F349277

General Info

Members Datasets Scaffolds Average Seq Length
236 191 472 207

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_1057421|Ga0436365_1057421_341_1033
Length 230
Sequence MSEKPSAGLPKPPPERSARDYFPVRKSLASLERAAKDCRGCDLYANATQTVFGRGPKRARVVLVGEQPGNDEDLAGEPFVGPAGRLLDEALQAAGISRADAYVTNVVKHFKWQADTRKHGDAGAPRGKRRIHAKPNAREIAACSPWLGEELAQLKPVVLVCLGATAAQALFGRSFKLLQNRGRVLPTSLAEHAVATVHPSSVLRAPDPESRAQARRDLIKDLKVVSKLLG

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
5 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
6 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
86 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
128 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
131 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
134 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
135 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
136 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
137 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
139 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
140 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
141 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
142 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
145 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
146 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
147 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
148 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
149 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
150 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
153 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
156 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
157 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
167 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
168 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
169 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
170 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
171 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
172 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
173 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
174 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
175 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
176 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
178 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
179 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
182 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
187 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
188 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
189 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
190 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
191 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.47
Nodule 0
Rhizoplane 1.27
Rhizosphere 89.83
Stem 0
Stem Tuber 0
Unclassified 1.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_1057421 3300039437 Bacteria 1262
2 JGI25151J46595_10001883 3300003187 Bacteria 13370
3 JGI25406J46586_10049256 3300003203 Bacteria 1422
4 Ga0055537_1005079 3300003773 Bacteria 3600
5 Ga0055524_1002274 3300003775 Bacteria 10035
6 Ga0055534_1001183 3300003784 Bacteria 10972
7 Ga0070676_10000324 3300005328 Bacteria 21626
8 Ga0070670_100009462 3300005331 Bacteria 8319
9 Ga0070670_100015452 3300005331 Bacteria 6557
10 Ga0068869_100000126 3300005334 Bacteria 36812
11 Ga0070680_100009910 3300005336 Bacteria 7336
12 Ga0070680_100040236 3300005336 Bacteria 3784
13 Ga0070682_100008110 3300005337 Bacteria 5921
14 Ga0070660_100006037 3300005339 Bacteria 8374
15 Ga0070661_100000815 3300005344 Bacteria 22416
16 Ga0070661_100027509 3300005344 Bacteria 4095
17 Ga0070692_10020083 3300005345 Bacteria 3234
18 Ga0070669_100018640 3300005353 Bacteria 4960
19 Ga0070675_100181295 3300005354 Bacteria 1821
20 Ga0070675_100401357 3300005354 Bacteria 1223
21 Ga0070673_100651507 3300005364 Bacteria 964
22 Ga0070659_100006137 3300005366 Bacteria 8674
23 Ga0070667_100235969 3300005367 Bacteria 1632
24 Ga0070703_10011692 3300005406 Bacteria 2483
25 Ga0070705_100007058 3300005440 Bacteria 5521
26 Ga0070694_100000121 3300005444 Bacteria 38329
27 Ga0070694_100169362 3300005444 Bacteria 1608
28 Ga0070663_100000550 3300005455 Bacteria 19939
29 Ga0070662_100008204 3300005457 Bacteria 6805
30 Ga0070662_100040676 3300005457 Bacteria 3311
31 Ga0070681_10004420 3300005458 Bacteria 13392
32 Ga0070681_10032659 3300005458 Bacteria 5225
33 Ga0068867_100003741 3300005459 Bacteria 10710
34 Ga0070707_100703714 3300005468 Bacteria 973
35 Ga0070679_100016879 3300005530 Bacteria 7057
36 Ga0070679_100884519 3300005530 Bacteria 837
37 Ga0070684_100881172 3300005535 Bacteria 838
38 Ga0068853_100013063 3300005539 Bacteria 6772
39 Ga0070672_100160999 3300005543 Bacteria 1862
40 Ga0070695_100001481 3300005545 Bacteria 13038
41 Ga0070695_100336492 3300005545 Bacteria 1127
42 Ga0070696_100011003 3300005546 Bacteria 6058
43 Ga0070693_100003201 3300005547 Bacteria 7595
44 Ga0070704_100282664 3300005549 Bacteria 1375
45 Ga0068855_100000993 3300005563 Bacteria 35303
46 Ga0070664_100018364 3300005564 Bacteria 5743
47 Ga0070664_100071426 3300005564 Bacteria 2975
48 Ga0068857_100017837 3300005577 Bacteria 6224
49 Ga0068854_100000401 3300005578 Bacteria 27283
50 Ga0068856_100002147 3300005614 Bacteria 20442
51 Ga0068856_100902096 3300005614 Bacteria 903
52 Ga0068859_100142087 3300005617 Bacteria 2474
53 Ga0068864_100045799 3300005618 Bacteria 3752
54 Ga0068861_100005570 3300005719 Bacteria 8533
55 Ga0068861_100598061 3300005719 Bacteria 1012
56 Ga0068870_10000444 3300005840 Bacteria 15684
57 Ga0068863_100121641 3300005841 Bacteria 2489
58 Ga0068858_100037490 3300005842 Bacteria 4496
59 Ga0068862_100006277 3300005844 Bacteria 9892
60 Ga0068862_100023077 3300005844 Bacteria 5210
61 Ga0081455_10002294 3300005937 Bacteria 22790
62 Ga0081539_10002631 3300005985 Bacteria 24551
63 Ga0081539_10075875 3300005985 Bacteria 1783
64 Ga0081539_10118587 3300005985 Bacteria 1318
65 Ga0075365_10348758 3300006038 Bacteria 1043
66 Ga0075368_10012435 3300006042 Bacteria 3112
67 Ga0075364_10462655 3300006051 Bacteria 867
68 Ga0075369_10005507 3300006186 Bacteria 4735
69 Ga0075369_10046117 3300006186 Bacteria 1876
70 Ga0075428_100015815 3300006844 Bacteria 8355
71 Ga0075428_100028116 3300006844 Bacteria 6219
72 Ga0075430_100008104 3300006846 Bacteria 8882
73 Ga0075430_100066222 3300006846 Bacteria 3033
74 Ga0075431_100305207 3300006847 Bacteria 1607
75 Ga0075433_10008584 3300006852 Bacteria 8151
76 Ga0075433_10057361 3300006852 Bacteria 3403
77 Ga0075434_100161056 3300006871 Bacteria 2264
78 Ga0075429_100461355 3300006880 Bacteria 1113
79 Ga0068865_100192700 3300006881 Bacteria 1578
80 Ga0097620_100142083 3300006931 Bacteria 2474
81 Ga0111539_10035318 3300009094 Bacteria 6053
82 Ga0111539_10601328 3300009094 Bacteria 1281
83 Ga0111539_11701636 3300009094 Bacteria 731
84 Ga0105247_10000757 3300009101 Bacteria 24944
85 Ga0114129_10000002 3300009147 Bacteria 204413
86 Ga0114129_10125597 3300009147 Bacteria 3527
87 Ga0105243_10147928 3300009148 Bacteria 2012
88 Ga0105241_10002509 3300009174 Bacteria 13786
89 Ga0105242_11174496 3300009176 Bacteria 785
90 Ga0105248_12031441 3300009177 Bacteria 653
91 Ga0105237_10135595 3300009545 Bacteria 2456
92 Ga0105249_10350043 3300009553 Bacteria 1496
93 Ga0105239_11437371 3300010375 Bacteria 796
94 Ga0157373_10000102 3300013100 Bacteria 67573
95 Ga0157370_10194223 3300013104 Bacteria 1884
96 Ga0157369_10029747 3300013105 Bacteria 6033
97 Ga0163162_11287700 3300013306 Bacteria 830
98 Ga0157372_10004220 3300013307 Bacteria 15374
99 Ga0157375_11361594 3300013308 Bacteria 835
100 Ga0163163_11275817 3300014325 Bacteria 797
101 Ga0157380_10165614 3300014326 Bacteria 1926
102 Ga0157377_10082495 3300014745 Bacteria 1882
103 Ga0157379_10168597 3300014968 Bacteria 1976
104 Ga0209565_1000152 3300025263 Bacteria 92995
105 Ga0209673_1066896 3300025273 Bacteria 872
106 Ga0209675_1002758 3300025291 Bacteria 8771
107 Ga0209025_1000330 3300025294 Bacteria 105197
108 Ga0209564_1000325 3300025295 Bacteria 92995
109 Ga0209256_1001250 3300025299 Bacteria 28006
110 Ga0207653_10003227 3300025885 Bacteria 5153
111 Ga0207688_10043361 3300025901 Bacteria 2505
112 Ga0207645_10000033 3300025907 Bacteria 91108
113 Ga0207643_10000641 3300025908 Bacteria 21901
114 Ga0207643_10004785 3300025908 Bacteria 7253
115 Ga0207707_10000162 3300025912 Bacteria 70164
116 Ga0207707_10015955 3300025912 Bacteria 6551
117 Ga0207660_10003445 3300025917 Bacteria 10324
118 Ga0207660_10334112 3300025917 Bacteria 1212
119 Ga0207657_10001749 3300025919 Bacteria 23427
120 Ga0207649_10000603 3300025920 Bacteria 24348
121 Ga0207649_10174723 3300025920 Bacteria 1499
122 Ga0207652_10002391 3300025921 Bacteria 15843
123 Ga0207681_10104784 3300025923 Bacteria 2047
124 Ga0207650_10000971 3300025925 Bacteria 21566
125 Ga0207650_10007893 3300025925 Bacteria 7251
126 Ga0207659_10274525 3300025926 Bacteria 1376
127 Ga0207644_10400562 3300025931 Bacteria 1122
128 Ga0207690_10041763 3300025932 Bacteria 3007
129 Ga0207706_10003550 3300025933 Bacteria 14887
130 Ga0207706_10008042 3300025933 Bacteria 9734
131 Ga0207670_10092147 3300025936 Bacteria 2144
132 Ga0207691_10123928 3300025940 Bacteria 2287
133 Ga0207689_10000139 3300025942 Bacteria 62281
134 Ga0207679_10007379 3300025945 Bacteria 6969
135 Ga0207640_10003202 3300025981 Bacteria 8815
136 Ga0207658_10093161 3300025986 Bacteria 2342
137 Ga0207703_10023872 3300026035 Bacteria 4809
138 Ga0207639_10008348 3300026041 Bacteria 7098
139 Ga0207678_10000479 3300026067 Bacteria 36311
140 Ga0207708_10320159 3300026075 Bacteria 1265
141 Ga0207702_10006143 3300026078 Bacteria 10398
142 Ga0207702_10993688 3300026078 Bacteria 832
143 Ga0207648_10007148 3300026089 Bacteria 11010
144 Ga0207676_10386377 3300026095 Bacteria 1304
145 Ga0207674_10000976 3300026116 Bacteria 37399
146 Ga0207675_100118521 3300026118 Bacteria 2503
147 Ga0207683_10009113 3300026121 Bacteria 8458
148 Ga0209999_1013247 3300027543 Bacteria 1496
149 Ga0210002_1018989 3300027617 Bacteria 1101
150 Ga0209983_1003217 3300027665 Bacteria 3502
151 Ga0209971_1000184 3300027682 Bacteria 18591
152 Ga0209966_1001396 3300027695 Bacteria 4226
153 Ga0209974_10000104 3300027876 Bacteria 23941
154 Ga0268265_10023098 3300028380 Bacteria 4380
155 Ga0268264_10171895 3300028381 Bacteria 1960
156 Ga0265331_10000387 3300031250 Bacteria 45582
157 Ga0265327_10002071 3300031251 Bacteria 22412
158 Ga0307408_100229689 3300031548 Bacteria 1519
159 Ga0265314_10120692 3300031711 Bacteria 1651
160 Ga0316576_10042608 3300031727 Bacteria 3272
161 Ga0307411_10782971 3300032005 Bacteria 838
162 Ga0316585_10045793 3300032137 Bacteria 1399
163 Ga0373948_0018951 3300034817 Bacteria 1297
164 Ga0373958_0075143 3300034819 Bacteria 756
165 Ga0373951_0031581 3300035091 Bacteria 1250
166 Ga0373923_0226736 3300035111 Bacteria 870
167 Ga0373932_0004866 3300035112 Bacteria 3164
168 Ga0373960_0180997 3300035121 Bacteria 736
169 Ga0373962_0168493 3300035242 Bacteria 726
170 Ga0316584_0000014 3300036712 Bacteria 59260
171 Ga0395899_0361319 3300037312 Bacteria 969
172 Ga0395905_0023843 3300037471 Bacteria 5777
173 Ga0395905_0863430 3300037471 Bacteria 808
174 Ga0436361_0572849 3300039447 Bacteria 2160
175 Ga0439465_0084019 3300041413 Bacteria 1083
176 Ga0439448_0001404 3300042005 Bacteria 6208
177 Ga0439459_0034804 3300042438 Bacteria 1043
178 Ga0439464_0095140 3300042439 Bacteria 901
179 Ga0439460_0048102 3300042461 Bacteria 1272
180 Ga0466963_0373327 3300044694 Bacteria 1005
181 Ga0451576_0021468 3300045051 Bacteria 7017
182 Ga0495624_0095071 3300046690 Bacteria 1837
183 Ga0495636_0136862 3300047318 Unclassified 1092
184 Ga0496102_0011434 3300048905 Bacteria 7653
185 Ga0496110_0402023 3300048913 Bacteria 1249
186 Ga0496111_0220850 3300048914 Unclassified 1408
187 Ga0501032_0237238 3300049569 Bacteria 1185
188 Ga0501036_1380588 3300049572 Bacteria 571
189 Ga0501037_0150461 3300049573 Bacteria 1664
190 Ga0501037_0286522 3300049573 Bacteria 1147
191 Ga0501038_0094484 3300049574 Bacteria 2499
192 Ga0501039_0042010 3300049575 Bacteria 3533
193 Ga0501039_0254359 3300049575 Bacteria 1381
194 Ga0501042_0000046 3300049578 Bacteria 41284
195 Ga0501043_0085137 3300049579 Bacteria 2484
196 Ga0501046_0019867 3300049580 Bacteria 5564
197 Ga0501047_0058702 3300049581 Bacteria 3716
198 Ga0501047_0149254 3300049581 Unclassified 2214
199 Ga0501070_0020339 3300049586 Bacteria 5569
200 Ga0501070_0542753 3300049586 Bacteria 931
201 Ga0501074_0340756 3300049590 Bacteria 1064
202 Ga0501075_0395054 3300049591 Bacteria 1054
203 Ga0501076_0589803 3300049592 Bacteria 917
204 Ga0501077_0108986 3300049593 Bacteria 1754
205 Ga0501249_002371 3300049679 Bacteria 3804
206 Ga0501079_0250815 3300049741 Bacteria 1383
207 Ga0501079_0272341 3300049741 Bacteria 1323
208 Ga0501079_0336169 3300049741 Bacteria 1183
209 Ga0501080_0030637 3300049742 Bacteria 5013
210 Ga0501080_0087182 3300049742 Bacteria 2900
211 Ga0501081_0100339 3300049743 Bacteria 2046
212 Ga0501081_0228449 3300049743 Bacteria 1355
213 Ga0501083_0002120 3300049744 Bacteria 13614
214 Ga0501035_0110933 3300049822 Bacteria 2404
215 Ga0501044_0027791 3300049823 Bacteria 5972
216 nmdc:mga03683_2272_c1 3300050489 Bacteria 5931
217 nmdc:mga0yw44_422630_c1 3300050492 Bacteria 902
218 nmdc:mga0yw44_742481_c1 3300050492 Bacteria 667
219 nmdc:mga05p37_134648_c1 3300050507 Bacteria 3031
220 nmdc:mga05p37_2_c1 3300050507 Bacteria 173421
221 nmdc:mga09592_195159_c1 3300050508 Bacteria 1753
222 nmdc:mga0qj67_18825_c1 3300050509 Bacteria 5266
223 nmdc:mga06r32_119215_c1 3300050510 Bacteria 2602
224 nmdc:mga06r32_16715_c1 3300050510 Bacteria 6688
225 nmdc:mga08y16_182462_c1 3300050511 Bacteria 2179
226 nmdc:mga08y16_596373_c1 3300050511 Bacteria 1114
227 nmdc:mga0n895_316055_c1 3300050512 Bacteria 1583
228 nmdc:mga0n895_490810_c1 3300050512 Bacteria 1238
229 nmdc:mga0n895_788036_c1 3300050512 Bacteria 942
230 nmdc:mga0a205_170315_c1 3300050515 Bacteria 2074
231 nmdc:mga0a205_3800_c1 3300050515 Bacteria 12405
232 Ga0500646_0114974 3300053090 Bacteria 859
233 Ga0500641_0003586 3300053096 Bacteria 5478
234 Ga0501084_0097078 3300054114 Bacteria 2474
235 Ga0501082_0169966 3300060353 Bacteria 1895
236 Ga0530510_0058424 3300061734 Bacteria 2789
237 Ga0436365_1057421
238 JGI25151J46595_10001883
239 JGI25406J46586_10049256
240 Ga0055537_1005079
241 Ga0055524_1002274
242 Ga0055534_1001183
243 Ga0070676_10000324
244 Ga0070670_100009462
245 Ga0070670_100015452
246 Ga0068869_100000126
247 Ga0070680_100009910
248 Ga0070680_100040236
249 Ga0070682_100008110
250 Ga0070660_100006037
251 Ga0070661_100000815
252 Ga0070661_100027509
253 Ga0070692_10020083
254 Ga0070669_100018640
255 Ga0070675_100181295
256 Ga0070675_100401357
257 Ga0070673_100651507
258 Ga0070659_100006137
259 Ga0070667_100235969
260 Ga0070703_10011692
261 Ga0070705_100007058
262 Ga0070694_100000121
263 Ga0070694_100169362
264 Ga0070663_100000550
265 Ga0070662_100008204
266 Ga0070662_100040676
267 Ga0070681_10004420
268 Ga0070681_10032659
269 Ga0068867_100003741
270 Ga0070707_100703714
271 Ga0070679_100016879
272 Ga0070679_100884519
273 Ga0070684_100881172
274 Ga0068853_100013063
275 Ga0070672_100160999
276 Ga0070695_100001481
277 Ga0070695_100336492
278 Ga0070696_100011003
279 Ga0070693_100003201
280 Ga0070704_100282664
281 Ga0068855_100000993
282 Ga0070664_100018364
283 Ga0070664_100071426
284 Ga0068857_100017837
285 Ga0068854_100000401
286 Ga0068856_100002147
287 Ga0068856_100902096
288 Ga0068859_100142087
289 Ga0068864_100045799
290 Ga0068861_100005570
291 Ga0068861_100598061
292 Ga0068870_10000444
293 Ga0068863_100121641
294 Ga0068858_100037490
295 Ga0068862_100006277
296 Ga0068862_100023077
297 Ga0081455_10002294
298 Ga0081539_10002631
299 Ga0081539_10075875
300 Ga0081539_10118587
301 Ga0075365_10348758
302 Ga0075368_10012435
303 Ga0075364_10462655
304 Ga0075369_10005507
305 Ga0075369_10046117
306 Ga0075428_100015815
307 Ga0075428_100028116
308 Ga0075430_100008104
309 Ga0075430_100066222
310 Ga0075431_100305207
311 Ga0075433_10008584
312 Ga0075433_10057361
313 Ga0075434_100161056
314 Ga0075429_100461355
315 Ga0068865_100192700
316 Ga0097620_100142083
317 Ga0111539_10035318
318 Ga0111539_10601328
319 Ga0111539_11701636
320 Ga0105247_10000757
321 Ga0114129_10000002
322 Ga0114129_10125597
323 Ga0105243_10147928
324 Ga0105241_10002509
325 Ga0105242_11174496
326 Ga0105248_12031441
327 Ga0105237_10135595
328 Ga0105249_10350043
329 Ga0105239_11437371
330 Ga0157373_10000102
331 Ga0157370_10194223
332 Ga0157369_10029747
333 Ga0163162_11287700
334 Ga0157372_10004220
335 Ga0157375_11361594
336 Ga0163163_11275817
337 Ga0157380_10165614
338 Ga0157377_10082495
339 Ga0157379_10168597
340 Ga0209565_1000152
341 Ga0209673_1066896
342 Ga0209675_1002758
343 Ga0209025_1000330
344 Ga0209564_1000325
345 Ga0209256_1001250
346 Ga0207653_10003227
347 Ga0207688_10043361
348 Ga0207645_10000033
349 Ga0207643_10000641
350 Ga0207643_10004785
351 Ga0207707_10000162
352 Ga0207707_10015955
353 Ga0207660_10003445
354 Ga0207660_10334112
355 Ga0207657_10001749
356 Ga0207649_10000603
357 Ga0207649_10174723
358 Ga0207652_10002391
359 Ga0207681_10104784
360 Ga0207650_10000971
361 Ga0207650_10007893
362 Ga0207659_10274525
363 Ga0207644_10400562
364 Ga0207690_10041763
365 Ga0207706_10003550
366 Ga0207706_10008042
367 Ga0207670_10092147
368 Ga0207691_10123928
369 Ga0207689_10000139
370 Ga0207679_10007379
371 Ga0207640_10003202
372 Ga0207658_10093161
373 Ga0207703_10023872
374 Ga0207639_10008348
375 Ga0207678_10000479
376 Ga0207708_10320159
377 Ga0207702_10006143
378 Ga0207702_10993688
379 Ga0207648_10007148
380 Ga0207676_10386377
381 Ga0207674_10000976
382 Ga0207675_100118521
383 Ga0207683_10009113
384 Ga0209999_1013247
385 Ga0210002_1018989
386 Ga0209983_1003217
387 Ga0209971_1000184
388 Ga0209966_1001396
389 Ga0209974_10000104
390 Ga0268265_10023098
391 Ga0268264_10171895
392 Ga0265331_10000387
393 Ga0265327_10002071
394 Ga0307408_100229689
395 Ga0265314_10120692
396 Ga0316576_10042608
397 Ga0307411_10782971
398 Ga0316585_10045793
399 Ga0373948_0018951
400 Ga0373958_0075143
401 Ga0373951_0031581
402 Ga0373923_0226736
403 Ga0373932_0004866
404 Ga0373960_0180997
405 Ga0373962_0168493
406 Ga0316584_0000014
407 Ga0395899_0361319
408 Ga0395905_0023843
409 Ga0395905_0863430
410 Ga0436361_0572849
411 Ga0439465_0084019
412 Ga0439448_0001404
413 Ga0439459_0034804
414 Ga0439464_0095140
415 Ga0439460_0048102
416 Ga0466963_0373327
417 Ga0451576_0021468
418 Ga0495624_0095071
419 Ga0495636_0136862
420 Ga0496102_0011434
421 Ga0496110_0402023
422 Ga0496111_0220850
423 Ga0501032_0237238
424 Ga0501036_1380588
425 Ga0501037_0150461
426 Ga0501037_0286522
427 Ga0501038_0094484
428 Ga0501039_0042010
429 Ga0501039_0254359
430 Ga0501042_0000046
431 Ga0501043_0085137
432 Ga0501046_0019867
433 Ga0501047_0058702
434 Ga0501047_0149254
435 Ga0501070_0020339
436 Ga0501070_0542753
437 Ga0501074_0340756
438 Ga0501075_0395054
439 Ga0501076_0589803
440 Ga0501077_0108986
441 Ga0501249_002371
442 Ga0501079_0250815
443 Ga0501079_0272341
444 Ga0501079_0336169
445 Ga0501080_0030637
446 Ga0501080_0087182
447 Ga0501081_0100339
448 Ga0501081_0228449
449 Ga0501083_0002120
450 Ga0501035_0110933
451 Ga0501044_0027791
452 nmdc:mga03683_2272_c1
453 nmdc:mga0yw44_422630_c1
454 nmdc:mga0yw44_742481_c1
455 nmdc:mga05p37_134648_c1
456 nmdc:mga05p37_2_c1
457 nmdc:mga09592_195159_c1
458 nmdc:mga0qj67_18825_c1
459 nmdc:mga06r32_119215_c1
460 nmdc:mga06r32_16715_c1
461 nmdc:mga08y16_182462_c1
462 nmdc:mga08y16_596373_c1
463 nmdc:mga0n895_316055_c1
464 nmdc:mga0n895_490810_c1
465 nmdc:mga0n895_788036_c1
466 nmdc:mga0a205_170315_c1
467 nmdc:mga0a205_3800_c1
468 Ga0500646_0114974
469 Ga0500641_0003586
470 Ga0501084_0097078
471 Ga0501082_0169966
472 Ga0530510_0058424

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03167

UDG

Uracil DNA glycosylase superfamily

52

223

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6iod-assembly2.cif.gz_B the structure of udgx in complex with single-stranded dna 0.971 11 195
6l6s-assembly1.cif.gz_A the structure of the udgx mutant h109e crosslinked to single-stranded dna 0.9586 11 194
8iij-assembly1.cif.gz_A h109g mutant of uracil dna glycosylase x 0.9565 11 194
8iir-assembly1.cif.gz_A msmudgx h109s/q53a double mutant 0.9564 11 195
6ajq-assembly1.cif.gz_A e52q mutant form of uracil dna glycosylase x from mycobacterium smegmatis. 0.9556 11 196
ID Description Score Start End Superfamily
1ui0A00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8756 11 192 3.40.470.10
4zbzA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8374 11 201 3.40.470.10
1ui0A00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8107 11 192 3.40.470.10
4zbzA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8048 11 201 3.40.470.10
2d3yA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.7619 12 198 3.40.470.10
ID Description Score Start End GO Terms
AF-A0A4R2W7K4-F1-model_v4 deleted 0.9973 14 197
AF-A0A1I7Y4H6-F1-model_v4 DNA polymerase 0.9952 14 90 GO:0006281
GO:0046872
GO:0051539
GO:0097506
AF-A0A441WWV6-F1-model_v4 Type-4 uracil-DNA glycosylase 0.9935 11 135 GO:0004844
GO:0006281
GO:0046872
GO:0051539
AF-A0A1I4XWX7-F1-model_v4 Type-4 uracil-DNA glycosylase 0.9932 11 131 GO:0004844
GO:0006281
GO:0046872
GO:0051539
AF-A0A845G2M7-F1-model_v4 Type-4 uracil-DNA glycosylase 0.9921 14 199 GO:0006281
GO:0046872
GO:0051539
GO:0097506

Map