F349238

General Info

Members Datasets Scaffolds Average Seq Length
236 191 472 220

Family's Representative Sequence

Representative Sequence 3300033180|Ga0307510_10021848|Ga0307510_100218485
Length 256
Sequence MPVFARARAPGACIASVCCWDAAEVMRRMRSSGRTVEGMRIVIAGGHGQIALRLERLLAARGEEVAGIIRNAGQSDDLRAAGAEPLVLDLESASVEEVAALLRGADAAVFAAGAGPNSGTTRKDTVDRGSAVLFADAAVLAGVRRHVVVSSMGADPAHRGDGVFDVYLRAKGEADAYVRGLDALDWTILRPGSLTNDAGTGLVRLEAHTGLGSIPRDDVAAVLAELVETPATAGLTLELIGGSAPVSVAVKSVAGN

Samples

Sample ID Description Type Environment
1 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
5 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
6 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
8 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
9 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
10 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
11 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
12 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
13 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
14 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
15 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
16 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
17 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
18 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
19 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
20 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
21 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
22 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
23 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
29 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
30 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
31 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
32 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
33 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
34 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
35 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
36 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
37 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
38 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
39 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
40 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
41 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
42 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
43 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
44 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
45 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
46 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
47 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
48 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
49 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
50 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
51 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
52 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
53 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
54 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
55 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
56 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
57 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
58 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
59 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
60 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
61 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
62 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
63 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
64 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
65 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
66 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
67 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
68 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
69 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
70 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
71 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
72 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
73 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
74 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
75 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
76 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
77 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
78 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
79 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
80 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
81 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
82 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
83 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
84 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
85 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
86 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
87 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
88 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
89 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
90 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
91 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
92 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
93 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
94 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
95 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
96 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
97 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
98 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
99 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
100 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
101 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
102 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
103 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
104 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
105 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
106 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
107 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
115 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
116 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
117 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
118 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
120 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
121 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
122 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
123 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
124 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
125 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
126 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
127 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
128 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
129 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
130 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
131 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
132 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
133 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
134 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
135 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
136 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
137 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
138 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
139 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
140 2582580736 Prauserella sp. Am3 Isolate Unclassified
141 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
142 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
143 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
144 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
145 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
146 2643221647 Streptomyces sp. Root369 Isolate Unclassified
147 2643221670 Streptomyces sp. Root431 Isolate Unclassified
148 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
149 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
150 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
151 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
152 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
153 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
154 2808606448 Streptomyces sp. 193411 Isolate Unclassified
155 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
156 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
157 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
158 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
159 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
160 2867369537 Streptomyces sp. Z26 Isolate Unclassified
161 2867428634 Streptomyces sp. RP5T Isolate Unclassified
162 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
163 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
164 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
165 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
166 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
167 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
168 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
169 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
170 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
171 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
172 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
173 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
174 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
175 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
176 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
177 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
178 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
179 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
180 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
181 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
182 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
183 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
184 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
185 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
186 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
187 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
188 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
189 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
190 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
191 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.12
Metatranscriptomes 0.42
Isolates 22.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.51
Nodule 0.85
Rhizoplane 2.12
Rhizosphere 75.42
Stem 0
Stem Tuber 0
Unclassified 1.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307510_10021848 3300033180 Bacteria 7445
2 rootH1_10008532 3300003323 Bacteria 11130
3 Ga0006562J51391_1125097 3300003578 Bacteria 1483
4 Ga0070665_100457828 3300005548 Bacteria 1286
5 Ga0068854_100844366 3300005578 Bacteria 801
6 Ga0081538_10002282 3300005981 Bacteria 18948
7 Ga0075368_10035618 3300006042 Bacteria 1943
8 Ga0075432_10000063 3300006058 Bacteria 20905
9 Ga0075367_10087918 3300006178 Bacteria 1888
10 Ga0075428_100097298 3300006844 Bacteria 3209
11 Ga0075433_10024785 3300006852 Bacteria 5067
12 Ga0075434_100000170 3300006871 Bacteria 41761
13 Ga0075436_100002492 3300006914 Bacteria 12664
14 Ga0075435_100005889 3300007076 Bacteria 8624
15 Ga0111539_10001964 3300009094 Bacteria 27450
16 Ga0105245_10432434 3300009098 Bacteria 1321
17 Ga0182006_1102456 3300015261 Bacteria 1014
18 Ga0182005_1020265 3300015265 Bacteria 1831
19 Ga0183367_1002 3300015688 Bacteria 1101531
20 Ga0213874_10014392 3300021377 Bacteria 2068
21 Ga0213876_10033192 3300021384 Unclassified 2721
22 Ga0207426_1015744 3300025302 Bacteria 2736
23 Ga0207640_10964478 3300025981 Bacteria 748
24 Ga0207639_10068978 3300026041 Bacteria 2757
25 Ga0207678_10373841 3300026067 Bacteria 1231
26 Ga0207674_10916817 3300026116 Bacteria 844
27 Ga0207683_10296220 3300026121 Bacteria 1480
28 Ga0209371_1023810 3300027312 Bacteria 1436
29 Ga0307513_10071347 3300031456 Bacteria 3625
30 Ga0307509_10069825 3300031507 Bacteria 3670
31 Ga0307508_10082629 3300031616 Bacteria 2794
32 Ga0307514_10028930 3300031649 Bacteria 4463
33 Ga0307516_10012550 3300031730 Bacteria 9120
34 Ga0307516_10070674 3300031730 Bacteria 3354
35 Ga0307518_10059274 3300031838 Bacteria 2779
36 Ga0307410_10273860 3300031852 Bacteria 1321
37 Ga0307411_10155833 3300032005 Bacteria 1704
38 Ga0307507_10052158 3300033179 Bacteria 3925
39 Ga0307510_10065146 3300033180 Bacteria 3693
40 Ga0307510_10221870 3300033180 Bacteria 1401
41 Ga0395898_0014555 3300037466 Bacteria 8080
42 Ga0395898_0232760 3300037466 Bacteria 1757
43 Ga0395901_0439154 3300038443 Bacteria 1336
44 Ga0395901_0471305 3300038443 Bacteria 1282
45 Ga0395901_0485639 3300038443 Unclassified 1259
46 Ga0436365_0062431 3300039437 Bacteria 11801
47 Ga0436363_0501420 3300039450 Bacteria 1510
48 Ga0436363_0515098 3300039450 Bacteria 3090
49 Ga0439436_0006307 3300041404 Bacteria 3642
50 Ga0451793_1640107 3300041452 Bacteria 2003
51 Ga0439457_007810 3300042014 Bacteria 2553
52 Ga0450899_001893 3300042135 Bacteria 2323
53 Ga0450903_001888 3300042138 Bacteria 3801
54 Ga0450903_013987 3300042138 Bacteria 1273
55 Ga0450906_003689 3300042145 Bacteria 3260
56 Ga0439458_0010577 3300042157 Bacteria 2058
57 Ga0439458_0032755 3300042157 Bacteria 1243
58 Ga0466969_0084567 3300044656 Bacteria 1510
59 Ga0466972_0025787 3300044658 Bacteria 2912
60 Ga0466965_0000298 3300044683 Bacteria 16420
61 Ga0466966_0010844 3300044684 Bacteria 6055
62 Ga0466961_0062394 3300044693 Bacteria 2368
63 Ga0466961_0093161 3300044693 Bacteria 1901
64 Ga0466963_0000957 3300044694 Bacteria 14814
65 Ga0466963_0002114 3300044694 Bacteria 10986
66 Ga0466963_0629113 3300044694 Bacteria 758
67 Ga0466964_0082242 3300044706 Bacteria 1384
68 Ga0466964_0364578 3300044706 Bacteria 746
69 Ga0466971_0003648 3300044719 Bacteria 6583
70 Ga0466971_0035634 3300044719 Bacteria 2232
71 Ga0466970_0007190 3300044765 Bacteria 5574
72 Ga0466970_0021653 3300044765 Bacteria 3350
73 Ga0466970_0212230 3300044765 Bacteria 1079
74 Ga0466957_0001094 3300044842 Bacteria 14003
75 Ga0466957_0073419 3300044842 Bacteria 2120
76 Ga0466960_0072188 3300044901 Bacteria 1720
77 Ga0466959_0001376 3300045049 Bacteria 14845
78 Ga0466959_0010681 3300045049 Bacteria 6574
79 Ga0466958_0001494 3300045836 Bacteria 11170
80 Ga0466958_0032359 3300045836 Bacteria 3111
81 Ga0466967_0001313 3300045976 Bacteria 14204
82 Ga0466967_0126539 3300045976 Bacteria 2367
83 Ga0495592_0136731 3300046454 Bacteria 1708
84 Ga0495603_0017936 3300046455 Bacteria 4283
85 Ga0495629_0008159 3300046459 Bacteria 7702
86 Ga0495629_0022915 3300046459 Bacteria 4450
87 Ga0495629_0035256 3300046459 Bacteria 3535
88 Ga0495629_0062728 3300046459 Bacteria 2595
89 Ga0495651_0001402 3300046462 Bacteria 18685
90 Ga0495582_0049013 3300046473 Bacteria 2326
91 Ga0495582_0115236 3300046473 Bacteria 1511
92 Ga0495662_0000039 3300046476 Bacteria 43770
93 Ga0495664_0001560 3300046477 Bacteria 12137
94 Ga0495594_0000149 3300046499 Bacteria 33577
95 Ga0495594_0019813 3300046499 Bacteria 3578
96 Ga0495606_0038028 3300046507 Bacteria 3259
97 Ga0495618_0015399 3300046514 Bacteria 4667
98 Ga0495628_0080320 3300046516 Bacteria 2535
99 Ga0495630_0102884 3300046517 Bacteria 2161
100 Ga0495631_0016424 3300046518 Bacteria 3528
101 Ga0495652_0023121 3300046529 Bacteria 5511
102 Ga0495587_0021218 3300046536 Bacteria 4005
103 Ga0495609_0089106 3300046538 Bacteria 1342
104 Ga0495645_0021671 3300046543 Bacteria 4645
105 Ga0495622_0001968 3300046557 Bacteria 10071
106 Ga0495622_0040628 3300046557 Bacteria 2164
107 Ga0495656_0105660 3300046615 Bacteria 1309
108 Ga0495634_0001063 3300046642 Bacteria 25743
109 Ga0495635_0004318 3300046663 Bacteria 9841
110 Ga0495588_0121544 3300046674 Bacteria 1376
111 Ga0495657_0001831 3300046675 Bacteria 18169
112 Ga0495623_0092084 3300046679 Bacteria 1859
113 Ga0495646_0000605 3300046680 Bacteria 19528
114 Ga0495658_0095689 3300046683 Bacteria 1765
115 Ga0495613_0005563 3300046689 Bacteria 9461
116 Ga0495613_0011250 3300046689 Bacteria 6649
117 Ga0495649_0053225 3300046694 Bacteria 2191
118 Ga0495649_0204572 3300046694 Bacteria 1024
119 Ga0495600_0015114 3300046809 Bacteria 4875
120 Ga0495604_0000692 3300047317 Bacteria 28601
121 Ga0495636_0001936 3300047318 Bacteria 7928
122 Ga0495636_0029026 3300047318 Bacteria 2257
123 Ga0495636_0035644 3300047318 Bacteria 2050
124 Ga0495676_0048959 3300047321 Bacteria 3402
125 Ga0495676_0050894 3300047321 Bacteria 3318
126 Ga0495676_0107676 3300047321 Bacteria 2051
127 Ga0495687_002749 3300047443 Bacteria 13636
128 Ga0495675_0136095 3300047444 Bacteria 1525
129 Ga0495685_014528 3300047447 Bacteria 2676
130 Ga0495684_0072567 3300047471 Bacteria 2615
131 Ga0495686_0042865 3300047472 Bacteria 2874
132 Ga0495593_0009210 3300047673 Bacteria 5725
133 Ga0495593_0332473 3300047673 Bacteria 759
134 Ga0495602_0048196 3300048088 Bacteria 3833
135 Ga0495614_0000308 3300048089 Bacteria 19362
136 Ga0495614_0006161 3300048089 Bacteria 5390
137 Ga0496110_0197342 3300048913 Bacteria 1828
138 Ga0496113_0131859 3300048916 Bacteria 1962
139 Ga0496114_0021223 3300048917 Bacteria 5282
140 Ga0495682_0188204 3300049460 Bacteria 733
141 Ga0501033_0066832 3300049570 Bacteria 2643
142 Ga0501033_0081918 3300049570 Bacteria 2366
143 Ga0501034_0039936 3300049571 Bacteria 4752
144 Ga0501034_0099297 3300049571 Bacteria 2906
145 Ga0501034_0641408 3300049571 Bacteria 964
146 Ga0501036_0026218 3300049572 Bacteria 4919
147 Ga0501036_0213151 3300049572 Bacteria 1622
148 Ga0501038_0001983 3300049574 Bacteria 18921
149 Ga0501038_0269639 3300049574 Bacteria 1342
150 Ga0501039_0193012 3300049575 Bacteria 1601
151 Ga0501043_0037661 3300049579 Bacteria 3803
152 Ga0501047_0119638 3300049581 Bacteria 2516
153 Ga0501067_0310043 3300049583 Bacteria 879
154 Ga0501068_0031279 3300049584 Bacteria 3161
155 Ga0501070_0122894 3300049586 Bacteria 2145
156 Ga0501070_0284900 3300049586 Bacteria 1348
157 Ga0501074_0001056 3300049590 Bacteria 17988
158 Ga0501035_0021944 3300049822 Bacteria 5865
159 Ga0501035_0380493 3300049822 Bacteria 1177
160 Ga0501044_0028946 3300049823 Bacteria 5843
161 Ga0501044_0128343 3300049823 Bacteria 2531
162 Ga0501044_0254475 3300049823 Bacteria 1696
163 nmdc:mga06z11_37708_c1 3300050494 Bacteria 2395
164 nmdc:mga04h51_59804_c1 3300050495 Bacteria 1303
165 nmdc:mga08y16_3061_c1 3300050511 Bacteria 17289
166 nmdc:mga0n895_97299_c1 3300050512 Bacteria 2949
167 nmdc:mga0rr50_1035_c1 3300050513 Bacteria 15062
168 nmdc:mga08x19_4133_c1 3300050514 Bacteria 8609
169 nmdc:mga0a205_2944_c1 3300050515 Bacteria 15088
170 Ga0495612_0043836 3300053078 Bacteria 1829
171 Ga0495655_0033241 3300053083 Bacteria 1268
172 Ga0495619_0171044 3300053085 Bacteria 1502
173 Ga0500583_0261183 3300053092 Bacteria 853
174 Ga0500640_015260 3300053095 Bacteria 3211
175 Ga0500650_0066741 3300053098 Bacteria 1681
176 Ga0500660_094618 3300053100 Bacteria 1323
177 Ga0500573_0110290 3300053140 Bacteria 1540
178 Ga0500600_0102944 3300053149 Bacteria 1503
179 Ga0500624_004944 3300053157 Bacteria 1763
180 Ga0500634_0149932 3300053161 Bacteria 1092
181 Ga0466962_0004114 3300061719 Bacteria 6966
182 Ga0466962_0050015 3300061719 Bacteria 1998
183 Ga0466962_0126116 3300061719 Unclassified 1236
184 2547409993 2547132111 Bacteria 8013147
185 2583152540 2582580736 Bacteria 5325865
186 2585308130 2582581313 Bacteria 10042643
187 2585319557 2582581314 Bacteria 11452267
188 2616696836 2616644814 Bacteria 11555299
189 2616901971 2616644941 Bacteria 8510691
190 2643942029 2643221587 Bacteria 7586415
191 2644261633 2643221647 Bacteria 10741251
192 2644389677 2643221670 Bacteria 6497041
193 2644429112 2643221677 Bacteria 7584031
194 2784589678 2784132148 Bacteria 8627943
195 2785370739 2784746768 Bacteria 10036182
196 2786671920 2786546132 Bacteria 10419719
197 2793976301 2791355406 Bacteria 11364898
198 2808843284 2808606359 Bacteria 9866990
199 2809233352 2808606448 Bacteria 8656184
200 2811845132 2808606982 Bacteria 7791042
201 2819695263 2818991463 Bacteria 7948711
202 2862286813 2862281513 Bacteria 9621493
203 2862387391 2862382967 Bacteria 10317375
204 2863411605 2863404153 Bacteria 9672205
205 2867373184 2867369537 Bacteria 6501581
206 2867432971 2867428634 Bacteria 9590268
207 2873154734 2873151551 Bacteria 8625867
208 2877679850 2877676314 Bacteria 9512378
209 2897563873 2897561785 Bacteria 3256946
210 2912718493 2912715099 Bacteria 9460473
211 2912730825 2912723979 Bacteria 8557534
212 2912762078 2912757875 Bacteria 7940295
213 2918505774 2918501144 Bacteria 8668083
214 2947227819 2947224130 Bacteria 9938529
215 2954003078 2954002825 Bacteria 9173742
216 2954384771 2954380949 Bacteria 10050426
217 2954678192 2954673503 Bacteria 9685905
218 2954685965 2954682443 Bacteria 9862841
219 2954695614 2954691527 Bacteria 10720516
220 2954715042 2954711539 Bacteria 10867210
221 2954724984 2954721474 Bacteria 10456478
222 2954736834 2954731030 Bacteria 10243860
223 2954743917 2954740390 Bacteria 10229294
224 2954755682 2954749733 Bacteria 10366972
225 2954762858 2954759201 Bacteria 9358192
226 3006396435 3006393351 Bacteria 6615579
227 3006494687 3006493962 Bacteria 8825450
228 8008566516 8008558824 Bacteria 10610750
229 8008577843 8008574985 Bacteria 7815457
230 8023629378 8023623736 Bacteria 8593882
231 8025532373 8025530807 Bacteria 8495698
232 8047897010 8047893842 Bacteria 11723082
233 8048361942 8048356638 Bacteria 11044339
234 8048373995 8048369669 Bacteria 11666822
235 8048384232 8048379754 Bacteria 11877923
236 8056837658 8056829672 Bacteria 9045328
237 Ga0307510_10021848
238 rootH1_10008532
239 Ga0006562J51391_1125097
240 Ga0070665_100457828
241 Ga0068854_100844366
242 Ga0081538_10002282
243 Ga0075368_10035618
244 Ga0075432_10000063
245 Ga0075367_10087918
246 Ga0075428_100097298
247 Ga0075433_10024785
248 Ga0075434_100000170
249 Ga0075436_100002492
250 Ga0075435_100005889
251 Ga0111539_10001964
252 Ga0105245_10432434
253 Ga0182006_1102456
254 Ga0182005_1020265
255 Ga0183367_1002
256 Ga0213874_10014392
257 Ga0213876_10033192
258 Ga0207426_1015744
259 Ga0207640_10964478
260 Ga0207639_10068978
261 Ga0207678_10373841
262 Ga0207674_10916817
263 Ga0207683_10296220
264 Ga0209371_1023810
265 Ga0307513_10071347
266 Ga0307509_10069825
267 Ga0307508_10082629
268 Ga0307514_10028930
269 Ga0307516_10012550
270 Ga0307516_10070674
271 Ga0307518_10059274
272 Ga0307410_10273860
273 Ga0307411_10155833
274 Ga0307507_10052158
275 Ga0307510_10065146
276 Ga0307510_10221870
277 Ga0395898_0014555
278 Ga0395898_0232760
279 Ga0395901_0439154
280 Ga0395901_0471305
281 Ga0395901_0485639
282 Ga0436365_0062431
283 Ga0436363_0501420
284 Ga0436363_0515098
285 Ga0439436_0006307
286 Ga0451793_1640107
287 Ga0439457_007810
288 Ga0450899_001893
289 Ga0450903_001888
290 Ga0450903_013987
291 Ga0450906_003689
292 Ga0439458_0010577
293 Ga0439458_0032755
294 Ga0466969_0084567
295 Ga0466972_0025787
296 Ga0466965_0000298
297 Ga0466966_0010844
298 Ga0466961_0062394
299 Ga0466961_0093161
300 Ga0466963_0000957
301 Ga0466963_0002114
302 Ga0466963_0629113
303 Ga0466964_0082242
304 Ga0466964_0364578
305 Ga0466971_0003648
306 Ga0466971_0035634
307 Ga0466970_0007190
308 Ga0466970_0021653
309 Ga0466970_0212230
310 Ga0466957_0001094
311 Ga0466957_0073419
312 Ga0466960_0072188
313 Ga0466959_0001376
314 Ga0466959_0010681
315 Ga0466958_0001494
316 Ga0466958_0032359
317 Ga0466967_0001313
318 Ga0466967_0126539
319 Ga0495592_0136731
320 Ga0495603_0017936
321 Ga0495629_0008159
322 Ga0495629_0022915
323 Ga0495629_0035256
324 Ga0495629_0062728
325 Ga0495651_0001402
326 Ga0495582_0049013
327 Ga0495582_0115236
328 Ga0495662_0000039
329 Ga0495664_0001560
330 Ga0495594_0000149
331 Ga0495594_0019813
332 Ga0495606_0038028
333 Ga0495618_0015399
334 Ga0495628_0080320
335 Ga0495630_0102884
336 Ga0495631_0016424
337 Ga0495652_0023121
338 Ga0495587_0021218
339 Ga0495609_0089106
340 Ga0495645_0021671
341 Ga0495622_0001968
342 Ga0495622_0040628
343 Ga0495656_0105660
344 Ga0495634_0001063
345 Ga0495635_0004318
346 Ga0495588_0121544
347 Ga0495657_0001831
348 Ga0495623_0092084
349 Ga0495646_0000605
350 Ga0495658_0095689
351 Ga0495613_0005563
352 Ga0495613_0011250
353 Ga0495649_0053225
354 Ga0495649_0204572
355 Ga0495600_0015114
356 Ga0495604_0000692
357 Ga0495636_0001936
358 Ga0495636_0029026
359 Ga0495636_0035644
360 Ga0495676_0048959
361 Ga0495676_0050894
362 Ga0495676_0107676
363 Ga0495687_002749
364 Ga0495675_0136095
365 Ga0495685_014528
366 Ga0495684_0072567
367 Ga0495686_0042865
368 Ga0495593_0009210
369 Ga0495593_0332473
370 Ga0495602_0048196
371 Ga0495614_0000308
372 Ga0495614_0006161
373 Ga0496110_0197342
374 Ga0496113_0131859
375 Ga0496114_0021223
376 Ga0495682_0188204
377 Ga0501033_0066832
378 Ga0501033_0081918
379 Ga0501034_0039936
380 Ga0501034_0099297
381 Ga0501034_0641408
382 Ga0501036_0026218
383 Ga0501036_0213151
384 Ga0501038_0001983
385 Ga0501038_0269639
386 Ga0501039_0193012
387 Ga0501043_0037661
388 Ga0501047_0119638
389 Ga0501067_0310043
390 Ga0501068_0031279
391 Ga0501070_0122894
392 Ga0501070_0284900
393 Ga0501074_0001056
394 Ga0501035_0021944
395 Ga0501035_0380493
396 Ga0501044_0028946
397 Ga0501044_0128343
398 Ga0501044_0254475
399 nmdc:mga06z11_37708_c1
400 nmdc:mga04h51_59804_c1
401 nmdc:mga08y16_3061_c1
402 nmdc:mga0n895_97299_c1
403 nmdc:mga0rr50_1035_c1
404 nmdc:mga08x19_4133_c1
405 nmdc:mga0a205_2944_c1
406 Ga0495612_0043836
407 Ga0495655_0033241
408 Ga0495619_0171044
409 Ga0500583_0261183
410 Ga0500640_015260
411 Ga0500650_0066741
412 Ga0500660_094618
413 Ga0500573_0110290
414 Ga0500600_0102944
415 Ga0500624_004944
416 Ga0500634_0149932
417 Ga0466962_0004114
418 Ga0466962_0050015
419 Ga0466962_0126116
420 2547409993
421 2583152540
422 2585308130
423 2585319557
424 2616696836
425 2616901971
426 2643942029
427 2644261633
428 2644389677
429 2644429112
430 2784589678
431 2785370739
432 2786671920
433 2793976301
434 2808843284
435 2809233352
436 2811845132
437 2819695263
438 2862286813
439 2862387391
440 2863411605
441 2867373184
442 2867432971
443 2873154734
444 2877679850
445 2897563873
446 2912718493
447 2912730825
448 2912762078
449 2918505774
450 2947227819
451 2954003078
452 2954384771
453 2954678192
454 2954685965
455 2954695614
456 2954715042
457 2954724984
458 2954736834
459 2954743917
460 2954755682
461 2954762858
462 3006396435
463 3006494687
464 8008566516
465 8008577843
466 8023629378
467 8025532373
468 8047897010
469 8048361942
470 8048373995
471 8048384232
472 8056837658

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13460

NAD_binding_10

NAD(P)H-binding

45

230

0.86

PF05368

NmrA

NmrA-like family

41

210

0.8

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

41

195

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e8x-assembly1.cif.gz_A-2 putative nad-dependent epimerase/dehydratase from bacillus halodurans. 0.9343 1 214
3e8x-assembly1.cif.gz_A-2 putative nad-dependent epimerase/dehydratase from bacillus halodurans. 0.9216 1 214
3dqp-assembly1.cif.gz_A-2 crystal structure of the oxidoreductase ylbe from lactococcus lactis, northeast structural genomics consortium target kr121. 0.89 1 218
6rfq-assembly1.cif.gz_E cryo-em structure of a respiratory complex i assembly intermediate with ndufaf2 0.8791 2 200
3dqp-assembly1.cif.gz_A-2 crystal structure of the oxidoreductase ylbe from lactococcus lactis, northeast structural genomics consortium target kr121. 0.8704 1 218
ID Description Score Start End Superfamily
af_Q9Y7K0_5_242_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9353 5 217 3.40.50.720
3e8xA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9321 1 214 3.40.50.720
af_Q869N3_132_238_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9239 2 40 3.90.180.10
3e8xA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9235 1 214 3.40.50.720
af_Q2FWB1_2_220_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9185 3 217 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6G3D7L4-F1-model_v4 NAD(P)H-binding protein 1.003 1 157
AF-A0A6B3H048-F1-model_v4 NAD(P)H-binding protein 1 69 154
AF-A0A542UDN0-F1-model_v4 Putative NAD(P)-binding protein 0.9998 1 218
AF-A0A2N3W036-F1-model_v4 Putative NAD(P)-binding protein 0.9994 1 218
AF-A0A1Q5JFQ8-F1-model_v4 NAD-dependent dehydratase 0.9992 1 218

Map