 Ga0496123_0081834 3300048926 Bacteria 1960
119 Ga0496124_0001736 3300048927 Bacteria 30598
120 Ga0496124_0003569 3300048927 Bacteria 18917
121 Ga0496124_0013980 3300048927 Bacteria 7791
122 Ga0496124_0107690 3300048927 Bacteria 2248
123 Ga0496124_0213238 3300048927 Bacteria 1459
124 Ga0496125_0000982 3300048928 Bacteria 44569
125 Ga0496125_0008593 3300048928 Bacteria 10662
126 Ga0496125_0014004 3300048928 Bacteria 7843
127 Ga0496125_0093173 3300048928 Bacteria 2249
128 Ga0496125_0517635 3300048928 Bacteria 668
129 Ga0496126_0000069 3300048929 Bacteria 246935
130 Ga0496126_0070186 3300048929 Bacteria 3122
131 Ga0501044_0330690 3300049823 Bacteria 1447
132 nmdc:mga03683_4797_c1 3300050489 Bacteria 4516
133 nmdc:mga03683_50033_c1 3300050489 Bacteria 1741
134 nmdc:mga00v17_251549_c1 3300050491 Bacteria 1146
135 nmdc:mga00v17_4_c1 3300050491 Bacteria 238758
136 nmdc:mga0k408_153057_c1 3300050493 Bacteria 1374
137 nmdc:mga07m45_138781_c1 3300050496 Bacteria 1408
138 nmdc:mga0sz30_1202_c1 3300050516 Bacteria 9297
139 nmdc:mga0sz30_34212_c2 3300050516 Bacteria 1469
140 nmdc:mga0sz30_718_c1 3300050516 Bacteria 12197
141 Ga0500610_0130674 3300053079 Bacteria 1277
142 Ga0500578_0389315 3300053086 Bacteria 806
143 Ga0500644_0027622 3300053088 Bacteria 1767
144 Ga0500644_0107718 3300053088 Bacteria 1069
145 Ga0500646_0114278 3300053090 Bacteria 862
146 Ga0500557_001529 3300053105 Bacteria 3827
147 Ga0500560_021620 3300053107 Bacteria 1841
148 Ga0500569_004382 3300053109 Bacteria 2963
149 Ga0500594_0003217 3300053118 Bacteria 3578
150 Ga0500658_0005297 3300053134 Bacteria 4795
151 Ga0500658_0009713 3300053134 Bacteria 3546
152 Ga0500561_0000073 3300053137 Bacteria 19888
153 Ga0500568_0020935 3300053139 Bacteria 2821
154 Ga0500568_0077286 3300053139 Bacteria 1267
155 Ga0500588_0003264 3300053146 Bacteria 3403
156 Ga0500604_0077326 3300053151 Bacteria 1070
157 Ga0500622_0000290 3300053156 Bacteria 51286
158 Ga0500636_0171329 3300053177 Unclassified 1174

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009545 Ga0105237_10818146 Ga0105237_108181461 165
2 3300053134 Ga0500658_0009713 Ga0500658_0009713_385_966 165
3 3300053151 Ga0500604_0077326 Ga0500604_0077326_495_1058 165
4 3300046453 Ga0495627_064831 Ga0495627_064831_489_1052 166
5 3300047470 Ga0495681_0041573 Ga0495681_0041573_389_949 166
6 3300053134 Ga0500658_0005297 Ga0500658_0005297_3083_3643 166
7 3300053139 Ga0500568_0020935 Ga0500568_0020935_1800_2363 171
8 iso_pu_bacteria 2643221547 2643756684 173
9 3300003781 Ga0055536_1009025 Ga0055536_10090254 174
10 3300053088 Ga0500644_0107718 Ga0500644_0107718_431_994 175
11 3300053146 Ga0500588_0003264 Ga0500588_0003264_1490_2110 175
12 3300003214 JGI25165J46597_1020118 JGI25165J46597_10201181 177
13 3300021361 Ga0213872_10293758 Ga0213872_102937582 177
14 3300025261 Ga0209233_1004005 Ga0209233_10040056 177
15 3300039447 Ga0436361_1177045 Ga0436361_1177045_1610_2143 177
16 3300049823 Ga0501044_0330690 Ga0501044_0330690_64_606 177
17 iso_pu_bacteria 2510461069 2510842729 177
18 iso_pu_bacteria 2516653046 2516897872 177
19 iso_pu_bacteria 2516653046 2516898286 177
20 iso_pu_bacteria 2558860242 2559297390 177
21 iso_pu_bacteria 2600255279 2601612342 177
22 iso_pu_bacteria 2600255308 2601749254 177
23 iso_pu_bacteria 2643221568 2643857843 177
24 iso_pu_bacteria 2643221653 2644297029 177
25 iso_pu_bacteria 2643221719 2644655282 177
26 iso_pu_bacteria 2643221723 2644672139 177
27 iso_pu_bacteria 2738543031 2739351634 177
28 iso_pu_bacteria 2758568016 2758638405 177
29 iso_pu_bacteria 2808606387 2808989609 177
30 iso_pu_bacteria 2838736955 2838741821 177
31 iso_pu_bacteria 2841840854 2841845763 177
32 iso_pu_bacteria 2841846520 2841850301 177
33 iso_pu_bacteria 2842124991 2842128774 177
34 iso_pu_bacteria 2842140634 2842145467 177
35 iso_pu_bacteria 2842521101 2842526859 177
36 iso_pu_bacteria 2899803654 2899806877 177
37 iso_pu_bacteria 2899845264 2899847446 177
38 iso_pu_bacteria 2916021584 2916028348 177
39 iso_pu_bacteria 2919114240 2919117672 177
40 iso_pu_bacteria 2926754445 2926755201 177
41 iso_pu_bacteria 2926760298 2926764360 177
42 iso_pu_bacteria 2929138655 2929140293 177
43 iso_pu_bacteria 2933594066 2933598580 177
44 iso_pu_bacteria 2941499720 2941506841 177
45 iso_pu_bacteria 2964636051 2964639888 177
46 iso_pu_bacteria 2979089926 2979090536 177
47 iso_pu_bacteria 2979095461 2979096062 177
48 iso_pu_bacteria 3005416602 3005419386 177
49 iso_pu_bacteria 650716007 650843823 177
50 iso_pu_bacteria 8054460903 8054464946 177
51 3300006051 Ga0075364_10032961 Ga0075364_100329614 178
52 3300009177 Ga0105248_10267576 Ga0105248_102675763 178
53 3300053090 Ga0500646_0114278 Ga0500646_0114278_92_640 178
54 iso_pu_bacteria 2523231067 2523469693 178
55 iso_pu_bacteria 2657244999 2657682113 178
56 iso_pu_bacteria 2941489479 2941490506 178
57 3300028794 Ga0307515_10000420 Ga0307515_1000042083 180
58 3300031456 Ga0307513_10010326 Ga0307513_100103265 180
59 3300048925 Ga0496122_0130322 Ga0496122_0130322_678_1289 180
60 3300003187 JGI25151J46595_10000373 JGI25151J46595_1000037313 181
61 3300003771 Ga0055526_1001636 Ga0055526_100163612 181
62 3300003775 Ga0055524_1043893 Ga0055524_10438932 181
63 3300003781 Ga0055536_1004041 Ga0055536_10040414 181
64 3300003791 Ga0055530_10037580 Ga0055530_100375802 181
65 3300003794 Ga0055531_10003972 Ga0055531_100039729 181
66 3300005548 Ga0070665_100073764 Ga0070665_1000737644 181
67 3300006051 Ga0075364_10093725 Ga0075364_100937252 181
68 3300006051 Ga0075364_10429824 Ga0075364_104298241 181
69 3300006177 Ga0075362_10004176 Ga0075362_100041764 181
70 3300006178 Ga0075367_10007813 Ga0075367_100078133 181
71 3300006186 Ga0075369_10000717 Ga0075369_1000071712 181
72 3300006186 Ga0075369_10033318 Ga0075369_100333181 181
73 3300006186 Ga0075369_10079257 Ga0075369_100792572 181
74 3300006195 Ga0075366_10153401 Ga0075366_101534011 181
75 3300009148 Ga0105243_10080694 Ga0105243_100806943 181
76 3300011119 Ga0105246_10242521 Ga0105246_102425212 181
77 3300013100 Ga0157373_10006868 Ga0157373_100068682 181
78 3300013102 Ga0157371_10000031 Ga0157371_100000318 181
79 3300013102 Ga0157371_10004697 Ga0157371_100046974 181
80 3300013104 Ga0157370_10056689 Ga0157370_100566892 181
81 3300025273 Ga0209673_1074373 Ga0209673_10743731 181
82 3300025292 Ga0209676_1002653 Ga0209676_100265310 181
83 3300025294 Ga0209025_1000969 Ga0209025_100096943 181
84 3300025295 Ga0209564_1000692 Ga0209564_100069216 181
85 3300025298 Ga0209050_1014799 Ga0209050_10147995 181
86 3300025299 Ga0209256_1002119 Ga0209256_100211915 181
87 3300025303 Ga0209051_1007607 Ga0209051_10076073 181
88 3300025304 Ga0209257_1002219 Ga0209257_100221914 181
89 3300028379 Ga0268266_10055740 Ga0268266_100557404 181
90 3300030744 Ga0316181_1190811 Ga0316181_11908112 181
91 3300031730 Ga0307516_10204552 Ga0307516_102045522 181
92 3300031852 Ga0307410_10766184 Ga0307410_107661841 181
93 3300033180 Ga0307510_10107929 Ga0307510_101079292 181
94 3300035695 Ga0373927_0000706 Ga0373927_0000706_6470_7018 181
95 3300037068 Ga0373925_0000597 Ga0373925_0000597_12205_12753 181
96 3300042004 Ga0439445_0040177 Ga0439445_0040177_504_1052 181
97 3300046460 Ga0495638_0010122 Ga0495638_0010122_2987_3535 181
98 3300046522 Ga0495643_0101064 Ga0495643_0101064_567_1193 181
99 3300046558 Ga0495633_0007118 Ga0495633_0007118_4453_5007 181
100 3300048916 Ga0496113_0042340 Ga0496113_0042340_2256_2882 181
101 3300048919 Ga0496116_0013697 Ga0496116_0013697_2114_2740 181
102 3300048919 Ga0496116_0256504 Ga0496116_0256504_96_644 181
103 3300048920 Ga0496117_0000030 Ga0496117_0000030_380112_380738 181
104 3300048920 Ga0496117_0041281 Ga0496117_0041281_1444_1992 181
105 3300048921 Ga0496118_0000938 Ga0496118_0000938_8360_8986 181
106 3300048922 Ga0496119_0089823 Ga0496119_0089823_516_1142 181
107 3300048923 Ga0496120_0000986 Ga0496120_0000986_8329_8955 181
108 3300048924 Ga0496121_0444754 Ga0496121_0444754_275_823 181
109 3300048925 Ga0496122_0000076 Ga0496122_0000076_8372_8998 181
110 3300048925 Ga0496122_0018269 Ga0496122_0018269_2236_2784 181
111 3300048925 Ga0496122_0024578 Ga0496122_0024578_141_689 181
112 3300048926 Ga0496123_0000023 Ga0496123_0000023_337897_338523 181
113 3300048926 Ga0496123_0050644 Ga0496123_0050644_1677_2225 181
114 3300048926 Ga0496123_0081834 Ga0496123_0081834_753_1301 181
115 3300048927 Ga0496124_0013980 Ga0496124_0013980_4785_5411 181
116 3300048927 Ga0496124_0107690 Ga0496124_0107690_516_1064 181
117 3300048927 Ga0496124_0213238 Ga0496124_0213238_650_1240 181
118 3300048928 Ga0496125_0008593 Ga0496125_0008593_4754_5302 181
119 3300048928 Ga0496125_0014004 Ga0496125_0014004_3400_3948 181
120 3300048928 Ga0496125_0093173 Ga0496125_0093173_331_957 181
121 3300048928 Ga0496125_0517635 Ga0496125_0517635_49_597 181
122 3300048929 Ga0496126_0000069 Ga0496126_0000069_83127_83675 181
123 3300048929 Ga0496126_0070186 Ga0496126_0070186_224_772 181
124 3300050489 nmdc:mga03683_4797_c1 nmdc:mga03683_4797_c1_2003_2629 181
125 3300050489 nmdc:mga03683_50033_c1 nmdc:mga03683_50033_c1_1044_1592 181
126 3300050491 nmdc:mga00v17_4_c1 nmdc:mga00v17_4_c1_237461_238087 181
127 3300050493 nmdc:mga0k408_153057_c1 nmdc:mga0k408_153057_c1_680_1306 181
128 3300050496 nmdc:mga07m45_138781_c1 nmdc:mga07m45_138781_c1_701_1327 181
129 3300050516 nmdc:mga0sz30_1202_c1 nmdc:mga0sz30_1202_c1_1148_1726 181
130 3300050516 nmdc:mga0sz30_34212_c2 nmdc:mga0sz30_34212_c2_597_1145 181
131 3300050516 nmdc:mga0sz30_718_c1 nmdc:mga0sz30_718_c1_7400_8026 181
132 3300053088 Ga0500644_0027622 Ga0500644_0027622_402_956 181
133 3300053107 Ga0500560_021620 Ga0500560_021620_793_1347 181
134 3300053137 Ga0500561_0000073 Ga0500561_0000073_2255_2881 181
135 3300053139 Ga0500568_0077286 Ga0500568_0077286_585_1139 181
136 3300053156 Ga0500622_0000290 Ga0500622_0000290_13425_13979 181
137 iso_pu_bacteria 2508501050 2508730998 181
138 iso_pu_bacteria 2508501127 2509145514 181
139 iso_pu_bacteria 2524023250 2524613305 181
140 iso_pu_bacteria 2554235003 2554244775 181
141 iso_pu_bacteria 2582581299 2585233958 181
142 iso_pu_bacteria 2643221593 2643976678 181
143 iso_pu_bacteria 2643221693 2644523028 181
144 iso_pu_bacteria 2751185897 2753763068 181
145 iso_pu_bacteria 2841734538 2841735523 181
146 iso_pu_bacteria 2858800743 2858804869 181
147 iso_pu_bacteria 2871474448 2871476235 181
148 iso_pu_bacteria 2878788777 2878793944 181
149 iso_pu_bacteria 2899792073 2899794443 181
150 iso_pu_bacteria 2915986958 2915986981 181
151 iso_pu_bacteria 2916028427 2916028662 181
152 iso_pu_bacteria 2916055098 2916056052 181
153 iso_pu_bacteria 2921201388 2921205168 181
154 iso_pu_bacteria 2921263974 2921264286 181
155 iso_pu_bacteria 2924172951 2924179473 181
156 iso_pu_bacteria 2929138655 2929143798 181
157 iso_pu_bacteria 2937042894 2937047648 181
158 iso_pu_bacteria 2937071275 2937075851 181
159 iso_pu_bacteria 2937106411 2937106782 181
160 iso_pu_bacteria 2937126314 2937126586 181
161 iso_pu_bacteria 2937836603 2937842337 181
162 iso_pu_bacteria 2957457609 2957462273 181
163 iso_pu_bacteria 2957478035 2957478259 181
164 iso_pu_bacteria 2958071322 2958075480 181
165 iso_pu_bacteria 2964643177 2964644615 181
166 iso_pu_bacteria 2964705432 2964706869 181
167 iso_pu_bacteria 2967664464 2967664963 181
168 iso_pu_bacteria 2967775926 2967780357 181
169 iso_pu_bacteria 2970082768 2970086018 181
170 iso_pu_bacteria 8001845381 8001848203 181
171 iso_pu_bacteria 8004633249 8004639376 181
172 iso_pu_bacteria 8055617313 8055622573 181
173 3300003771 Ga0055526_1000032 Ga0055526_100003223 182
174 3300003773 Ga0055537_1000308 Ga0055537_10003088 182
175 3300003775 Ga0055524_1000054 Ga0055524_100005423 182
176 3300003784 Ga0055534_1000224 Ga0055534_100022415 182
177 3300003790 Ga0055528_1000021 Ga0055528_100002193 182
178 3300015689 Ga0183360_10001 Ga0183360_100011666 182
179 3300025263 Ga0209565_1000001 Ga0209565_10000012145 182
180 3300025263 Ga0209565_1004007 Ga0209565_10040073 182
181 3300025273 Ga0209673_1000001 Ga0209673_10000012145 182
182 3300025291 Ga0209675_1000001 Ga0209675_1000001387 182
183 3300025295 Ga0209564_1000001 Ga0209564_1000001549 182
184 3300025299 Ga0209256_1000002 Ga0209256_10000021003 182
185 3300031901 Ga0307406_10000616 Ga0307406_1000061611 182
186 3300041405 Ga0439438_021584 Ga0439438_021584_86_640 182
187 3300041406 Ga0439439_0015969 Ga0439439_0015969_341_895 182
188 3300041411 Ga0439466_0034374 Ga0439466_0034374_397_951 182
189 3300041413 Ga0439465_0000386 Ga0439465_0000386_10895_11449 182
190 3300042010 Ga0439452_065532 Ga0439452_065532_83_637 182
191 3300042015 Ga0439462_0147443 Ga0439462_0147443_35_589 182
192 3300042435 Ga0439434_0031959 Ga0439434_0031959_1017_1571 182
193 3300042531 Ga0450918_011558 Ga0450918_011558_399_953 182
194 3300048924 Ga0496121_0007358 Ga0496121_0007358_2041_2589 182
195 iso_pu_bacteria 2802429268 2804751131 182
196 3300003794 Ga0055531_10000965 Ga0055531_100009659 183
197 3300026118 Ga0207675_100276676 Ga0207675_1002766762 183
198 3300042436 Ga0439435_0017254 Ga0439435_0017254_475_1038 183
199 3300042438 Ga0439459_0065405 Ga0439459_0065405_245_817 183
200 3300031616 Ga0307508_10000637 Ga0307508_100006372 184
201 3300046660 Ga0495625_0001248 Ga0495625_0001248_29525_30082 184
202 3300053177 Ga0500636_0171329 Ga0500636_0171329_122_679 184
203 3300003187 JGI25151J46595_10000148 JGI25151J46595_1000014835 185
204 3300005331 Ga0070670_100002591 Ga0070670_1000025913 185
205 3300014497 Ga0182008_10169713 Ga0182008_101697132 185
206 3300025245 Ga0207425_1001459 Ga0207425_10014592 185
207 3300025294 Ga0209025_1000005 Ga0209025_1000005617 185
208 3300025297 Ga0209758_1016229 Ga0209758_10162293 185
209 3300025925 Ga0207650_10003085 Ga0207650_100030853 185
210 3300025941 Ga0207711_10513143 Ga0207711_105131432 185
211 3300031616 Ga0307508_10208133 Ga0307508_102081332 185
212 3300032133 Ga0316583_10061834 Ga0316583_100618342 185
213 3300037312 Ga0395899_0000018 Ga0395899_0000018_171987_172550 185
214 3300046519 Ga0495632_0099066 Ga0495632_0099066_14_574 185
215 3300046616 Ga0495668_0011978 Ga0495668_0011978_2350_2910 185
216 3300046660 Ga0495625_0110789 Ga0495625_0110789_128_688 185
217 3300048920 Ga0496117_0011425 Ga0496117_0011425_147_710 185
218 3300048921 Ga0496118_0016837 Ga0496118_0016837_5751_6314 185
219 3300048922 Ga0496119_0201128 Ga0496119_0201128_272_835 185
220 3300048923 Ga0496120_0015235 Ga0496120_0015235_4080_4643 185
221 3300048923 Ga0496120_0200317 Ga0496120_0200317_86_670 185
222 3300048924 Ga0496121_0000174 Ga0496121_0000174_95668_96252 185
223 3300048924 Ga0496121_0589434 Ga0496121_0589434_12_596 185
224 3300048926 Ga0496123_0020443 Ga0496123_0020443_1865_2428 185
225 3300048927 Ga0496124_0001736 Ga0496124_0001736_23042_23605 185
226 3300048927 Ga0496124_0003569 Ga0496124_0003569_4371_4934 185
227 3300048928 Ga0496125_0000982 Ga0496125_0000982_25126_25689 185
228 3300050491 nmdc:mga00v17_251549_c1 nmdc:mga00v17_251549_c1_492_1076 185
229 3300053079 Ga0500610_0130674 Ga0500610_0130674_545_1105 185
230 3300053086 Ga0500578_0389315 Ga0500578_0389315_208_768 185
231 3300053105 Ga0500557_001529 Ga0500557_001529_1163_1723 185
232 3300053109 Ga0500569_004382 Ga0500569_004382_1122_1682 185
233 3300053118 Ga0500594_0003217 Ga0500594_0003217_1674_2234 185
234 iso_pu_bacteria 2738543031 2739351613 185
235 iso_pu_bacteria 2855872281 2855878305 185
236 iso_pu_bacteria 2932801729 2932805865 185
237 iso_pu_bacteria 2935883170 2935883772 185

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

41

87

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4l62-assembly1.cif.gz_C crystal structure of pseudomonas aeruginosa transcriptional regulator pa2196 bound to its operator dna 0.8499 8 178
4l62-assembly1.cif.gz_C crystal structure of pseudomonas aeruginosa transcriptional regulator pa2196 bound to its operator dna 0.7856 8 178
4yze-assembly2.cif.gz_D crystal structure of e.coli nemr reduced form 0.7842 10 178
3dpj-assembly2.cif.gz_H the crystal structure of a tetr transcription regulator from silicibacter pomeroyi dss 0.7799 10 178
6zui-assembly1.cif.gz_A crystal structure of the cys-ser mutant of the cpyfp-based biosensor for hypochlorous acid 0.7746 11 83
ID Description Score Start End Superfamily
5mwrB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9691 13 57 1.10.10.60
1jt6E01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9621 11 57 1.10.10.60
3whcB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.962 11 53 1.10.10.60
2g0eE01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9616 11 57 1.10.10.60
1qvuE01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9616 11 57 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A285Y2P6-F1-model_v4 deleted 0.9841 1 180
AF-K0VY15-F1-model_v4 Orf_Bo158 0.9766 1 180 GO:0003677
AF-A0A7C1T2C8-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9691 1 115 GO:0003677
AF-A0A7W4U0X5-F1-model_v4 deleted 0.9673 1 180
AF-A0A528MGY9-F1-model_v4 Helix-turn-helix transcriptional regulator 0.964 1 98 GO:0003677

Feature Viewer

pLDDT pTM Quality
91 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map