F349719

General Info

Members Datasets Scaffolds Average Seq Length
237 144 474 176

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100259619|Ga0070680_1002596191
Length 200
Sequence MKNAGRVRARWNKAGGTFAMIRMIAAGDRRLMTRVNRWRPPRWLRTWMIAASRAGDGWLWIGLGALIGLFGGPLRTEAILAGLASAGLGWAVFFFVKKLAGRERPCATEPNCWATLLPPDRFSFPSGHTIMAFAITASIGLYYPSLLAGLIFCAMSVAASRVLLGLHYLTDVLAGIALGCLIGMSMTVAVPRLLTAILNV

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
4 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
5 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
54 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
55 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
56 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
57 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
58 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
84 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
85 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
86 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
87 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
88 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
89 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
90 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
91 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
92 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
93 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
97 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
98 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
99 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
100 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
101 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
102 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
103 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
104 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
105 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
106 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
107 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
108 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
109 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
110 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
113 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
114 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
115 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
116 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
117 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
118 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
119 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
120 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
121 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
122 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
123 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
124 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
125 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
126 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
129 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
130 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
137 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
138 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
139 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
141 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
142 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
143 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
144 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.84
Rhizosphere 84.81
Stem 0
Stem Tuber 0
Unclassified 36.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100259619 3300005336 Bacteria 1469
2 Ga0070658_10161289 3300005327 Bacteria 1881
3 Ga0070680_100111432 3300005336 Bacteria 2278
4 Ga0070661_100052020 3300005344 Unclassified 2998
5 Ga0070661_100200349 3300005344 Unclassified 1525
6 Ga0070669_100259629 3300005353 Bacteria 1386
7 Ga0070688_100278842 3300005365 Unclassified 1200
8 Ga0070659_100730681 3300005366 Unclassified 858
9 Ga0070703_10052526 3300005406 Bacteria 1308
10 Ga0070709_10175811 3300005434 Bacteria 1500
11 Ga0070709_10478054 3300005434 Unclassified 943
12 Ga0070714_100007176 3300005435 Bacteria 8646
13 Ga0070714_100302175 3300005435 Bacteria 1492
14 Ga0070714_100340227 3300005435 Bacteria 1407
15 Ga0070713_100017099 3300005436 Bacteria 5473
16 Ga0070713_100323771 3300005436 Unclassified 1424
17 Ga0070708_100291249 3300005445 Bacteria 1537
18 Ga0070663_100577315 3300005455 Unclassified 943
19 Ga0070678_100051785 3300005456 Bacteria 2978
20 Ga0070681_10036198 3300005458 Bacteria 4958
21 Ga0070681_10138667 3300005458 Bacteria 2362
22 Ga0070681_10279347 3300005458 Bacteria 1581
23 Ga0070681_10310443 3300005458 Bacteria 1486
24 Ga0070706_100161249 3300005467 Bacteria 2094
25 Ga0070699_100116300 3300005518 Bacteria 2350
26 Ga0070699_100136840 3300005518 Bacteria 2161
27 Ga0070697_100344050 3300005536 Bacteria 1287
28 Ga0068853_100155402 3300005539 Bacteria 2061
29 Ga0070695_100143279 3300005545 Unclassified 1660
30 Ga0070665_100080997 3300005548 Bacteria 3252
31 Ga0068855_100003950 3300005563 Bacteria 18100
32 Ga0068855_100007824 3300005563 Bacteria 12912
33 Ga0068856_100029394 3300005614 Bacteria 5368
34 Ga0068856_100099004 3300005614 Bacteria 2906
35 Ga0068852_100006925 3300005616 Bacteria 8245
36 Ga0068863_100099149 3300005841 Bacteria 2768
37 Ga0068858_100515995 3300005842 Bacteria 1155
38 Ga0068858_100758519 3300005842 Unclassified 946
39 Ga0068860_100702030 3300005843 Unclassified 1021
40 Ga0081455_10006591 3300005937 Bacteria 12420
41 Ga0070717_10027764 3300006028 Bacteria 4525
42 Ga0070716_100236065 3300006173 Bacteria 1237
43 Ga0070712_100021638 3300006175 Bacteria 4226
44 Ga0070712_100313721 3300006175 Unclassified 1273
45 Ga0070712_101356244 3300006175 Unclassified 620
46 Ga0068871_100067966 3300006358 Bacteria 2925
47 Ga0075430_100130742 3300006846 Unclassified 2092
48 Ga0075431_100022123 3300006847 Bacteria 6502
49 Ga0075431_100055459 3300006847 Bacteria 4088
50 Ga0075429_100080280 3300006880 Unclassified 2844
51 Ga0075429_100214349 3300006880 Bacteria 1687
52 Ga0075436_100006941 3300006914 Bacteria 7748
53 Ga0075435_100351786 3300007076 Unclassified 1263
54 Ga0105240_10000425 3300009093 Bacteria 78173
55 Ga0105240_10000734 3300009093 Bacteria 59913
56 Ga0105240_10350449 3300009093 Unclassified 1675
57 Ga0111539_10066354 3300009094 Bacteria 4263
58 Ga0105245_10057144 3300009098 Bacteria 3509
59 Ga0105245_11572379 3300009098 Unclassified 709
60 Ga0114129_10246670 3300009147 Bacteria 2399
61 Ga0105243_11325954 3300009148 Unclassified 738
62 Ga0105242_10204639 3300009176 Unclassified 1755
63 Ga0105248_10464143 3300009177 Unclassified 1427
64 Ga0105238_10466768 3300009551 Unclassified 1260
65 Ga0157371_10096533 3300013102 Unclassified 2095
66 Ga0157370_10000734 3300013104 Bacteria 41162
67 Ga0157370_10001930 3300013104 Bacteria 25516
68 Ga0157370_10099376 3300013104 Bacteria 2727
69 Ga0157370_10252268 3300013104 Bacteria 1632
70 Ga0157369_10007112 3300013105 Bacteria 12906
71 Ga0157369_10107042 3300013105 Unclassified 2975
72 Ga0157369_10135492 3300013105 Bacteria 2608
73 Ga0157369_10255742 3300013105 Bacteria 1827
74 Ga0157369_10525237 3300013105 Unclassified 1224
75 Ga0157369_10690072 3300013105 Unclassified 1052
76 Ga0157374_10038298 3300013296 Bacteria 4407
77 Ga0163162_10340648 3300013306 Unclassified 1632
78 Ga0163162_11010137 3300013306 Unclassified 941
79 Ga0157372_10026503 3300013307 Bacteria 6307
80 Ga0157372_10115257 3300013307 Unclassified 3081
81 Ga0157372_10127253 3300013307 Unclassified 2929
82 Ga0157372_10312620 3300013307 Bacteria 1829
83 Ga0157372_12244671 3300013307 Unclassified 627
84 Ga0157379_11506582 3300014968 Unclassified 654
85 Ga0157376_10229503 3300014969 Bacteria 1724
86 Ga0157376_10706613 3300014969 Bacteria 1014
87 Ga0213873_10017991 3300021358 Unclassified 1619
88 Ga0213874_10024638 3300021377 Unclassified 1689
89 Ga0213874_10120205 3300021377 Unclassified 892
90 Ga0213874_10136826 3300021377 Unclassified 845
91 Ga0213876_10005059 3300021384 Bacteria 7271
92 Ga0213876_10016328 3300021384 Bacteria 3924
93 Ga0213875_10000069 3300021388 Bacteria 121776
94 Ga0213875_10002002 3300021388 Bacteria 12574
95 Ga0213875_10015612 3300021388 Unclassified 3694
96 Ga0213875_10021917 3300021388 Unclassified 3058
97 Ga0213871_10079744 3300021441 Bacteria 936
98 Ga0207699_10937678 3300025906 Bacteria 639
99 Ga0207705_10136041 3300025909 Unclassified 1832
100 Ga0207684_10133958 3300025910 Bacteria 2127
101 Ga0207707_10021892 3300025912 Bacteria 5588
102 Ga0207707_10682272 3300025912 Unclassified 864
103 Ga0207693_10032841 3300025915 Bacteria 4096
104 Ga0207660_10012670 3300025917 Bacteria 5523
105 Ga0207652_10506662 3300025921 Bacteria 1086
106 Ga0207652_11310034 3300025921 Unclassified 627
107 Ga0207681_10331771 3300025923 Unclassified 1213
108 Ga0207694_10295106 3300025924 Bacteria 1333
109 Ga0207700_10287570 3300025928 Bacteria 1416
110 Ga0207700_10915046 3300025928 Bacteria 785
111 Ga0207664_10011168 3300025929 Bacteria 6366
112 Ga0207664_10508893 3300025929 Bacteria 1079
113 Ga0207644_10194891 3300025931 Bacteria 1595
114 Ga0207686_10095499 3300025934 Unclassified 1973
115 Ga0207670_10830912 3300025936 Unclassified 771
116 Ga0207665_10388189 3300025939 Unclassified 1061
117 Ga0207679_10932384 3300025945 Unclassified 795
118 Ga0207667_10017010 3300025949 Bacteria 8202
119 Ga0207667_10292440 3300025949 Unclassified 1664
120 Ga0207667_11002011 3300025949 Bacteria 823
121 Ga0207703_10269226 3300026035 Bacteria 1543
122 Ga0207639_10025480 3300026041 Bacteria 4288
123 Ga0207678_10035093 3300026067 Bacteria 4367
124 Ga0207702_10039352 3300026078 Unclassified 3960
125 Ga0207698_10012874 3300026142 Bacteria 5495
126 Ga0268266_10217843 3300028379 Bacteria 1753
127 Ga0268264_10960447 3300028381 Unclassified 860
128 Ga0265760_10108419 3300031090 Bacteria 883
129 Ga0265330_10318517 3300031235 Bacteria 656
130 Ga0265325_10002502 3300031241 Bacteria 12380
131 Ga0265339_10051230 3300031249 Bacteria 2254
132 Ga0265316_10058598 3300031344 Bacteria 2999
133 Ga0265316_10152100 3300031344 Bacteria 1733
134 Ga0265316_10170283 3300031344 Bacteria 1625
135 Ga0265316_10376282 3300031344 Bacteria 1025
136 Ga0265316_10422066 3300031344 Unclassified 959
137 Ga0265314_10015276 3300031711 Bacteria 6096
138 Ga0265342_10221927 3300031712 Bacteria 1018
139 Ga0373926_0156343 3300035083 Bacteria 869
140 Ga0373943_0422818 3300035170 Unclassified 771
141 Ga0373935_0101205 3300035692 Bacteria 1900
142 Ga0373927_0000926 3300035695 Bacteria 22228
143 Ga0373927_0109756 3300035695 Bacteria 1797
144 Ga0373947_0072188 3300035725 Bacteria 2119
145 Ga0373947_0175683 3300035725 Bacteria 1392
146 Ga0373937_0467355 3300036401 Bacteria 1198
147 Ga0373925_0964371 3300037068 Bacteria 702
148 Ga0395899_0209078 3300037312 Bacteria 1357
149 Ga0395900_0156835 3300037418 Bacteria 2325
150 Ga0395900_0404117 3300037418 Bacteria 1329
151 Ga0395898_0147826 3300037466 Bacteria 2249
152 Ga0395905_0638973 3300037471 Bacteria 966
153 Ga0436364_0109856 3300037853 Bacteria 15119
154 Ga0436364_0164919 3300037853 Bacteria 2674
155 Ga0436364_0235452 3300037853 Bacteria 12272
156 Ga0436364_0278774 3300037853 Bacteria 400541
157 Ga0436364_0359103 3300037853 Bacteria 2193
158 Ga0436364_0483881 3300037853 Bacteria 1672
159 Ga0436364_0485265 3300037853 Unclassified 4377
160 Ga0436364_0749990 3300037853 Unclassified 1548
161 Ga0436364_0951596 3300037853 Bacteria 37753
162 Ga0436364_1003201 3300037853 Bacteria 4262
163 Ga0436364_1107882 3300037853 Bacteria 2076
164 Ga0436364_1368996 3300037853 Bacteria 6202
165 Ga0436365_0097183 3300039437 Bacteria 5177
166 Ga0436365_1099037 3300039437 Bacteria 1574
167 Ga0436365_1130034 3300039437 Bacteria 3075
168 Ga0436365_1256885 3300039437 Bacteria 9910
169 Ga0436365_1517291 3300039437 Unclassified 3487
170 Ga0436365_1614020 3300039437 Unclassified 1371
171 Ga0436365_1757114 3300039437 Unclassified 759
172 Ga0436360_0065360 3300039438 Bacteria 8322
173 Ga0436360_0753618 3300039438 Bacteria 1363
174 Ga0436361_0932507 3300039447 Unclassified 767
175 Ga0436363_0128270 3300039450 Unclassified 4901
176 Ga0436363_0136497 3300039450 Unclassified 3572
177 Ga0436363_1129205 3300039450 Bacteria 1239
178 Ga0436363_1137223 3300039450 Unclassified 1496
179 Ga0436362_0021584 3300039453 Unclassified 1639
180 Ga0436362_0342071 3300039453 Bacteria 1760
181 Ga0436362_0363612 3300039453 Bacteria 1775
182 Ga0436362_0602864 3300039453 Bacteria 2077
183 Ga0466966_0152625 3300044684 Unclassified 1408
184 Ga0466966_0352135 3300044684 Unclassified 885
185 Ga0466963_0091726 3300044694 Bacteria 2070
186 Ga0453684_0504131 3300044712 Bacteria 1340
187 Ga0466959_0137604 3300045049 Bacteria 1728
188 Ga0451576_0530997 3300045051 Bacteria 1236
189 Ga0466967_1320533 3300045976 Unclassified 718
190 Ga0495653_0105395 3300046463 Bacteria 2036
191 Ga0495580_0025112 3300046472 Unclassified 4354
192 Ga0495580_0036392 3300046472 Bacteria 3534
193 Ga0495580_0059807 3300046472 Unclassified 2678
194 Ga0495580_0130052 3300046472 Bacteria 1747
195 Ga0495580_0391903 3300046472 Bacteria 937
196 Ga0495594_0088960 3300046499 Unclassified 1729
197 Ga0495665_0180240 3300046531 Unclassified 1098
198 Ga0495665_0307685 3300046531 Unclassified 811
199 Ga0495587_0522255 3300046536 Unclassified 656
200 Ga0495645_0271060 3300046543 Unclassified 1120
201 Ga0495667_0067667 3300046559 Bacteria 2333
202 Ga0495634_0080019 3300046642 Bacteria 2139
203 Ga0495635_0131735 3300046663 Bacteria 1704
204 Ga0495635_0241858 3300046663 Unclassified 1218
205 Ga0495623_0038746 3300046679 Bacteria 3048
206 Ga0495623_0075778 3300046679 Bacteria 2088
207 Ga0495623_0136407 3300046679 Unclassified 1464
208 Ga0495613_0489991 3300046689 Bacteria 829
209 Ga0495604_0180617 3300047317 Unclassified 1476
210 Ga0495604_0293905 3300047317 Bacteria 1093
211 Ga0495674_0018657 3300047319 Bacteria 6455
212 Ga0495674_0047973 3300047319 Bacteria 3783
213 Ga0495675_0201894 3300047444 Unclassified 1210
214 Ga0495675_0222489 3300047444 Bacteria 1142
215 Ga0495675_0325972 3300047444 Bacteria 908
216 Ga0495684_0046098 3300047471 Unclassified 3335
217 Ga0495684_0091730 3300047471 Bacteria 2301
218 Ga0496110_1500195 3300048913 Unclassified 584
219 Ga0496115_0210759 3300048918 Unclassified 1605
220 Ga0496126_0016788 3300048929 Bacteria 7308
221 Ga0496126_0497547 3300048929 Unclassified 975
222 Ga0501032_0245409 3300049569 Unclassified 1163
223 Ga0501034_0051245 3300049571 Bacteria 4162
224 Ga0501036_0891581 3300049572 Unclassified 730
225 Ga0501037_0479310 3300049573 Unclassified 846
226 Ga0501038_0102345 3300049574 Bacteria 2383
227 Ga0501047_0080743 3300049581 Bacteria 3126
228 Ga0501070_0195782 3300049586 Unclassified 1660
229 Ga0501073_0324814 3300049589 Unclassified 1062
230 Ga0501080_0721817 3300049742 Unclassified 878
231 Ga0501035_0029034 3300049822 Bacteria 5044
232 Ga0501044_0045900 3300049823 Bacteria 4525
233 Ga0501044_0184140 3300049823 Bacteria 2054
234 nmdc:mga05p37_580671_c1 3300050507 Unclassified 1269
235 nmdc:mga08y16_793626_c1 3300050511 Bacteria 940
236 nmdc:mga08x19_18368_c1 3300050514 Bacteria 4286
237 Ga0466962_0164214 3300061719 Unclassified 1080
238 Ga0070680_100259619
239 Ga0070658_10161289
240 Ga0070680_100111432
241 Ga0070661_100052020
242 Ga0070661_100200349
243 Ga0070669_100259629
244 Ga0070688_100278842
245 Ga0070659_100730681
246 Ga0070703_10052526
247 Ga0070709_10175811
248 Ga0070709_10478054
249 Ga0070714_100007176
250 Ga0070714_100302175
251 Ga0070714_100340227
252 Ga0070713_100017099
253 Ga0070713_100323771
254 Ga0070708_100291249
255 Ga0070663_100577315
256 Ga0070678_100051785
257 Ga0070681_10036198
258 Ga0070681_10138667
259 Ga0070681_10279347
260 Ga0070681_10310443
261 Ga0070706_100161249
262 Ga0070699_100116300
263 Ga0070699_100136840
264 Ga0070697_100344050
265 Ga0068853_100155402
266 Ga0070695_100143279
267 Ga0070665_100080997
268 Ga0068855_100003950
269 Ga0068855_100007824
270 Ga0068856_100029394
271 Ga0068856_100099004
272 Ga0068852_100006925
273 Ga0068863_100099149
274 Ga0068858_100515995
275 Ga0068858_100758519
276 Ga0068860_100702030
277 Ga0081455_10006591
278 Ga0070717_10027764
279 Ga0070716_100236065
280 Ga0070712_100021638
281 Ga0070712_100313721
282 Ga0070712_101356244
283 Ga0068871_100067966
284 Ga0075430_100130742
285 Ga0075431_100022123
286 Ga0075431_100055459
287 Ga0075429_100080280
288 Ga0075429_100214349
289 Ga0075436_100006941
290 Ga0075435_100351786
291 Ga0105240_10000425
292 Ga0105240_10000734
293 Ga0105240_10350449
294 Ga0111539_10066354
295 Ga0105245_10057144
296 Ga0105245_11572379
297 Ga0114129_10246670
298 Ga0105243_11325954
299 Ga0105242_10204639
300 Ga0105248_10464143
301 Ga0105238_10466768
302 Ga0157371_10096533
303 Ga0157370_10000734
304 Ga0157370_10001930
305 Ga0157370_10099376
306 Ga0157370_10252268
307 Ga0157369_10007112
308 Ga0157369_10107042
309 Ga0157369_10135492
310 Ga0157369_10255742
311 Ga0157369_10525237
312 Ga0157369_10690072
313 Ga0157374_10038298
314 Ga0163162_10340648
315 Ga0163162_11010137
316 Ga0157372_10026503
317 Ga0157372_10115257
318 Ga0157372_10127253
319 Ga0157372_10312620
320 Ga0157372_12244671
321 Ga0157379_11506582
322 Ga0157376_10229503
323 Ga0157376_10706613
324 Ga0213873_10017991
325 Ga0213874_10024638
326 Ga0213874_10120205
327 Ga0213874_10136826
328 Ga0213876_10005059
329 Ga0213876_10016328
330 Ga0213875_10000069
331 Ga0213875_10002002
332 Ga0213875_10015612
333 Ga0213875_10021917
334 Ga0213871_10079744
335 Ga0207699_10937678
336 Ga0207705_10136041
337 Ga0207684_10133958
338 Ga0207707_10021892
339 Ga0207707_10682272
340 Ga0207693_10032841
341 Ga0207660_10012670
342 Ga0207652_10506662
343 Ga0207652_11310034
344 Ga0207681_10331771
345 Ga0207694_10295106
346 Ga0207700_10287570
347 Ga0207700_10915046
348 Ga0207664_10011168
349 Ga0207664_10508893
350 Ga0207644_10194891
351 Ga0207686_10095499
352 Ga0207670_10830912
353 Ga0207665_10388189
354 Ga0207679_10932384
355 Ga0207667_10017010
356 Ga0207667_10292440
357 Ga0207667_11002011
358 Ga0207703_10269226
359 Ga0207639_10025480
360 Ga0207678_10035093
361 Ga0207702_10039352
362 Ga0207698_10012874
363 Ga0268266_10217843
364 Ga0268264_10960447
365 Ga0265760_10108419
366 Ga0265330_10318517
367 Ga0265325_10002502
368 Ga0265339_10051230
369 Ga0265316_10058598
370 Ga0265316_10152100
371 Ga0265316_10170283
372 Ga0265316_10376282
373 Ga0265316_10422066
374 Ga0265314_10015276
375 Ga0265342_10221927
376 Ga0373926_0156343
377 Ga0373943_0422818
378 Ga0373935_0101205
379 Ga0373927_0000926
380 Ga0373927_0109756
381 Ga0373947_0072188
382 Ga0373947_0175683
383 Ga0373937_0467355
384 Ga0373925_0964371
385 Ga0395899_0209078
386 Ga0395900_0156835
387 Ga0395900_0404117
388 Ga0395898_0147826
389 Ga0395905_0638973
390 Ga0436364_0109856
391 Ga0436364_0164919
392 Ga0436364_0235452
393 Ga0436364_0278774
394 Ga0436364_0359103
395 Ga0436364_0483881
396 Ga0436364_0485265
397 Ga0436364_0749990
398 Ga0436364_0951596
399 Ga0436364_1003201
400 Ga0436364_1107882
401 Ga0436364_1368996
402 Ga0436365_0097183
403 Ga0436365_1099037
404 Ga0436365_1130034
405 Ga0436365_1256885
406 Ga0436365_1517291
407 Ga0436365_1614020
408 Ga0436365_1757114
409 Ga0436360_0065360
410 Ga0436360_0753618
411 Ga0436361_0932507
412 Ga0436363_0128270
413 Ga0436363_0136497
414 Ga0436363_1129205
415 Ga0436363_1137223
416 Ga0436362_0021584
417 Ga0436362_0342071
418 Ga0436362_0363612
419 Ga0436362_0602864
420 Ga0466966_0152625
421 Ga0466966_0352135
422 Ga0466963_0091726
423 Ga0453684_0504131
424 Ga0466959_0137604
425 Ga0451576_0530997
426 Ga0466967_1320533
427 Ga0495653_0105395
428 Ga0495580_0025112
429 Ga0495580_0036392
430 Ga0495580_0059807
431 Ga0495580_0130052
432 Ga0495580_0391903
433 Ga0495594_0088960
434 Ga0495665_0180240
435 Ga0495665_0307685
436 Ga0495587_0522255
437 Ga0495645_0271060
438 Ga0495667_0067667
439 Ga0495634_0080019
440 Ga0495635_0131735
441 Ga0495635_0241858
442 Ga0495623_0038746
443 Ga0495623_0075778
444 Ga0495623_0136407
445 Ga0495613_0489991
446 Ga0495604_0180617
447 Ga0495604_0293905
448 Ga0495674_0018657
449 Ga0495674_0047973
450 Ga0495675_0201894
451 Ga0495675_0222489
452 Ga0495675_0325972
453 Ga0495684_0046098
454 Ga0495684_0091730
455 Ga0496110_1500195
456 Ga0496115_0210759
457 Ga0496126_0016788
458 Ga0496126_0497547
459 Ga0501032_0245409
460 Ga0501034_0051245
461 Ga0501036_0891581
462 Ga0501037_0479310
463 Ga0501038_0102345
464 Ga0501047_0080743
465 Ga0501070_0195782
466 Ga0501073_0324814
467 Ga0501080_0721817
468 Ga0501035_0029034
469 Ga0501044_0045900
470 Ga0501044_0184140
471 nmdc:mga05p37_580671_c1
472 nmdc:mga08y16_793626_c1
473 nmdc:mga08x19_18368_c1
474 Ga0466962_0164214

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14378

PAP2_3

PAP2 superfamily

111

184

0.9

PF01569

PAP2

PAP2 superfamily

77

194

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ebu-assembly1.cif.gz_A crystal structure of aquifex aeolicus lpxe 0.865 11 169
6ebu-assembly1.cif.gz_A crystal structure of aquifex aeolicus lpxe 0.8067 11 169
5jki-assembly1.cif.gz_A crystal structure of the first transmembrane pap2 type phosphatidylglycerolphosphate phosphatase from bacillus subtilis 0.7862 4 173
1qi9-assembly1.cif.gz_A x-ray siras structure determination of a vanadium-dependent haloperoxidase from ascophyllum nodosum at 2.0 a resolution 0.7794 100 167
5jki-assembly1.cif.gz_A crystal structure of the first transmembrane pap2 type phosphatidylglycerolphosphate phosphatase from bacillus subtilis 0.7621 4 173
ID Description Score Start End Superfamily
af_A0A2R8Q2K8_118_304_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.8018 55 174 1.20.144.10
af_A4HYG7_136_301_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.7851 57 175 1.20.144.10
af_Q59W68_11_255_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.7826 41 171 1.20.144.10
af_A4HXR9_231_397_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.78 55 171 1.20.144.10
af_Q9V576_127_372_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.7748 56 168 1.20.144.10
ID Description Score Start End GO Terms
AF-A0A2V8TT66-F1-model_v4 Phosphatase PAP2 family protein 0.9758 2 173 GO:0016020
AF-A0A2E5FJT9-F1-model_v4 Phosphatase PAP2 family protein 0.9739 3 170 GO:0008610
GO:0016020
GO:0016787
GO:1901137
AF-A0A2V8Y0G8-F1-model_v4 Phosphatase PAP2 family protein 0.9676 5 173 GO:0016020
AF-A0A2V9GKR0-F1-model_v4 Phosphatase PAP2 family protein 0.9675 4 172 GO:0016020
AF-A0A7C4FZQ4-F1-model_v4 Phosphatase PAP2 family protein 0.9647 30 171 GO:0016020

Map