F349319

General Info

Members Datasets Scaffolds Average Seq Length
236 140 472 328

Family's Representative Sequence

Representative Sequence 3300044693|Ga0466961_0055098|Ga0466961_0055098_1414_2448
Length 344
Sequence MRSYADNVGIVAAVDWAAYESEAARAIAAATAAPELDAARVRYLGRRSELAQALRGVRDRERGLLLNGVRQRLEQAAAERGRTLADEELDRRLREETVDVTLPGESLPLGHLHPITQVRRIVEDAFLGLGYEIRDDREVETVEYNFDKLAFAPTHSARSHRDTFFFDDGRLLRTETSPSQIHALEERPPPTYMVSIGRVYRRDAITATRYPIFHQFEGLAVDRGITLADLKGTLLHVMRALYGPDRRVRFRTHFFPFTEPSIEPDVSCGICGGAGCRTCKFSGWIEMGGAGVVDPQVFENVGLDPQEWSGFAFGCGLERAAQLRHDIPDIRALWEGDLRVLRQF

Samples

Sample ID Description Type Environment
1 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
66 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
67 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
68 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
69 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
70 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
71 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
72 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
73 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
74 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
75 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
76 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
77 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
78 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
79 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
80 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
81 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
82 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
83 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
84 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
85 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
86 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
87 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
88 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
89 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
90 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
91 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
92 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
93 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
94 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
95 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
96 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
97 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
98 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
99 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
100 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
101 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
102 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
103 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
104 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
105 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
106 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
107 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
108 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
109 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
110 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
111 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
112 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
113 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
114 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
115 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
116 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
117 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
118 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
119 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
120 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
121 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
122 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
123 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
124 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
126 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
127 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
128 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
129 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
130 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
131 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
134 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
135 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
136 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
137 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
138 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
139 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
140 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.85
Nodule 0
Rhizoplane 9.75
Rhizosphere 89.41
Stem 0
Stem Tuber 0
Unclassified 2.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466961_0055098 3300044693 Bacteria 2536
2 Ga0070658_10036612 3300005327 Bacteria 3955
3 Ga0070683_100011814 3300005329 Bacteria 7564
4 Ga0070683_100020881 3300005329 Bacteria 5837
5 Ga0070680_100013534 3300005336 Bacteria 6355
6 Ga0068868_100350294 3300005338 Bacteria 1264
7 Ga0070660_100002902 3300005339 Bacteria 11796
8 Ga0070661_100166833 3300005344 Bacteria 1671
9 Ga0070667_100008761 3300005367 Bacteria 8385
10 Ga0070714_100257932 3300005435 Bacteria 1614
11 Ga0070714_100285371 3300005435 Bacteria 1535
12 Ga0070708_100065158 3300005445 Bacteria 3267
13 Ga0070707_100057060 3300005468 Bacteria 3746
14 Ga0070698_100002618 3300005471 Bacteria 19818
15 Ga0070698_100034655 3300005471 Bacteria 5224
16 Ga0070699_100140276 3300005518 Bacteria 2134
17 Ga0070679_100029376 3300005530 Bacteria 5424
18 Ga0070684_100008337 3300005535 Bacteria 8094
19 Ga0070684_100143982 3300005535 Bacteria 2157
20 Ga0070697_100113255 3300005536 Bacteria 2263
21 Ga0070697_100197114 3300005536 Bacteria 1711
22 Ga0070696_100037888 3300005546 Bacteria 3326
23 Ga0068855_100061845 3300005563 Bacteria 4373
24 Ga0068855_100281699 3300005563 Bacteria 1846
25 Ga0070664_100166924 3300005564 Bacteria 1951
26 Ga0068857_100031798 3300005577 Bacteria 4663
27 Ga0081455_10000934 3300005937 Bacteria 37343
28 Ga0081455_10020077 3300005937 Bacteria 6304
29 Ga0081455_10040902 3300005937 Bacteria 4084
30 Ga0081540_1001698 3300005983 Bacteria 18681
31 Ga0081539_10002150 3300005985 Bacteria 29119
32 Ga0075365_10108647 3300006038 Bacteria 1905
33 Ga0075364_10051881 3300006051 Bacteria 2679
34 Ga0075432_10080474 3300006058 Bacteria 1181
35 Ga0070712_100229178 3300006175 Bacteria 1474
36 Ga0075428_100000925 3300006844 Bacteria 31021
37 Ga0075428_100167704 3300006844 Bacteria 2381
38 Ga0075430_100142739 3300006846 Bacteria 1994
39 Ga0075431_100059054 3300006847 Bacteria 3958
40 Ga0075434_100045736 3300006871 Bacteria 4343
41 Ga0075429_100441362 3300006880 Bacteria 1140
42 Ga0075436_100059873 3300006914 Unclassified 2631
43 Ga0075435_100118113 3300007076 Bacteria 2211
44 Ga0111539_10027134 3300009094 Bacteria 6994
45 Ga0114129_10006452 3300009147 Bacteria 16632
46 Ga0114129_10049490 3300009147 Bacteria 5905
47 Ga0114129_10409578 3300009147 Bacteria 1786
48 Ga0157370_10008874 3300013104 Bacteria 10806
49 Ga0157370_10130410 3300013104 Bacteria 2345
50 Ga0157369_10009010 3300013105 Bacteria 11428
51 Ga0157369_10010102 3300013105 Bacteria 10775
52 Ga0157369_10030868 3300013105 Bacteria 5908
53 Ga0157374_10230931 3300013296 Bacteria 1817
54 Ga0206353_10445973 3300020082 Bacteria 3630
55 Ga0207699_10111909 3300025906 Bacteria 1751
56 Ga0207699_10271412 3300025906 Bacteria 1175
57 Ga0207705_10172626 3300025909 Bacteria 1628
58 Ga0207705_10183596 3300025909 Bacteria 1579
59 Ga0207684_10084967 3300025910 Bacteria 2695
60 Ga0207707_10081088 3300025912 Bacteria 2832
61 Ga0207693_10001413 3300025915 Bacteria 21296
62 Ga0207693_10039515 3300025915 Bacteria 3716
63 Ga0207663_10069230 3300025916 Bacteria 2269
64 Ga0207662_10061539 3300025918 Bacteria 2254
65 Ga0207657_10001894 3300025919 Bacteria 22600
66 Ga0207657_10158225 3300025919 Bacteria 1841
67 Ga0207649_10085378 3300025920 Bacteria 2054
68 Ga0207649_10113040 3300025920 Bacteria 1818
69 Ga0207652_10183813 3300025921 Bacteria 1879
70 Ga0207646_10101581 3300025922 Bacteria 2578
71 Ga0207664_10067584 3300025929 Bacteria 2869
72 Ga0207664_10197588 3300025929 Unclassified 1734
73 Ga0207664_10247106 3300025929 Bacteria 1556
74 Ga0207664_10403388 3300025929 Unclassified 1216
75 Ga0207644_10169752 3300025931 Bacteria 1702
76 Ga0207690_10287180 3300025932 Bacteria 1283
77 Ga0207706_10200404 3300025933 Bacteria 1751
78 Ga0207706_10262653 3300025933 Bacteria 1507
79 Ga0207665_10014753 3300025939 Bacteria 5139
80 Ga0207661_10023618 3300025944 Bacteria 4648
81 Ga0207667_10264610 3300025949 Bacteria 1758
82 Ga0207658_10010432 3300025986 Bacteria 6310
83 Ga0207677_10237412 3300026023 Bacteria 1472
84 Ga0207702_10320664 3300026078 Bacteria 1475
85 Ga0207674_10004276 3300026116 Bacteria 17218
86 Ga0207675_100179853 3300026118 Bacteria 2025
87 Ga0207698_10098965 3300026142 Bacteria 2411
88 Ga0207428_10019162 3300027907 Bacteria 5834
89 Ga0265338_10096611 3300028800 Bacteria 2423
90 Ga0265338_10181855 3300028800 Bacteria 1602
91 Ga0373930_0026996 3300034816 Bacteria 1161
92 Ga0373941_0028582 3300035115 Bacteria 1638
93 Ga0373943_0017492 3300035170 Bacteria 3281
94 Ga0316574_0205270 3300035398 Bacteria 1265
95 Ga0373933_0027735 3300035724 Bacteria 3264
96 Ga0373947_0005587 3300035725 Bacteria 7332
97 Ga0395899_0016432 3300037312 Bacteria 5641
98 Ga0395899_0044172 3300037312 Bacteria 3321
99 Ga0395899_0062106 3300037312 Bacteria 2751
100 Ga0395899_0070443 3300037312 Bacteria 2559
101 Ga0395899_0162252 3300037312 Bacteria 1578
102 Ga0395900_0025686 3300037418 Bacteria 6030
103 Ga0395900_0026888 3300037418 Bacteria 5888
104 Ga0395900_0032926 3300037418 Bacteria 5332
105 Ga0395900_0079327 3300037418 Bacteria 3373
106 Ga0395900_0133933 3300037418 Bacteria 2538
107 Ga0395900_0189339 3300037418 Bacteria 2088
108 Ga0395900_0244124 3300037418 Bacteria 1800
109 Ga0395900_0249656 3300037418 Bacteria 1776
110 Ga0395900_0297376 3300037418 Bacteria 1601
111 Ga0395900_0464312 3300037418 Bacteria 1220
112 Ga0395900_0531632 3300037418 Bacteria 1122
113 Ga0395898_0011102 3300037466 Bacteria 9377
114 Ga0395898_0020170 3300037466 Bacteria 6772
115 Ga0395898_0030573 3300037466 Bacteria 5388
116 Ga0395898_0035109 3300037466 Bacteria 4990
117 Ga0395898_0061077 3300037466 Bacteria 3661
118 Ga0395898_0099825 3300037466 Bacteria 2788
119 Ga0395898_0248229 3300037466 Bacteria 1697
120 Ga0395898_0256891 3300037466 Bacteria 1666
121 Ga0395905_0026173 3300037471 Bacteria 5501
122 Ga0395905_0033526 3300037471 Bacteria 4823
123 Ga0395905_0038450 3300037471 Bacteria 4490
124 Ga0395905_0047998 3300037471 Bacteria 4001
125 Ga0395905_0057994 3300037471 Bacteria 3621
126 Ga0395905_0353857 3300037471 Bacteria 1361
127 Ga0395905_0376071 3300037471 Bacteria 1314
128 Ga0395905_0426805 3300037471 Bacteria 1222
129 Ga0395901_0020977 3300038443 Bacteria 6693
130 Ga0395901_0024804 3300038443 Bacteria 6155
131 Ga0395901_0067464 3300038443 Bacteria 3725
132 Ga0395901_0179384 3300038443 Bacteria 2221
133 Ga0395901_0374048 3300038443 Bacteria 1467
134 Ga0395901_0386624 3300038443 Bacteria 1439
135 Ga0395901_0425745 3300038443 Bacteria 1360
136 Ga0436360_0150526 3300039438 Bacteria 914
137 Ga0439431_0019030 3300041997 Bacteria 1629
138 Ga0439445_0021490 3300042004 Bacteria 1622
139 Ga0439446_0000660 3300042156 Bacteria 7160
140 Ga0466966_0136550 3300044684 Bacteria 1500
141 Ga0466963_0035397 3300044694 Bacteria 3253
142 Ga0466964_0006226 3300044706 Bacteria 4449
143 Ga0466964_0049337 3300044706 Bacteria 1723
144 Ga0466971_0146839 3300044719 Bacteria 1100
145 Ga0466957_0119053 3300044842 Bacteria 1682
146 Ga0466957_0149861 3300044842 Bacteria 1508
147 Ga0466967_0015239 3300045976 Bacteria 6022
148 Ga0466967_0076740 3300045976 Bacteria 3006
149 Ga0466967_0159920 3300045976 Bacteria 2113
150 Ga0466967_0248504 3300045976 Bacteria 1699
151 Ga0495592_0082982 3300046454 Bacteria 2315
152 Ga0495629_0074346 3300046459 Bacteria 2373
153 Ga0495629_0290507 3300046459 Bacteria 1121
154 Ga0495641_0079219 3300046461 Bacteria 1472
155 Ga0495651_0012441 3300046462 Bacteria 6562
156 Ga0495651_0037938 3300046462 Bacteria 3752
157 Ga0495651_0174334 3300046462 Bacteria 1528
158 Ga0495582_0017713 3300046473 Bacteria 3895
159 Ga0495582_0109531 3300046473 Bacteria 1551
160 Ga0495608_0004926 3300046511 Bacteria 9565
161 Ga0495608_0011554 3300046511 Bacteria 6143
162 Ga0495618_0040707 3300046514 Bacteria 2926
163 Ga0495618_0076580 3300046514 Bacteria 2132
164 Ga0495630_0006731 3300046517 Bacteria 8191
165 Ga0495630_0051565 3300046517 Bacteria 3080
166 Ga0495665_0056441 3300046531 Bacteria 2073
167 Ga0495665_0084990 3300046531 Bacteria 1663
168 Ga0495587_0065270 3300046536 Bacteria 2126
169 Ga0495667_0007908 3300046559 Bacteria 7208
170 Ga0495667_0016590 3300046559 Bacteria 4973
171 Ga0495635_0038426 3300046663 Bacteria 3315
172 Ga0495657_0029423 3300046675 Bacteria 3853
173 Ga0495657_0113802 3300046675 Bacteria 1711
174 Ga0495657_0187648 3300046675 Bacteria 1265
175 Ga0495647_0007916 3300046681 Bacteria 3569
176 Ga0495658_0051435 3300046683 Bacteria 2334
177 Ga0495613_0008261 3300046689 Bacteria 7727
178 Ga0495589_0017137 3300046794 Bacteria 3720
179 Ga0495581_0003423 3300047315 Bacteria 9108
180 Ga0495604_0045431 3300047317 Bacteria 3428
181 Ga0495674_0009942 3300047319 Bacteria 9020
182 Ga0495674_0280511 3300047319 Bacteria 1365
183 Ga0495676_0014251 3300047321 Bacteria 7117
184 Ga0495676_0077462 3300047321 Bacteria 2535
185 Ga0495680_0002078 3300047322 Bacteria 20832
186 Ga0495680_0003625 3300047322 Bacteria 15102
187 Ga0495684_0007333 3300047471 Bacteria 8544
188 Ga0495684_0022751 3300047471 Bacteria 4820
189 Ga0495684_0025294 3300047471 Bacteria 4564
190 Ga0496101_0054927 3300048904 Bacteria 2875
191 Ga0496102_0062781 3300048905 Bacteria 3402
192 Ga0496102_0186402 3300048905 Bacteria 1955
193 Ga0496103_0096983 3300048906 Unclassified 1863
194 Ga0496104_0059523 3300048907 Bacteria 3616
195 Ga0496105_0081654 3300048908 Bacteria 2670
196 Ga0496107_0039989 3300048910 Bacteria 3365
197 Ga0496107_0180717 3300048910 Bacteria 1566
198 Ga0496108_0142092 3300048911 Bacteria 2068
199 Ga0496108_0248176 3300048911 Bacteria 1548
200 Ga0496109_0014999 3300048912 Bacteria 6744
201 Ga0496109_0016139 3300048912 Bacteria 6527
202 Ga0496110_0055726 3300048913 Bacteria 3479
203 Ga0496110_0100263 3300048913 Bacteria 2596
204 Ga0496112_0010011 3300048915 Bacteria 8582
205 Ga0496113_0174951 3300048916 Bacteria 1701
206 Ga0496113_0232095 3300048916 Bacteria 1471
207 Ga0496114_0030751 3300048917 Bacteria 4418
208 Ga0496114_0117446 3300048917 Bacteria 2285
209 Ga0496114_0129634 3300048917 Bacteria 2177
210 Ga0496114_0159928 3300048917 Bacteria 1958
211 Ga0496115_0003848 3300048918 Bacteria 10819
212 Ga0496115_0195915 3300048918 Bacteria 1669
213 Ga0501031_0252554 3300049568 Bacteria 1146
214 Ga0501067_0101550 3300049583 Bacteria 1598
215 Ga0501069_0086822 3300049585 Bacteria 1766
216 Ga0501070_0001263 3300049586 Bacteria 22706
217 Ga0501070_0046344 3300049586 Bacteria 3615
218 Ga0501077_0013312 3300049593 Bacteria 5159
219 Ga0501079_0138249 3300049741 Bacteria 1897
220 Ga0501279_014284 3300049775 Bacteria 1092
221 Ga0501035_0500532 3300049822 Bacteria 1000
222 nmdc:mga05p37_19262_c1 3300050507 Bacteria 8254
223 nmdc:mga05p37_290433_c1 3300050507 Bacteria 1946
224 nmdc:mga09592_69944_c1 3300050508 Bacteria 2977
225 nmdc:mga09592_8900_c1 3300050508 Bacteria 8164
226 nmdc:mga06r32_103190_c1 3300050510 Bacteria 2800
227 nmdc:mga06r32_224622_c1 3300050510 Bacteria 1866
228 nmdc:mga08y16_17696_c1 3300050511 Bacteria 7507
229 nmdc:mga08y16_36098_c1 3300050511 Bacteria 5190
230 nmdc:mga0rr50_26370_c1 3300050513 Unclassified 4053
231 nmdc:mga0rr50_70033_c1 3300050513 Bacteria 2672
232 nmdc:mga08x19_62789_c1 3300050514 Bacteria 2409
233 nmdc:mga0a205_230919_c1 3300050515 Bacteria 1733
234 Ga0495619_0052656 3300053085 Bacteria 2691
235 Ga0530510_0068436 3300061734 Bacteria 2576
236 Ga0530510_0144375 3300061734 Bacteria 1755
237 Ga0466961_0055098
238 Ga0070658_10036612
239 Ga0070683_100011814
240 Ga0070683_100020881
241 Ga0070680_100013534
242 Ga0068868_100350294
243 Ga0070660_100002902
244 Ga0070661_100166833
245 Ga0070667_100008761
246 Ga0070714_100257932
247 Ga0070714_100285371
248 Ga0070708_100065158
249 Ga0070707_100057060
250 Ga0070698_100002618
251 Ga0070698_100034655
252 Ga0070699_100140276
253 Ga0070679_100029376
254 Ga0070684_100008337
255 Ga0070684_100143982
256 Ga0070697_100113255
257 Ga0070697_100197114
258 Ga0070696_100037888
259 Ga0068855_100061845
260 Ga0068855_100281699
261 Ga0070664_100166924
262 Ga0068857_100031798
263 Ga0081455_10000934
264 Ga0081455_10020077
265 Ga0081455_10040902
266 Ga0081540_1001698
267 Ga0081539_10002150
268 Ga0075365_10108647
269 Ga0075364_10051881
270 Ga0075432_10080474
271 Ga0070712_100229178
272 Ga0075428_100000925
273 Ga0075428_100167704
274 Ga0075430_100142739
275 Ga0075431_100059054
276 Ga0075434_100045736
277 Ga0075429_100441362
278 Ga0075436_100059873
279 Ga0075435_100118113
280 Ga0111539_10027134
281 Ga0114129_10006452
282 Ga0114129_10049490
283 Ga0114129_10409578
284 Ga0157370_10008874
285 Ga0157370_10130410
286 Ga0157369_10009010
287 Ga0157369_10010102
288 Ga0157369_10030868
289 Ga0157374_10230931
290 Ga0206353_10445973
291 Ga0207699_10111909
292 Ga0207699_10271412
293 Ga0207705_10172626
294 Ga0207705_10183596
295 Ga0207684_10084967
296 Ga0207707_10081088
297 Ga0207693_10001413
298 Ga0207693_10039515
299 Ga0207663_10069230
300 Ga0207662_10061539
301 Ga0207657_10001894
302 Ga0207657_10158225
303 Ga0207649_10085378
304 Ga0207649_10113040
305 Ga0207652_10183813
306 Ga0207646_10101581
307 Ga0207664_10067584
308 Ga0207664_10197588
309 Ga0207664_10247106
310 Ga0207664_10403388
311 Ga0207644_10169752
312 Ga0207690_10287180
313 Ga0207706_10200404
314 Ga0207706_10262653
315 Ga0207665_10014753
316 Ga0207661_10023618
317 Ga0207667_10264610
318 Ga0207658_10010432
319 Ga0207677_10237412
320 Ga0207702_10320664
321 Ga0207674_10004276
322 Ga0207675_100179853
323 Ga0207698_10098965
324 Ga0207428_10019162
325 Ga0265338_10096611
326 Ga0265338_10181855
327 Ga0373930_0026996
328 Ga0373941_0028582
329 Ga0373943_0017492
330 Ga0316574_0205270
331 Ga0373933_0027735
332 Ga0373947_0005587
333 Ga0395899_0016432
334 Ga0395899_0044172
335 Ga0395899_0062106
336 Ga0395899_0070443
337 Ga0395899_0162252
338 Ga0395900_0025686
339 Ga0395900_0026888
340 Ga0395900_0032926
341 Ga0395900_0079327
342 Ga0395900_0133933
343 Ga0395900_0189339
344 Ga0395900_0244124
345 Ga0395900_0249656
346 Ga0395900_0297376
347 Ga0395900_0464312
348 Ga0395900_0531632
349 Ga0395898_0011102
350 Ga0395898_0020170
351 Ga0395898_0030573
352 Ga0395898_0035109
353 Ga0395898_0061077
354 Ga0395898_0099825
355 Ga0395898_0248229
356 Ga0395898_0256891
357 Ga0395905_0026173
358 Ga0395905_0033526
359 Ga0395905_0038450
360 Ga0395905_0047998
361 Ga0395905_0057994
362 Ga0395905_0353857
363 Ga0395905_0376071
364 Ga0395905_0426805
365 Ga0395901_0020977
366 Ga0395901_0024804
367 Ga0395901_0067464
368 Ga0395901_0179384
369 Ga0395901_0374048
370 Ga0395901_0386624
371 Ga0395901_0425745
372 Ga0436360_0150526
373 Ga0439431_0019030
374 Ga0439445_0021490
375 Ga0439446_0000660
376 Ga0466966_0136550
377 Ga0466963_0035397
378 Ga0466964_0006226
379 Ga0466964_0049337
380 Ga0466971_0146839
381 Ga0466957_0119053
382 Ga0466957_0149861
383 Ga0466967_0015239
384 Ga0466967_0076740
385 Ga0466967_0159920
386 Ga0466967_0248504
387 Ga0495592_0082982
388 Ga0495629_0074346
389 Ga0495629_0290507
390 Ga0495641_0079219
391 Ga0495651_0012441
392 Ga0495651_0037938
393 Ga0495651_0174334
394 Ga0495582_0017713
395 Ga0495582_0109531
396 Ga0495608_0004926
397 Ga0495608_0011554
398 Ga0495618_0040707
399 Ga0495618_0076580
400 Ga0495630_0006731
401 Ga0495630_0051565
402 Ga0495665_0056441
403 Ga0495665_0084990
404 Ga0495587_0065270
405 Ga0495667_0007908
406 Ga0495667_0016590
407 Ga0495635_0038426
408 Ga0495657_0029423
409 Ga0495657_0113802
410 Ga0495657_0187648
411 Ga0495647_0007916
412 Ga0495658_0051435
413 Ga0495613_0008261
414 Ga0495589_0017137
415 Ga0495581_0003423
416 Ga0495604_0045431
417 Ga0495674_0009942
418 Ga0495674_0280511
419 Ga0495676_0014251
420 Ga0495676_0077462
421 Ga0495680_0002078
422 Ga0495680_0003625
423 Ga0495684_0007333
424 Ga0495684_0022751
425 Ga0495684_0025294
426 Ga0496101_0054927
427 Ga0496102_0062781
428 Ga0496102_0186402
429 Ga0496103_0096983
430 Ga0496104_0059523
431 Ga0496105_0081654
432 Ga0496107_0039989
433 Ga0496107_0180717
434 Ga0496108_0142092
435 Ga0496108_0248176
436 Ga0496109_0014999
437 Ga0496109_0016139
438 Ga0496110_0055726
439 Ga0496110_0100263
440 Ga0496112_0010011
441 Ga0496113_0174951
442 Ga0496113_0232095
443 Ga0496114_0030751
444 Ga0496114_0117446
445 Ga0496114_0129634
446 Ga0496114_0159928
447 Ga0496115_0003848
448 Ga0496115_0195915
449 Ga0501031_0252554
450 Ga0501067_0101550
451 Ga0501069_0086822
452 Ga0501070_0001263
453 Ga0501070_0046344
454 Ga0501077_0013312
455 Ga0501079_0138249
456 Ga0501279_014284
457 Ga0501035_0500532
458 nmdc:mga05p37_19262_c1
459 nmdc:mga05p37_290433_c1
460 nmdc:mga09592_69944_c1
461 nmdc:mga09592_8900_c1
462 nmdc:mga06r32_103190_c1
463 nmdc:mga06r32_224622_c1
464 nmdc:mga08y16_17696_c1
465 nmdc:mga08y16_36098_c1
466 nmdc:mga0rr50_26370_c1
467 nmdc:mga0rr50_70033_c1
468 nmdc:mga08x19_62789_c1
469 nmdc:mga0a205_230919_c1
470 Ga0495619_0052656
471 Ga0530510_0068436
472 Ga0530510_0144375

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01409

tRNA-synt_2d

tRNA synthetases class II core domain (F)

97

344

0.99

PF02912

Phe_tRNA-synt_N

Aminoacyl tRNA synthetase class II, N-terminal domain

31

93

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4p75-assembly1.cif.gz_C phers in complex with compound 4a 0.904 90 337
4p73-assembly1.cif.gz_C phers in complex with compound 1a 0.8943 89 337
4p75-assembly1.cif.gz_C phers in complex with compound 4a 0.8928 90 337
6p24-assembly1.cif.gz_A escherichia coli trna synthetase 0.889 89 337
4p75-assembly1.cif.gz_D phers in complex with compound 4a 0.8886 87 337
ID Description Score Start End Superfamily
af_Q9VW85_1004_1233_1.20.900.10 Mainly Alpha;Up-down Bundle;Dbl Homology Domain; Chain A;Dbl homology (DH) domain 0.9359 43 87 1.20.900.10
4p73C01 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9326 105 337 3.30.930.10
4p73C01 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9244 105 337 3.30.930.10
af_Q1JPX3_176_497_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8607 95 326 3.30.930.10
2rhsC00 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8523 79 337 3.30.930.10
ID Description Score Start End GO Terms
AF-A0A3D1QB45-F1-model_v4 Phenylalanine--tRNA ligase subunit alpha (EC 6.1.1.20) 0.9762 201 317 GO:0000049
GO:0004826
GO:0005524
GO:0005737
GO:0006432
GO:0016740
AF-X4YKH8-F1-model_v4 Phenylalanyl-tRNA synthase alpha subunit 0.9738 156 300 GO:0000049
GO:0004826
GO:0005524
GO:0005737
GO:0006432
GO:0016740
AF-A0A2M7AQQ6-F1-model_v4 phenylalanine--tRNA ligase (EC 6.1.1.20) 0.9734 108 327 GO:0000049
GO:0004826
GO:0005524
GO:0005737
GO:0006432
AF-G0LP40-F1-model_v4 Phenylalanine tRNA synthetase, alpha subunit 0.9719 154 302 GO:0000049
GO:0004826
GO:0005524
GO:0005737
GO:0006432
GO:0016740
AF-A0A535FE07-F1-model_v4 phenylalanine--tRNA ligase (EC 6.1.1.20) 0.9701 127 261 GO:0000049
GO:0004826
GO:0005524
GO:0005737
GO:0006432

Map