F349385

General Info

Members Datasets Scaffolds Average Seq Length
236 137 236 405

Family's Representative Sequence

Representative Sequence 3300046675|Ga0495657_0021165|Ga0495657_0021165_346_1632
Length 428
Sequence MPSQRFFQNTRWPPLKLQPNMNLDALYSELTLKTDAKLALVVLDGLGDLAVKSQNELTPLEAAKTPNLDALVADGVAQGRMIPVAPGITPGSGPGHLALFGYDPLEFQVGRGVIEALGLGLHLKAGDVAARANFCTLDAKGIVTDRRAGRIETEVCEELCALLSKKIKKVGDAEVIIKASKGHRFVVILRGKGLEGPLTDADPHREGLSVPKVESVNRKSLKAKKAAKLVADFYRAALPVIARKKPANGFLLRGIAHQPEIPLFEERYRLRPACIAVYPMYKGLAQLVGMRKLEGPQTITEQFERYLAEYDNYDFFFIHYKYTDMHGEDGNFEGKRKAIEDFDAALPVLLKKKPDVLAITGDHSTPCAAKAHSWHPQPVLLHSALSGSDKLDRFTETGANMGSLGKFEAKYLMRLMQANAKMFDKFGA

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
61 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
62 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
63 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
64 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
65 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
66 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
67 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
68 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
69 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
70 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
71 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
72 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
73 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
74 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
75 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
76 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
77 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
78 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
79 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
80 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
81 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
82 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
83 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
84 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
85 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
86 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
87 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
88 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
89 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
90 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
91 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
92 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
93 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
96 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
97 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
100 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
101 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
102 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
103 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
104 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
105 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
106 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
107 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
108 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
109 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
110 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
111 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
112 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
113 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
114 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
115 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
116 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
117 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
118 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
119 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
120 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
121 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
122 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
123 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
124 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
125 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
133 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
134 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
135 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
136 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
137 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.42
Nodule 0
Rhizoplane 0
Rhizosphere 99.58
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10026311 3300005327 Unclassified 4667
2 Ga0070690_100009033 3300005330 Bacteria 5763
3 Ga0070666_10056843 3300005335 Unclassified 2643
4 Ga0070689_100001437 3300005340 Bacteria 15181
5 Ga0070689_100029895 3300005340 Bacteria 4131
6 Ga0070689_100087366 3300005340 Bacteria 2453
7 Ga0070688_100022278 3300005365 Bacteria 3709
8 Ga0070688_100197834 3300005365 Bacteria 1404
9 Ga0070714_100006898 3300005435 Bacteria 8805
10 Ga0070713_100286908 3300005436 Bacteria 1512
11 Ga0070701_10002332 3300005438 Bacteria 7282
12 Ga0070701_10097496 3300005438 Bacteria 1622
13 Ga0070711_100003138 3300005439 Bacteria 9582
14 Ga0070705_100017578 3300005440 Bacteria 3734
15 Ga0070708_100284733 3300005445 Bacteria 1556
16 Ga0070685_10053317 3300005466 Bacteria 2342
17 Ga0070684_100100101 3300005535 Unclassified 2588
18 Ga0068853_100105873 3300005539 Unclassified 2492
19 Ga0070686_100002854 3300005544 Bacteria 9519
20 Ga0070704_100006285 3300005549 Bacteria 6993
21 Ga0068855_100005564 3300005563 Bacteria 15375
22 Ga0068855_100112992 3300005563 Bacteria 3116
23 Ga0068855_100210086 3300005563 Bacteria 2187
24 Ga0068857_100011538 3300005577 Bacteria 7688
25 Ga0068856_100000160 3300005614 Bacteria 69926
26 Ga0068859_100293900 3300005617 Unclassified 1718
27 Ga0068864_100033417 3300005618 Bacteria 4373
28 Ga0068864_100069760 3300005618 Unclassified 3057
29 Ga0068863_100038775 3300005841 Bacteria 4533
30 Ga0068863_100089044 3300005841 Unclassified 2926
31 Ga0068858_100067816 3300005842 Bacteria 3305
32 Ga0068862_100096692 3300005844 Unclassified 2578
33 Ga0068862_100395561 3300005844 Bacteria 1292
34 Ga0081455_10133766 3300005937 Bacteria 1935
35 Ga0070716_100017372 3300006173 Bacteria 3729
36 Ga0070712_100226331 3300006175 Unclassified 1483
37 Ga0097621_100128992 3300006237 Unclassified 2151
38 Ga0068871_100057445 3300006358 Bacteria 3165
39 Ga0075431_100126351 3300006847 Bacteria 2638
40 Ga0075434_100127353 3300006871 Unclassified 2563
41 Ga0097620_100293923 3300006931 Unclassified 1718
42 Ga0097620_100454622 3300006931 Unclassified 1377
43 Ga0075435_100144842 3300007076 Unclassified 1995
44 Ga0075435_100217147 3300007076 Bacteria 1623
45 Ga0105240_10017731 3300009093 Bacteria 9587
46 Ga0105240_10224669 3300009093 Unclassified 2185
47 Ga0111539_10046909 3300009094 Bacteria 5166
48 Ga0111539_10189505 3300009094 Bacteria 2400
49 Ga0111539_10246323 3300009094 Bacteria 2081
50 Ga0105245_10326660 3300009098 Unclassified 1513
51 Ga0105248_10254140 3300009177 Bacteria 1978
52 Ga0105238_10011445 3300009551 Bacteria 8935
53 Ga0105238_10012685 3300009551 Bacteria 8506
54 Ga0105238_10013879 3300009551 Bacteria 8146
55 Ga0105238_10060027 3300009551 Bacteria 3808
56 Ga0105249_10118884 3300009553 Bacteria 2509
57 Ga0105249_10344841 3300009553 Bacteria 1507
58 Ga0157374_10067538 3300013296 Bacteria 3361
59 Ga0157378_10066548 3300013297 Unclassified 3227
60 Ga0157378_10261800 3300013297 Bacteria 1660
61 Ga0157375_10000041 3300013308 Bacteria 162765
62 Ga0157375_10046365 3300013308 Bacteria 4237
63 Ga0163163_10000027 3300014325 Bacteria 176970
64 Ga0163163_10045373 3300014325 Unclassified 4313
65 Ga0163163_10215361 3300014325 Unclassified 1970
66 Ga0163163_10406467 3300014325 Bacteria 1420
67 Ga0207680_10051086 3300025903 Unclassified 2471
68 Ga0207695_10075497 3300025913 Bacteria 3429
69 Ga0207695_10143005 3300025913 Bacteria 2339
70 Ga0207663_10006670 3300025916 Bacteria 5934
71 Ga0207646_10185884 3300025922 Bacteria 1877
72 Ga0207694_10015507 3300025924 Bacteria 5746
73 Ga0207694_10058513 3300025924 Bacteria 2997
74 Ga0207687_10187413 3300025927 Unclassified 1607
75 Ga0207700_10356378 3300025928 Bacteria 1275
76 Ga0207664_10068565 3300025929 Bacteria 2850
77 Ga0207670_10052075 3300025936 Bacteria 2752
78 Ga0207661_10105590 3300025944 Bacteria 2374
79 Ga0207667_10058353 3300025949 Bacteria 4049
80 Ga0207639_10072927 3300026041 Unclassified 2690
81 Ga0207702_10008624 3300026078 Bacteria 8598
82 Ga0207702_10026615 3300026078 Bacteria 4802
83 Ga0207676_10023076 3300026095 Bacteria 4584
84 Ga0207674_10005182 3300026116 Bacteria 15526
85 Ga0207674_10208322 3300026116 Unclassified 1904
86 Ga0268265_10146355 3300028380 Bacteria 1986
87 Ga0265337_1001858 3300028556 Bacteria 10084
88 Ga0265337_1002186 3300028556 Bacteria 9148
89 Ga0265337_1010539 3300028556 Bacteria 3234
90 Ga0265337_1013930 3300028556 Bacteria 2680
91 Ga0265326_10009272 3300028558 Unclassified 2941
92 Ga0265319_1000004 3300028563 Bacteria 305085
93 Ga0265319_1002911 3300028563 Bacteria 9135
94 Ga0265319_1016410 3300028563 Unclassified 2840
95 Ga0265334_10031957 3300028573 Archaea 2101
96 Ga0265318_10031991 3300028577 Unclassified 2037
97 Ga0265338_10000038 3300028800 Bacteria 237195
98 Ga0265338_10000402 3300028800 Bacteria 77555
99 Ga0265338_10000533 3300028800 Bacteria 66710
100 Ga0265338_10000631 3300028800 Bacteria 61153
101 Ga0265338_10000702 3300028800 Bacteria 57422
102 Ga0265338_10001287 3300028800 Bacteria 41160
103 Ga0265338_10002914 3300028800 Bacteria 24859
104 Ga0265338_10003929 3300028800 Bacteria 20487
105 Ga0265338_10004069 3300028800 Bacteria 20046
106 Ga0265338_10005466 3300028800 Bacteria 16582
107 Ga0265338_10017471 3300028800 Bacteria 7729
108 Ga0265338_10020099 3300028800 Bacteria 7043
109 Ga0265338_10030971 3300028800 Bacteria 5254
110 Ga0265338_10032943 3300028800 Bacteria 5042
111 Ga0265338_10062682 3300028800 Unclassified 3248
112 Ga0265338_10068081 3300028800 Unclassified 3070
113 Ga0265338_10092284 3300028800 Unclassified 2498
114 Ga0265338_10149837 3300028800 Unclassified 1814
115 Ga0265338_10168486 3300028800 Bacteria 1683
116 Ga0265338_10192351 3300028800 Bacteria 1546
117 Ga0265324_10000237 3300029957 Bacteria 41672
118 Ga0265324_10005831 3300029957 Bacteria 5238
119 Ga0265324_10010686 3300029957 Bacteria 3526
120 Ga0265324_10011775 3300029957 Unclassified 3322
121 Ga0265332_10018236 3300031238 Unclassified 3096
122 Ga0265332_10031273 3300031238 Archaea 2322
123 Ga0265320_10002227 3300031240 Bacteria 13595
124 Ga0265320_10003594 3300031240 Bacteria 10365
125 Ga0265320_10025923 3300031240 Bacteria 3076
126 Ga0265325_10007939 3300031241 Bacteria 6305
127 Ga0265329_10007020 3300031242 Bacteria 4398
128 Ga0265340_10023719 3300031247 Bacteria 3126
129 Ga0265339_10003742 3300031249 Bacteria 10608
130 Ga0265339_10006089 3300031249 Bacteria 7960
131 Ga0265327_10000705 3300031251 Bacteria 52883
132 Ga0265327_10004308 3300031251 Bacteria 12697
133 Ga0265327_10010945 3300031251 Bacteria 6313
134 Ga0265327_10032198 3300031251 Bacteria 2937
135 Ga0265313_10001842 3300031595 Bacteria 19330
136 Ga0316575_10002131 3300031665 Bacteria 6606
137 Ga0265314_10000034 3300031711 Bacteria 241556
138 Ga0265314_10016069 3300031711 Bacteria 5925
139 Ga0265314_10026022 3300031711 Bacteria 4403
140 Ga0265342_10046451 3300031712 Unclassified 2610
141 Ga0265342_10081754 3300031712 Bacteria 1865
142 Ga0316578_10010437 3300031728 Bacteria 4819
143 Ga0316585_10025931 3300032137 Bacteria 1820
144 Ga0373930_0008833 3300034816 Bacteria 1770
145 Ga0373926_0044215 3300035083 Unclassified 1595
146 Ga0373928_0000057 3300035084 Bacteria 19683
147 Ga0373929_0000184 3300035085 Bacteria 11105
148 Ga0373932_0000003 3300035112 Bacteria 459351
149 Ga0373956_0011896 3300035119 Bacteria 3596
150 Ga0373956_0096596 3300035119 Bacteria 1367
151 Ga0373943_0178900 3300035170 Bacteria 1165
152 Ga0373946_0031640 3300035171 Unclassified 2121
153 Ga0373962_0000163 3300035242 Bacteria 14108
154 Ga0316574_0005822 3300035398 Bacteria 6612
155 Ga0373931_0000017 3300035691 Bacteria 207733
156 Ga0373931_0057093 3300035691 Unclassified 2093
157 Ga0373935_0005978 3300035692 Bacteria 7224
158 Ga0373935_0135660 3300035692 Bacteria 1657
159 Ga0373927_0039415 3300035695 Bacteria 3066
160 Ga0373947_0016219 3300035725 Bacteria 4282
161 Ga0373937_0002204 3300036401 Bacteria 16284
162 Ga0316584_0005641 3300036712 Bacteria 8421
163 Ga0373925_0000137 3300037068 Bacteria 77893
164 Ga0373925_0009188 3300037068 Bacteria 7198
165 Ga0373925_0011782 3300037068 Bacteria 6328
166 Ga0373925_0053781 3300037068 Bacteria 3011
167 Ga0316581_0002452 3300037588 Bacteria 4442
168 Ga0395901_0421942 3300038443 Unclassified 1368
169 Ga0451577_0000744 3300042876 Bacteria 50061
170 Ga0451577_0013609 3300042876 Bacteria 7607
171 Ga0451577_0037304 3300042876 Bacteria 4375
172 Ga0453684_0004968 3300044712 Bacteria 27058
173 Ga0453684_0006695 3300044712 Bacteria 21742
174 Ga0453684_0153730 3300044712 Unclassified 2731
175 Ga0466957_0076074 3300044842 Bacteria 2084
176 Ga0451576_0035747 3300045051 Bacteria 5269
177 Ga0451576_0042064 3300045051 Bacteria 4825
178 Ga0451576_0046914 3300045051 Bacteria 4546
179 Ga0451576_0109687 3300045051 Bacteria 2872
180 Ga0451576_0303153 3300045051 Bacteria 1671
181 Ga0451576_0396475 3300045051 Bacteria 1447
182 Ga0495592_0000008 3300046454 Bacteria 175382
183 Ga0495592_0072704 3300046454 Bacteria 2501
184 Ga0495629_0018012 3300046459 Bacteria 5062
185 Ga0495651_0170685 3300046462 Bacteria 1549
186 Ga0495664_0059523 3300046477 Bacteria 2274
187 Ga0495618_0002128 3300046514 Bacteria 12975
188 Ga0495628_0000046 3300046516 Bacteria 97902
189 Ga0495628_0062764 3300046516 Bacteria 2912
190 Ga0495628_0080740 3300046516 Bacteria 2527
191 Ga0495630_0001985 3300046517 Bacteria 14252
192 Ga0495630_0008649 3300046517 Bacteria 7307
193 Ga0495630_0017974 3300046517 Bacteria 5188
194 Ga0495630_0026019 3300046517 Bacteria 4330
195 Ga0495666_0037872 3300046526 Unclassified 2345
196 Ga0495652_0009622 3300046529 Bacteria 8777
197 Ga0495640_0009108 3300046533 Bacteria 7749
198 Ga0495640_0059921 3300046533 Unclassified 2591
199 Ga0495586_0000586 3300046535 Bacteria 21136
200 Ga0495586_0001531 3300046535 Bacteria 12753
201 Ga0495586_0001886 3300046535 Bacteria 11406
202 Ga0495586_0013910 3300046535 Bacteria 4271
203 Ga0495645_0027730 3300046543 Bacteria 4114
204 Ga0495645_0053722 3300046543 Bacteria 2928
205 Ga0495622_0031726 3300046557 Unclassified 2468
206 Ga0495667_0014700 3300046559 Bacteria 5290
207 Ga0495667_0024498 3300046559 Unclassified 4064
208 Ga0495634_0001588 3300046642 Bacteria 19941
209 Ga0495634_0029409 3300046642 Bacteria 3804
210 Ga0495657_0021165 3300046675 Bacteria 4668
211 Ga0495599_0004295 3300046678 Bacteria 8427
212 Ga0495599_0056202 3300046678 Bacteria 2463
213 Ga0495658_0005710 3300046683 Bacteria 6112
214 Ga0495613_0000918 3300046689 Bacteria 22602
215 Ga0495613_0138952 3300046689 Bacteria 1737
216 Ga0495674_0003435 3300047319 Bacteria 15393
217 Ga0495674_0025382 3300047319 Bacteria 5434
218 Ga0495676_0047451 3300047321 Bacteria 3473
219 Ga0495680_0005148 3300047322 Bacteria 12345
220 Ga0501031_0000231 3300049568 Bacteria 31958
221 Ga0501033_0002690 3300049570 Bacteria 14908
222 Ga0501036_0109109 3300049572 Bacteria 2339
223 Ga0501046_0101798 3300049580 Bacteria 2203
224 Ga0501083_0170146 3300049744 Bacteria 1424
225 Ga0501035_0004691 3300049822 Bacteria 12974
226 Ga0501035_0007099 3300049822 Bacteria 10474
227 Ga0501035_0044593 3300049822 Bacteria 3993
228 Ga0501044_0066944 3300049823 Bacteria 3661
229 Ga0501044_0145251 3300049823 Unclassified 2358
230 nmdc:mga09592_95791_c1 3300050508 Bacteria 2539
231 nmdc:mga06r32_105535_c1 3300050510 Bacteria 2768
232 nmdc:mga08y16_151485_c1 3300050511 Bacteria 1710
233 nmdc:mga08y16_9965_c1 3300050511 Bacteria 5171
234 nmdc:mga0n895_149263_c1 3300050512 Unclassified 2367
235 nmdc:mga0rr50_134188_c1 3300050513 Bacteria 1985
236 Ga0500650_0069215 3300053098 Unclassified 1650

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014325 Ga0163163_10406467 Ga0163163_104064672 347
2 3300046533 Ga0495640_0059921 Ga0495640_0059921_1516_2562 348
3 3300046559 Ga0495667_0024498 Ga0495667_0024498_2691_3737 348
4 3300014325 Ga0163163_10215361 Ga0163163_102153612 351
5 3300035170 Ga0373943_0178900 Ga0373943_0178900_66_1139 357
6 3300005618 Ga0068864_100069760 Ga0068864_1000697602 374
7 3300026095 Ga0207676_10023076 Ga0207676_100230763 374
8 3300005438 Ga0070701_10097496 Ga0070701_100974961 375
9 3300005844 Ga0068862_100096692 Ga0068862_1000966922 375
10 3300009094 Ga0111539_10046909 Ga0111539_100469092 380
11 3300050511 nmdc:mga08y16_9965_c1 nmdc:mga08y16_9965_c1_924_2147 380
12 3300005841 Ga0068863_100038775 Ga0068863_1000387754 387
13 3300009553 Ga0105249_10344841 Ga0105249_103448411 388
14 3300028558 Ga0265326_10009272 Ga0265326_100092722 389
15 3300028800 Ga0265338_10000038 Ga0265338_10000038206 389
16 3300028800 Ga0265338_10000533 Ga0265338_1000053349 389
17 3300028800 Ga0265338_10092284 Ga0265338_100922842 389
18 3300029957 Ga0265324_10000237 Ga0265324_100002377 389
19 3300031665 Ga0316575_10002131 Ga0316575_100021314 392
20 3300031728 Ga0316578_10010437 Ga0316578_100104372 392
21 3300032137 Ga0316585_10025931 Ga0316585_100259311 392
22 3300035398 Ga0316574_0005822 Ga0316574_0005822_487_1695 392
23 3300036712 Ga0316584_0005641 Ga0316584_0005641_6028_7236 392
24 3300037588 Ga0316581_0002452 Ga0316581_0002452_415_1623 392
25 3300045051 Ga0451576_0042064 Ga0451576_0042064_240_1463 393
26 3300025929 Ga0207664_10068565 Ga0207664_100685652 394
27 3300029957 Ga0265324_10011775 Ga0265324_100117752 394
28 3300009093 Ga0105240_10017731 Ga0105240_100177318 401
29 3300005844 Ga0068862_100395561 Ga0068862_1003955611 405
30 3300006871 Ga0075434_100127353 Ga0075434_1001273532 405
31 3300009094 Ga0111539_10189505 Ga0111539_101895053 405
32 3300028380 Ga0268265_10146355 Ga0268265_101463551 405
33 3300045051 Ga0451576_0046914 Ga0451576_0046914_612_1835 405
34 3300050511 nmdc:mga08y16_151485_c1 nmdc:mga08y16_151485_c1_35_1258 405
35 3300050512 nmdc:mga0n895_149263_c1 nmdc:mga0n895_149263_c1_830_2053 405
36 3300005330 Ga0070690_100009033 Ga0070690_1000090335 406
37 3300005842 Ga0068858_100067816 Ga0068858_1000678163 406
38 3300028563 Ga0265319_1000004 Ga0265319_100000423 406
39 3300028800 Ga0265338_10017471 Ga0265338_100174713 406
40 3300028800 Ga0265338_10062682 Ga0265338_100626824 406
41 3300031595 Ga0265313_10001842 Ga0265313_1000184218 406
42 3300035083 Ga0373926_0044215 Ga0373926_0044215_89_1309 406
43 3300035171 Ga0373946_0031640 Ga0373946_0031640_673_1893 406
44 3300035692 Ga0373935_0005978 Ga0373935_0005978_655_1875 406
45 3300035695 Ga0373927_0039415 Ga0373927_0039415_977_2197 406
46 3300037068 Ga0373925_0009188 Ga0373925_0009188_5282_6502 406
47 3300046517 Ga0495630_0026019 Ga0495630_0026019_2073_3293 406
48 3300046526 Ga0495666_0037872 Ga0495666_0037872_545_1765 406
49 3300005327 Ga0070658_10026311 Ga0070658_100263113 407
50 3300005335 Ga0070666_10056843 Ga0070666_100568432 407
51 3300005340 Ga0070689_100001437 Ga0070689_1000014379 407
52 3300005340 Ga0070689_100029895 Ga0070689_1000298951 407
53 3300005340 Ga0070689_100087366 Ga0070689_1000873661 407
54 3300005365 Ga0070688_100022278 Ga0070688_1000222782 407
55 3300005365 Ga0070688_100197834 Ga0070688_1001978341 407
56 3300005435 Ga0070714_100006898 Ga0070714_1000068982 407
57 3300005436 Ga0070713_100286908 Ga0070713_1002869082 407
58 3300005438 Ga0070701_10002332 Ga0070701_100023323 407
59 3300005439 Ga0070711_100003138 Ga0070711_1000031384 407
60 3300005440 Ga0070705_100017578 Ga0070705_1000175781 407
61 3300005445 Ga0070708_100284733 Ga0070708_1002847331 407
62 3300005466 Ga0070685_10053317 Ga0070685_100533172 407
63 3300005535 Ga0070684_100100101 Ga0070684_1001001012 407
64 3300005539 Ga0068853_100105873 Ga0068853_1001058732 407
65 3300005544 Ga0070686_100002854 Ga0070686_1000028547 407
66 3300005549 Ga0070704_100006285 Ga0070704_1000062852 407
67 3300005563 Ga0068855_100005564 Ga0068855_10000556415 407
68 3300005563 Ga0068855_100112992 Ga0068855_1001129922 407
69 3300005563 Ga0068855_100210086 Ga0068855_1002100862 407
70 3300005577 Ga0068857_100011538 Ga0068857_1000115382 407
71 3300005614 Ga0068856_100000160 Ga0068856_1000001604 407
72 3300005617 Ga0068859_100293900 Ga0068859_1002939002 407
73 3300005618 Ga0068864_100033417 Ga0068864_1000334174 407
74 3300005841 Ga0068863_100089044 Ga0068863_1000890441 407
75 3300005937 Ga0081455_10133766 Ga0081455_101337661 407
76 3300006173 Ga0070716_100017372 Ga0070716_1000173723 407
77 3300006175 Ga0070712_100226331 Ga0070712_1002263311 407
78 3300006237 Ga0097621_100128992 Ga0097621_1001289922 407
79 3300006358 Ga0068871_100057445 Ga0068871_1000574453 407
80 3300006847 Ga0075431_100126351 Ga0075431_1001263514 407
81 3300006931 Ga0097620_100293923 Ga0097620_1002939232 407
82 3300006931 Ga0097620_100454622 Ga0097620_1004546221 407
83 3300007076 Ga0075435_100144842 Ga0075435_1001448423 407
84 3300007076 Ga0075435_100217147 Ga0075435_1002171472 407
85 3300009093 Ga0105240_10224669 Ga0105240_102246693 407
86 3300009094 Ga0111539_10246323 Ga0111539_102463232 407
87 3300009098 Ga0105245_10326660 Ga0105245_103266601 407
88 3300009177 Ga0105248_10254140 Ga0105248_102541402 407
89 3300009551 Ga0105238_10011445 Ga0105238_100114456 407
90 3300009551 Ga0105238_10012685 Ga0105238_100126859 407
91 3300009551 Ga0105238_10013879 Ga0105238_100138796 407
92 3300009551 Ga0105238_10060027 Ga0105238_100600272 407
93 3300009553 Ga0105249_10118884 Ga0105249_101188843 407
94 3300013296 Ga0157374_10067538 Ga0157374_100675384 407
95 3300013297 Ga0157378_10066548 Ga0157378_100665483 407
96 3300013297 Ga0157378_10261800 Ga0157378_102618001 407
97 3300013308 Ga0157375_10000041 Ga0157375_1000004181 407
98 3300013308 Ga0157375_10046365 Ga0157375_100463656 407
99 3300014325 Ga0163163_10000027 Ga0163163_10000027146 407
100 3300014325 Ga0163163_10045373 Ga0163163_100453735 407
101 3300025903 Ga0207680_10051086 Ga0207680_100510862 407
102 3300025913 Ga0207695_10075497 Ga0207695_100754973 407
103 3300025913 Ga0207695_10143005 Ga0207695_101430052 407
104 3300025916 Ga0207663_10006670 Ga0207663_100066702 407
105 3300025922 Ga0207646_10185884 Ga0207646_101858842 407
106 3300025924 Ga0207694_10015507 Ga0207694_100155073 407
107 3300025924 Ga0207694_10058513 Ga0207694_100585133 407
108 3300025927 Ga0207687_10187413 Ga0207687_101874132 407
109 3300025928 Ga0207700_10356378 Ga0207700_103563781 407
110 3300025936 Ga0207670_10052075 Ga0207670_100520752 407
111 3300025944 Ga0207661_10105590 Ga0207661_101055901 407
112 3300025949 Ga0207667_10058353 Ga0207667_100583533 407
113 3300026041 Ga0207639_10072927 Ga0207639_100729272 407
114 3300026078 Ga0207702_10008624 Ga0207702_100086245 407
115 3300026078 Ga0207702_10026615 Ga0207702_100266156 407
116 3300026116 Ga0207674_10005182 Ga0207674_100051822 407
117 3300026116 Ga0207674_10208322 Ga0207674_102083222 407
118 3300028556 Ga0265337_1001858 Ga0265337_10018586 407
119 3300028556 Ga0265337_1002186 Ga0265337_10021868 407
120 3300028556 Ga0265337_1010539 Ga0265337_10105391 407
121 3300028556 Ga0265337_1013930 Ga0265337_10139303 407
122 3300028563 Ga0265319_1002911 Ga0265319_10029117 407
123 3300028563 Ga0265319_1016410 Ga0265319_10164102 407
124 3300028573 Ga0265334_10031957 Ga0265334_100319571 407
125 3300028577 Ga0265318_10031991 Ga0265318_100319911 407
126 3300028800 Ga0265338_10000402 Ga0265338_1000040214 407
127 3300028800 Ga0265338_10000631 Ga0265338_1000063114 407
128 3300028800 Ga0265338_10000702 Ga0265338_100007028 407
129 3300028800 Ga0265338_10001287 Ga0265338_1000128711 407
130 3300028800 Ga0265338_10002914 Ga0265338_100029144 407
131 3300028800 Ga0265338_10003929 Ga0265338_100039294 407
132 3300028800 Ga0265338_10004069 Ga0265338_100040696 407
133 3300028800 Ga0265338_10005466 Ga0265338_1000546617 407
134 3300028800 Ga0265338_10020099 Ga0265338_100200993 407
135 3300028800 Ga0265338_10030971 Ga0265338_100309716 407
136 3300028800 Ga0265338_10032943 Ga0265338_100329432 407
137 3300028800 Ga0265338_10068081 Ga0265338_100680812 407
138 3300028800 Ga0265338_10149837 Ga0265338_101498372 407
139 3300028800 Ga0265338_10168486 Ga0265338_101684862 407
140 3300028800 Ga0265338_10192351 Ga0265338_101923512 407
141 3300029957 Ga0265324_10005831 Ga0265324_100058315 407
142 3300029957 Ga0265324_10010686 Ga0265324_100106862 407
143 3300031238 Ga0265332_10018236 Ga0265332_100182362 407
144 3300031238 Ga0265332_10031273 Ga0265332_100312731 407
145 3300031240 Ga0265320_10002227 Ga0265320_100022273 407
146 3300031240 Ga0265320_10003594 Ga0265320_100035946 407
147 3300031240 Ga0265320_10025923 Ga0265320_100259231 407
148 3300031241 Ga0265325_10007939 Ga0265325_100079395 407
149 3300031242 Ga0265329_10007020 Ga0265329_100070203 407
150 3300031247 Ga0265340_10023719 Ga0265340_100237194 407
151 3300031249 Ga0265339_10003742 Ga0265339_100037428 407
152 3300031249 Ga0265339_10006089 Ga0265339_100060896 407
153 3300031251 Ga0265327_10000705 Ga0265327_1000070525 407
154 3300031251 Ga0265327_10004308 Ga0265327_100043085 407
155 3300031251 Ga0265327_10010945 Ga0265327_100109457 407
156 3300031251 Ga0265327_10032198 Ga0265327_100321983 407
157 3300031711 Ga0265314_10000034 Ga0265314_10000034119 407
158 3300031711 Ga0265314_10016069 Ga0265314_100160697 407
159 3300031711 Ga0265314_10026022 Ga0265314_100260224 407
160 3300031712 Ga0265342_10046451 Ga0265342_100464513 407
161 3300031712 Ga0265342_10081754 Ga0265342_100817541 407
162 3300034816 Ga0373930_0008833 Ga0373930_0008833_361_1584 407
163 3300035084 Ga0373928_0000057 Ga0373928_0000057_18266_19489 407
164 3300035085 Ga0373929_0000184 Ga0373929_0000184_7738_8961 407
165 3300035112 Ga0373932_0000003 Ga0373932_0000003_171877_173100 407
166 3300035119 Ga0373956_0011896 Ga0373956_0011896_1757_2980 407
167 3300035119 Ga0373956_0096596 Ga0373956_0096596_116_1339 407
168 3300035242 Ga0373962_0000163 Ga0373962_0000163_168_1391 407
169 3300035691 Ga0373931_0000017 Ga0373931_0000017_171735_172958 407
170 3300035691 Ga0373931_0057093 Ga0373931_0057093_702_1925 407
171 3300035692 Ga0373935_0135660 Ga0373935_0135660_184_1407 407
172 3300035725 Ga0373947_0016219 Ga0373947_0016219_597_1820 407
173 3300036401 Ga0373937_0002204 Ga0373937_0002204_7381_8604 407
174 3300037068 Ga0373925_0000137 Ga0373925_0000137_12174_13397 407
175 3300037068 Ga0373925_0011782 Ga0373925_0011782_183_1406 407
176 3300037068 Ga0373925_0053781 Ga0373925_0053781_628_1851 407
177 3300038443 Ga0395901_0421942 Ga0395901_0421942_94_1320 407
178 3300042876 Ga0451577_0000744 Ga0451577_0000744_27254_28477 407
179 3300042876 Ga0451577_0013609 Ga0451577_0013609_2520_3746 407
180 3300042876 Ga0451577_0037304 Ga0451577_0037304_1986_3212 407
181 3300044712 Ga0453684_0004968 Ga0453684_0004968_9335_10561 407
182 3300044712 Ga0453684_0006695 Ga0453684_0006695_14566_15789 407
183 3300044712 Ga0453684_0153730 Ga0453684_0153730_415_1644 407
184 3300044842 Ga0466957_0076074 Ga0466957_0076074_461_1684 407
185 3300045051 Ga0451576_0035747 Ga0451576_0035747_246_1469 407
186 3300045051 Ga0451576_0109687 Ga0451576_0109687_783_2006 407
187 3300045051 Ga0451576_0303153 Ga0451576_0303153_363_1589 407
188 3300045051 Ga0451576_0396475 Ga0451576_0396475_123_1349 407
189 3300046454 Ga0495592_0000008 Ga0495592_0000008_149800_151023 407
190 3300046454 Ga0495592_0072704 Ga0495592_0072704_113_1336 407
191 3300046459 Ga0495629_0018012 Ga0495629_0018012_1576_2799 407
192 3300046462 Ga0495651_0170685 Ga0495651_0170685_160_1383 407
193 3300046477 Ga0495664_0059523 Ga0495664_0059523_329_1552 407
194 3300046514 Ga0495618_0002128 Ga0495618_0002128_10340_11563 407
195 3300046516 Ga0495628_0000046 Ga0495628_0000046_72253_73476 407
196 3300046516 Ga0495628_0062764 Ga0495628_0062764_211_1434 407
197 3300046516 Ga0495628_0080740 Ga0495628_0080740_1211_2434 407
198 3300046517 Ga0495630_0001985 Ga0495630_0001985_10904_12127 407
199 3300046517 Ga0495630_0008649 Ga0495630_0008649_1985_3208 407
200 3300046517 Ga0495630_0017974 Ga0495630_0017974_3706_4929 407
201 3300046529 Ga0495652_0009622 Ga0495652_0009622_7452_8675 407
202 3300046533 Ga0495640_0009108 Ga0495640_0009108_1633_2856 407
203 3300046535 Ga0495586_0000586 Ga0495586_0000586_10892_12115 407
204 3300046535 Ga0495586_0001531 Ga0495586_0001531_4745_5968 407
205 3300046535 Ga0495586_0001886 Ga0495586_0001886_2202_3425 407
206 3300046535 Ga0495586_0013910 Ga0495586_0013910_1296_2519 407
207 3300046543 Ga0495645_0027730 Ga0495645_0027730_1988_3211 407
208 3300046543 Ga0495645_0053722 Ga0495645_0053722_187_1410 407
209 3300046557 Ga0495622_0031726 Ga0495622_0031726_545_1768 407
210 3300046559 Ga0495667_0014700 Ga0495667_0014700_601_1824 407
211 3300046642 Ga0495634_0001588 Ga0495634_0001588_15627_16850 407
212 3300046642 Ga0495634_0029409 Ga0495634_0029409_142_1365 407
213 3300046675 Ga0495657_0021165 Ga0495657_0021165_346_1632 407
214 3300046678 Ga0495599_0004295 Ga0495599_0004295_2461_3684 407
215 3300046678 Ga0495599_0056202 Ga0495599_0056202_179_1402 407
216 3300046683 Ga0495658_0005710 Ga0495658_0005710_3054_4277 407
217 3300046689 Ga0495613_0000918 Ga0495613_0000918_15160_16383 407
218 3300046689 Ga0495613_0138952 Ga0495613_0138952_399_1622 407
219 3300047319 Ga0495674_0003435 Ga0495674_0003435_10903_12126 407
220 3300047319 Ga0495674_0025382 Ga0495674_0025382_963_2186 407
221 3300047321 Ga0495676_0047451 Ga0495676_0047451_105_1328 407
222 3300047322 Ga0495680_0005148 Ga0495680_0005148_9921_11144 407
223 3300049568 Ga0501031_0000231 Ga0501031_0000231_17809_19032 407
224 3300049570 Ga0501033_0002690 Ga0501033_0002690_2124_3347 407
225 3300049572 Ga0501036_0109109 Ga0501036_0109109_442_1665 407
226 3300049580 Ga0501046_0101798 Ga0501046_0101798_513_1736 407
227 3300049744 Ga0501083_0170146 Ga0501083_0170146_139_1398 407
228 3300049822 Ga0501035_0004691 Ga0501035_0004691_9659_10882 407
229 3300049822 Ga0501035_0007099 Ga0501035_0007099_5133_6356 407
230 3300049822 Ga0501035_0044593 Ga0501035_0044593_819_2042 407
231 3300049823 Ga0501044_0066944 Ga0501044_0066944_1398_2621 407
232 3300049823 Ga0501044_0145251 Ga0501044_0145251_765_1988 407
233 3300050508 nmdc:mga09592_95791_c1 nmdc:mga09592_95791_c1_70_1296 407
234 3300050510 nmdc:mga06r32_105535_c1 nmdc:mga06r32_105535_c1_624_1847 407
235 3300050513 nmdc:mga0rr50_134188_c1 nmdc:mga0rr50_134188_c1_708_1931 407
236 3300053098 Ga0500650_0069215 Ga0500650_0069215_369_1592 407

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01676

Metalloenzyme

Metalloenzyme superfamily

36

419

0.94

PF10143

PhosphMutase

2,3-bisphosphoglycerate-independent phosphoglycerate mutase

73

248

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zkt-assembly1.cif.gz_B structure of ph0037 protein from pyrococcus horikoshii 0.8126 13 407
2zkt-assembly1.cif.gz_B structure of ph0037 protein from pyrococcus horikoshii 0.8106 13 407
2zkt-assembly1.cif.gz_A structure of ph0037 protein from pyrococcus horikoshii 0.8036 12 407
2zkt-assembly1.cif.gz_A structure of ph0037 protein from pyrococcus horikoshii 0.8013 12 407
3kd8-assembly1.cif.gz_A cofactor-independent phosphoglycerate mutase from thermoplasma acidophilum dsm 1728 0.7658 16 399
ID Description Score Start End Superfamily
af_Q59007_75_170_3.30.70.2130 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Metalloenzyme domain 0.9145 89 186 3.30.70.2130
af_Q59007_75_170_3.30.70.2130 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Metalloenzyme domain 0.9055 89 186 3.30.70.2130
af_K7MV60_82_185_3.30.70.2130 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Metalloenzyme domain 0.9024 89 190 3.30.70.2130
af_K7MV60_82_185_3.30.70.2130 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Metalloenzyme domain 0.8782 89 190 3.30.70.2130
3iddB01 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.8641 17 368 3.40.720.10
ID Description Score Start End GO Terms
AF-X1TRT9-F1-model_v4 Uncharacterized protein 0.9775 99 230 GO:0046537
AF-X1TRT9-F1-model_v4 Uncharacterized protein 0.9416 99 230 GO:0046537
AF-A0A7V6EC93-F1-model_v4 Phosphonopyruvate decarboxylase-related protein 0.9326 3 243 GO:0006096
GO:0046537
GO:0046872
AF-X1G4Z3-F1-model_v4 Uncharacterized protein 0.9295 129 225 GO:0046537
AF-X1Q1W8-F1-model_v4 Metalloenzyme domain-containing protein 0.9256 97 363 GO:0006096
GO:0046537
GO:0046872

Feature Viewer

pLDDT pTM Quality
86.03 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map