F349202

General Info

Members Datasets Scaffolds Average Seq Length
236 149 236 183

Family's Representative Sequence

Representative Sequence 3300031250|Ga0265331_10176106|Ga0265331_101761062
Length 190
Sequence MKLAPLAAAFLLALLAACGRQDSAFHATDVTGALPALDFALTRAGDGREVHAADYRGKVAILYFGYTHCPDICPTTLANLAEMLGKLGTRAGDVRVLFVTVDPTRDTPATMKGYVQSFAPQIDGLRGTPDQLITLTRRYRVAFSVTPGPPYEVMHSNAVFFFDATGRARLVSTDVGKPDDVAADVKRLME

Samples

Sample ID Description Type Environment
1 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
61 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
101 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
102 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
103 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
104 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
107 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
108 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
109 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
113 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
114 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
115 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
116 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
117 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
118 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
131 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
132 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
133 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
134 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
135 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
136 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
137 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
138 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
139 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
140 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
143 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
144 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
145 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
146 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
147 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
148 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
149 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.24
Nodule 0
Rhizoplane 0
Rhizosphere 94.49
Stem 0
Stem Tuber 0
Unclassified 1.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000003 3300003214 Bacteria 694080
2 Ga0070658_10004431 3300005327 Bacteria 11438
3 Ga0070676_10012222 3300005328 Bacteria 4683
4 Ga0070683_100219770 3300005329 Bacteria 1806
5 Ga0070670_100394492 3300005331 Bacteria 1221
6 Ga0068869_100142507 3300005334 Bacteria 1852
7 Ga0070666_10314275 3300005335 Bacteria 1117
8 Ga0070666_10459649 3300005335 Bacteria 920
9 Ga0068868_100064931 3300005338 Bacteria 2899
10 Ga0068868_100394502 3300005338 Bacteria 1193
11 Ga0070660_100015204 3300005339 Bacteria 5552
12 Ga0070660_100345816 3300005339 Bacteria 1224
13 Ga0070675_100229631 3300005354 Bacteria 1618
14 Ga0070674_100254265 3300005356 Bacteria 1381
15 Ga0070673_100580197 3300005364 Bacteria 1021
16 Ga0070673_100746227 3300005364 Bacteria 901
17 Ga0070659_100053933 3300005366 Bacteria 3165
18 Ga0070701_10618645 3300005438 Bacteria 719
19 Ga0070663_100354421 3300005455 Bacteria 1189
20 Ga0070678_100136658 3300005456 Bacteria 1956
21 Ga0070678_100428938 3300005456 Bacteria 1154
22 Ga0070678_100573244 3300005456 Bacteria 1005
23 Ga0070662_100705695 3300005457 Bacteria 854
24 Ga0070681_10051757 3300005458 Bacteria 4096
25 Ga0070681_10447371 3300005458 Bacteria 1204
26 Ga0068867_100127655 3300005459 Bacteria 1972
27 Ga0070679_100004972 3300005530 Bacteria 12269
28 Ga0070684_100188554 3300005535 Bacteria 1876
29 Ga0068853_100376174 3300005539 Bacteria 1326
30 Ga0070693_100377386 3300005547 Bacteria 977
31 Ga0070665_100000162 3300005548 Bacteria 122048
32 Ga0070665_100033932 3300005548 Bacteria 5133
33 Ga0070665_101487882 3300005548 Bacteria 686
34 Ga0068855_100483358 3300005563 Bacteria 1348
35 Ga0068855_101482045 3300005563 Bacteria 697
36 Ga0070664_100488501 3300005564 Bacteria 1134
37 Ga0070702_100284730 3300005615 Bacteria 1136
38 Ga0068852_100104053 3300005616 Bacteria 2569
39 Ga0068864_100925049 3300005618 Bacteria 862
40 Ga0068870_10306268 3300005840 Bacteria 1004
41 Ga0068863_100091459 3300005841 Bacteria 2885
42 Ga0068858_100044603 3300005842 Bacteria 4109
43 Ga0068860_101010793 3300005843 Bacteria 850
44 Ga0097621_100011961 3300006237 Bacteria 6420
45 Ga0097621_100262643 3300006237 Bacteria 1515
46 Ga0097621_100814665 3300006237 Bacteria 866
47 Ga0068871_100001662 3300006358 Bacteria 14953
48 Ga0068871_100138300 3300006358 Bacteria 2070
49 Ga0068865_100029082 3300006881 Bacteria 3662
50 Ga0068865_100138236 3300006881 Bacteria 1834
51 Ga0068865_100199466 3300006881 Bacteria 1553
52 Ga0105240_10075407 3300009093 Bacteria 4160
53 Ga0105240_10167660 3300009093 Bacteria 2603
54 Ga0105240_10568564 3300009093 Bacteria 1252
55 Ga0105240_10669519 3300009093 Bacteria 1136
56 Ga0105240_11012385 3300009093 Bacteria 888
57 Ga0105245_10145282 3300009098 Bacteria 2237
58 Ga0105245_10858378 3300009098 Bacteria 948
59 Ga0105247_10173286 3300009101 Bacteria 1436
60 Ga0105243_10010434 3300009148 Bacteria 7054
61 Ga0105243_10724649 3300009148 Bacteria 972
62 Ga0105241_10110779 3300009174 Bacteria 2196
63 Ga0105241_10154513 3300009174 Bacteria 1880
64 Ga0105241_10557691 3300009174 Bacteria 1029
65 Ga0105248_10084400 3300009177 Bacteria 3573
66 Ga0105237_10393580 3300009545 Bacteria 1390
67 Ga0105237_11834749 3300009545 Bacteria 614
68 Ga0105238_10140902 3300009551 Bacteria 2388
69 Ga0105238_10395375 3300009551 Bacteria 1375
70 Ga0105238_10550915 3300009551 Bacteria 1158
71 Ga0105239_10200287 3300010375 Bacteria 2237
72 Ga0105239_10213620 3300010375 Bacteria 2162
73 Ga0105246_10034489 3300011119 Bacteria 3373
74 Ga0105246_11277164 3300011119 Bacteria 679
75 Ga0157373_10158704 3300013100 Bacteria 1591
76 Ga0157370_10059085 3300013104 Bacteria 3644
77 Ga0157370_10117814 3300013104 Bacteria 2481
78 Ga0157370_11267684 3300013104 Bacteria 664
79 Ga0157369_10579333 3300013105 Bacteria 1159
80 Ga0157374_10199312 3300013296 Bacteria 1960
81 Ga0157374_10765790 3300013296 Bacteria 980
82 Ga0163162_10370634 3300013306 Bacteria 1565
83 Ga0163162_12117105 3300013306 Bacteria 645
84 Ga0157372_10245426 3300013307 Bacteria 2078
85 Ga0157375_10105116 3300013308 Bacteria 2913
86 Ga0163163_10000002 3300014325 Bacteria 609846
87 Ga0163163_10354783 3300014325 Bacteria 1523
88 Ga0157380_10335800 3300014326 Bacteria 1407
89 Ga0157377_10088504 3300014745 Bacteria 1824
90 Ga0157379_10371896 3300014968 Bacteria 1310
91 Ga0157376_10440932 3300014969 Bacteria 1268
92 Ga0163161_10136012 3300017792 Bacteria 1858
93 Ga0209233_1000015 3300025261 Bacteria 980563
94 Ga0209233_1004939 3300025261 Bacteria 4485
95 Ga0209233_1040334 3300025261 Bacteria 1017
96 Ga0207656_10092190 3300025321 Bacteria 1377
97 Ga0207688_10053920 3300025901 Bacteria 2255
98 Ga0207680_10193347 3300025903 Bacteria 1382
99 Ga0207680_10278973 3300025903 Bacteria 1161
100 Ga0207699_10843372 3300025906 Bacteria 675
101 Ga0207645_10055976 3300025907 Bacteria 2518
102 Ga0207643_10054876 3300025908 Bacteria 2265
103 Ga0207705_10005301 3300025909 Bacteria 9647
104 Ga0207705_10672944 3300025909 Bacteria 805
105 Ga0207654_10109448 3300025911 Bacteria 1716
106 Ga0207654_10141739 3300025911 Bacteria 1534
107 Ga0207654_10408872 3300025911 Bacteria 945
108 Ga0207707_10072413 3300025912 Bacteria 3004
109 Ga0207707_10347382 3300025912 Bacteria 1278
110 Ga0207695_10050766 3300025913 Bacteria 4360
111 Ga0207695_10134711 3300025913 Bacteria 2424
112 Ga0207695_10255787 3300025913 Bacteria 1650
113 Ga0207695_10529944 3300025913 Bacteria 1059
114 Ga0207695_10564677 3300025913 Bacteria 1019
115 Ga0207657_10076300 3300025919 Bacteria 2828
116 Ga0207657_10323006 3300025919 Bacteria 1220
117 Ga0207657_10768940 3300025919 Bacteria 746
118 Ga0207652_10005256 3300025921 Bacteria 10515
119 Ga0207652_10125112 3300025921 Bacteria 2290
120 Ga0207694_10042879 3300025924 Bacteria 3491
121 Ga0207694_10081933 3300025924 Bacteria 2536
122 Ga0207694_10619632 3300025924 Bacteria 910
123 Ga0207694_10910344 3300025924 Bacteria 744
124 Ga0207650_10404834 3300025925 Bacteria 1130
125 Ga0207659_10377531 3300025926 Bacteria 1181
126 Ga0207687_10077891 3300025927 Bacteria 2385
127 Ga0207690_10014675 3300025932 Bacteria 4736
128 Ga0207706_10497561 3300025933 Bacteria 1052
129 Ga0207686_10366664 3300025934 Bacteria 1089
130 Ga0207709_10456907 3300025935 Bacteria 988
131 Ga0207669_10158605 3300025937 Bacteria 1595
132 Ga0207704_10138399 3300025938 Bacteria 1699
133 Ga0207711_10030760 3300025941 Bacteria 4529
134 Ga0207689_10172231 3300025942 Bacteria 1785
135 Ga0207689_10232141 3300025942 Bacteria 1525
136 Ga0207661_10964731 3300025944 Bacteria 785
137 Ga0207679_10565377 3300025945 Bacteria 1022
138 Ga0207667_10207530 3300025949 Bacteria 2008
139 Ga0207667_10341865 3300025949 Bacteria 1527
140 Ga0207651_10622617 3300025960 Bacteria 945
141 Ga0207712_10057231 3300025961 Bacteria 2750
142 Ga0207640_11203012 3300025981 Bacteria 674
143 Ga0207703_10153529 3300026035 Bacteria 2010
144 Ga0207703_10432945 3300026035 Bacteria 1226
145 Ga0207639_10184098 3300026041 Bacteria 1779
146 Ga0207678_10144550 3300026067 Bacteria 2030
147 Ga0207702_10017827 3300026078 Bacteria 5878
148 Ga0207641_10182295 3300026088 Bacteria 1924
149 Ga0207648_10050182 3300026089 Bacteria 3649
150 Ga0207674_10716714 3300026116 Bacteria 966
151 Ga0207683_10139139 3300026121 Bacteria 2187
152 Ga0207683_10576766 3300026121 Bacteria 1040
153 Ga0268266_10000969 3300028379 Bacteria 36492
154 Ga0268266_10116957 3300028379 Bacteria 2369
155 Ga0268266_10124817 3300028379 Bacteria 2295
156 Ga0268266_10658827 3300028379 Bacteria 1008
157 Ga0265338_10010269 3300028800 Bacteria 11019
158 Ga0265338_10050230 3300028800 Bacteria 3772
159 Ga0265325_10001990 3300031241 Bacteria 14065
160 Ga0265339_10023137 3300031249 Bacteria 3594
161 Ga0265331_10068207 3300031250 Bacteria 1668
162 Ga0265331_10070671 3300031250 Bacteria 1634
163 Ga0265331_10176106 3300031250 Bacteria 967
164 Ga0265313_10017186 3300031595 Bacteria 4122
165 Ga0265314_10025287 3300031711 Bacteria 4484
166 Ga0265314_10055617 3300031711 Bacteria 2730
167 Ga0265342_10080212 3300031712 Bacteria 1886
168 Ga0307516_10037319 3300031730 Bacteria 4859
169 Ga0307516_10053001 3300031730 Bacteria 3969
170 Ga0373928_0036701 3300035084 Bacteria 1109
171 Ga0373941_0190645 3300035115 Bacteria 774
172 Ga0395898_0158587 3300037466 Bacteria 2164
173 Ga0395901_0071452 3300038443 Bacteria 3617
174 Ga0466967_0336062 3300045976 Bacteria 1460
175 Ga0495592_0563716 3300046454 Bacteria 699
176 Ga0495650_0075017 3300046471 Bacteria 1317
177 Ga0495625_0233296 3300046660 Bacteria 1201
178 Ga0495646_0100856 3300046680 Bacteria 1656
179 Ga0496121_0000913 3300048924 Bacteria 53289
180 Ga0501032_0022381 3300049569 Bacteria 4381
181 Ga0501033_0061345 3300049570 Bacteria 2771
182 Ga0501033_0176406 3300049570 Bacteria 1533
183 Ga0501033_0775687 3300049570 Bacteria 649
184 Ga0501034_0001901 3300049571 Bacteria 26446
185 Ga0501036_0003292 3300049572 Bacteria 12884
186 Ga0501037_0373088 3300049573 Bacteria 981
187 Ga0501037_0679043 3300049573 Bacteria 687
188 Ga0501038_0093638 3300049574 Bacteria 2513
189 Ga0501038_0159433 3300049574 Bacteria 1834
190 Ga0501039_0003701 3300049575 Bacteria 11472
191 Ga0501042_0106667 3300049578 Bacteria 2016
192 Ga0501043_0075589 3300049579 Bacteria 2646
193 Ga0501043_0166959 3300049579 Bacteria 1718
194 Ga0501043_0884921 3300049579 Bacteria 641
195 Ga0501046_0002257 3300049580 Bacteria 18185
196 Ga0501046_0089922 3300049580 Bacteria 2363
197 Ga0501047_0019823 3300049581 Bacteria 6455
198 Ga0501047_0128745 3300049581 Bacteria 2412
199 Ga0501047_0151433 3300049581 Bacteria 2195
200 Ga0501047_0218251 3300049581 Bacteria 1763
201 Ga0501047_0542968 3300049581 Bacteria 987
202 Ga0501048_0001840 3300049582 Bacteria 16103
203 Ga0501067_0001565 3300049583 Bacteria 12502
204 Ga0501068_0008788 3300049584 Bacteria 5636
205 Ga0501069_0015408 3300049585 Bacteria 4097
206 Ga0501070_0080249 3300049586 Bacteria 2699
207 Ga0501072_0084351 3300049588 Bacteria 2519
208 Ga0501073_0143699 3300049589 Bacteria 1653
209 Ga0501073_0632603 3300049589 Bacteria 739
210 Ga0501074_0007895 3300049590 Bacteria 7709
211 Ga0501079_0002732 3300049741 Bacteria 12855
212 Ga0501080_0086216 3300049742 Bacteria 2917
213 Ga0501083_0002013 3300049744 Bacteria 13984
214 Ga0501035_0009598 3300049822 Bacteria 9000
215 Ga0501035_0015315 3300049822 Bacteria 7077
216 Ga0501035_0116946 3300049822 Bacteria 2333
217 Ga0501035_0150189 3300049822 Bacteria 2022
218 Ga0501035_0402132 3300049822 Bacteria 1139
219 Ga0501044_0004770 3300049823 Bacteria 15167
220 Ga0501044_0056786 3300049823 Bacteria 4019
221 Ga0501044_0087341 3300049823 Unclassified 3150
222 Ga0501044_0107844 3300049823 Bacteria 2795
223 Ga0501044_0145609 3300049823 Bacteria 2355
224 Ga0501044_0148977 3300049823 Bacteria 2323
225 Ga0501044_0353046 3300049823 Bacteria 1390
226 Ga0501044_0747351 3300049823 Bacteria 860
227 Ga0501045_0075173 3300049824 Bacteria 2488
228 Ga0500643_000003 3300053087 Bacteria 876659
229 Ga0500646_0038737 3300053090 Bacteria 1335
230 Ga0500595_000992 3300053119 Bacteria 15933
231 Ga0500595_006418 3300053119 Bacteria 4992
232 Ga0500573_0000008 3300053140 Bacteria 237795
233 Ga0500639_209001 3300053163 Bacteria 829
234 Ga0501084_0001552 3300054114 Bacteria 18248
235 Ga0501082_0005184 3300060353 Bacteria 11336
236 Ga0501082_0245895 3300060353 Bacteria 1557

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025933 Ga0207706_10497561 Ga0207706_104975611 160
2 3300005458 Ga0070681_10447371 Ga0070681_104473711 175
3 3300025321 Ga0207656_10092190 Ga0207656_100921902 175
4 3300053163 Ga0500639_209001 Ga0500639_209001_12_557 175
5 3300049581 Ga0501047_0019823 Ga0501047_0019823_4712_5269 178
6 3300049822 Ga0501035_0009598 Ga0501035_0009598_7037_7594 178
7 3300049823 Ga0501044_0004770 Ga0501044_0004770_2698_3255 178
8 3300046454 Ga0495592_0563716 Ga0495592_0563716_132_671 179
9 3300053119 Ga0500595_000992 Ga0500595_000992_2969_3508 179
10 3300053119 Ga0500595_006418 Ga0500595_006418_1807_2346 179
11 3300006881 Ga0068865_100199466 Ga0068865_1001994662 180
12 3300009093 Ga0105240_10075407 Ga0105240_100754074 180
13 3300009551 Ga0105238_10550915 Ga0105238_105509152 180
14 3300011119 Ga0105246_11277164 Ga0105246_112771641 180
15 3300013104 Ga0157370_10117814 Ga0157370_101178143 180
16 3300025906 Ga0207699_10843372 Ga0207699_108433721 180
17 3300025913 Ga0207695_10134711 Ga0207695_101347112 180
18 3300005328 Ga0070676_10012222 Ga0070676_100122222 181
19 3300005334 Ga0068869_100142507 Ga0068869_1001425072 181
20 3300005335 Ga0070666_10459649 Ga0070666_104596491 181
21 3300005338 Ga0068868_100064931 Ga0068868_1000649313 181
22 3300005339 Ga0070660_100345816 Ga0070660_1003458162 181
23 3300005354 Ga0070675_100229631 Ga0070675_1002296312 181
24 3300005356 Ga0070674_100254265 Ga0070674_1002542652 181
25 3300005364 Ga0070673_100746227 Ga0070673_1007462271 181
26 3300005366 Ga0070659_100053933 Ga0070659_1000539332 181
27 3300005438 Ga0070701_10618645 Ga0070701_106186451 181
28 3300005456 Ga0070678_100136658 Ga0070678_1001366581 181
29 3300005459 Ga0068867_100127655 Ga0068867_1001276553 181
30 3300005539 Ga0068853_100376174 Ga0068853_1003761742 181
31 3300005547 Ga0070693_100377386 Ga0070693_1003773861 181
32 3300005548 Ga0070665_100033932 Ga0070665_1000339325 181
33 3300005548 Ga0070665_101487882 Ga0070665_1014878822 181
34 3300005563 Ga0068855_100483358 Ga0068855_1004833582 181
35 3300005563 Ga0068855_101482045 Ga0068855_1014820451 181
36 3300005840 Ga0068870_10306268 Ga0068870_103062682 181
37 3300005842 Ga0068858_100044603 Ga0068858_1000446035 181
38 3300005843 Ga0068860_101010793 Ga0068860_1010107931 181
39 3300006237 Ga0097621_100011961 Ga0097621_1000119614 181
40 3300006237 Ga0097621_100814665 Ga0097621_1008146651 181
41 3300006358 Ga0068871_100001662 Ga0068871_1000016624 181
42 3300006881 Ga0068865_100029082 Ga0068865_1000290825 181
43 3300006881 Ga0068865_100138236 Ga0068865_1001382363 181
44 3300009093 Ga0105240_11012385 Ga0105240_110123852 181
45 3300009098 Ga0105245_10858378 Ga0105245_108583782 181
46 3300009148 Ga0105243_10010434 Ga0105243_100104344 181
47 3300009148 Ga0105243_10724649 Ga0105243_107246491 181
48 3300009174 Ga0105241_10110779 Ga0105241_101107792 181
49 3300009545 Ga0105237_10393580 Ga0105237_103935802 181
50 3300009545 Ga0105237_11834749 Ga0105237_118347491 181
51 3300009551 Ga0105238_10140902 Ga0105238_101409023 181
52 3300010375 Ga0105239_10213620 Ga0105239_102136201 181
53 3300013100 Ga0157373_10158704 Ga0157373_101587043 181
54 3300013296 Ga0157374_10199312 Ga0157374_101993122 181
55 3300013306 Ga0163162_10370634 Ga0163162_103706341 181
56 3300013306 Ga0163162_12117105 Ga0163162_121171051 181
57 3300013307 Ga0157372_10245426 Ga0157372_102454262 181
58 3300013308 Ga0157375_10105116 Ga0157375_101051162 181
59 3300014325 Ga0163163_10000002 Ga0163163_1000000218 181
60 3300014325 Ga0163163_10354783 Ga0163163_103547833 181
61 3300014326 Ga0157380_10335800 Ga0157380_103358002 181
62 3300014745 Ga0157377_10088504 Ga0157377_100885043 181
63 3300014968 Ga0157379_10371896 Ga0157379_103718963 181
64 3300014969 Ga0157376_10440932 Ga0157376_104409321 181
65 3300017792 Ga0163161_10136012 Ga0163161_101360123 181
66 3300025261 Ga0209233_1004939 Ga0209233_10049395 181
67 3300025261 Ga0209233_1040334 Ga0209233_10403342 181
68 3300025901 Ga0207688_10053920 Ga0207688_100539203 181
69 3300025903 Ga0207680_10278973 Ga0207680_102789731 181
70 3300025907 Ga0207645_10055976 Ga0207645_100559762 181
71 3300025908 Ga0207643_10054876 Ga0207643_100548761 181
72 3300025909 Ga0207705_10672944 Ga0207705_106729441 181
73 3300025911 Ga0207654_10109448 Ga0207654_101094482 181
74 3300025911 Ga0207654_10141739 Ga0207654_101417391 181
75 3300025912 Ga0207707_10347382 Ga0207707_103473822 181
76 3300025913 Ga0207695_10255787 Ga0207695_102557872 181
77 3300025919 Ga0207657_10768940 Ga0207657_107689402 181
78 3300025921 Ga0207652_10125112 Ga0207652_101251123 181
79 3300025924 Ga0207694_10081933 Ga0207694_100819332 181
80 3300025926 Ga0207659_10377531 Ga0207659_103775312 181
81 3300025932 Ga0207690_10014675 Ga0207690_100146753 181
82 3300025934 Ga0207686_10366664 Ga0207686_103666641 181
83 3300025935 Ga0207709_10456907 Ga0207709_104569072 181
84 3300025937 Ga0207669_10158605 Ga0207669_101586053 181
85 3300025938 Ga0207704_10138399 Ga0207704_101383993 181
86 3300025942 Ga0207689_10172231 Ga0207689_101722311 181
87 3300025944 Ga0207661_10964731 Ga0207661_109647312 181
88 3300025960 Ga0207651_10622617 Ga0207651_106226172 181
89 3300025981 Ga0207640_11203012 Ga0207640_112030122 181
90 3300026035 Ga0207703_10153529 Ga0207703_101535293 181
91 3300026035 Ga0207703_10432945 Ga0207703_104329452 181
92 3300026041 Ga0207639_10184098 Ga0207639_101840982 181
93 3300026078 Ga0207702_10017827 Ga0207702_100178274 181
94 3300026089 Ga0207648_10050182 Ga0207648_100501821 181
95 3300026116 Ga0207674_10716714 Ga0207674_107167142 181
96 3300026121 Ga0207683_10139139 Ga0207683_101391393 181
97 3300028379 Ga0268266_10116957 Ga0268266_101169573 181
98 3300028379 Ga0268266_10658827 Ga0268266_106588272 181
99 3300031250 Ga0265331_10068207 Ga0265331_100682072 181
100 3300031711 Ga0265314_10025287 Ga0265314_100252871 181
101 3300031730 Ga0307516_10053001 Ga0307516_100530014 181
102 3300035084 Ga0373928_0036701 Ga0373928_0036701_538_1083 181
103 3300035115 Ga0373941_0190645 Ga0373941_0190645_99_644 181
104 3300046471 Ga0495650_0075017 Ga0495650_0075017_257_811 181
105 3300046660 Ga0495625_0233296 Ga0495625_0233296_50_598 181
106 3300048924 Ga0496121_0000913 Ga0496121_0000913_39688_40245 181
107 3300049569 Ga0501032_0022381 Ga0501032_0022381_1318_1863 181
108 3300049570 Ga0501033_0061345 Ga0501033_0061345_1905_2450 181
109 3300049570 Ga0501033_0176406 Ga0501033_0176406_437_991 181
110 3300049570 Ga0501033_0775687 Ga0501033_0775687_33_584 181
111 3300049571 Ga0501034_0001901 Ga0501034_0001901_1209_1754 181
112 3300049572 Ga0501036_0003292 Ga0501036_0003292_2211_2756 181
113 3300049573 Ga0501037_0373088 Ga0501037_0373088_322_867 181
114 3300049573 Ga0501037_0679043 Ga0501037_0679043_89_637 181
115 3300049574 Ga0501038_0093638 Ga0501038_0093638_1351_1914 181
116 3300049574 Ga0501038_0159433 Ga0501038_0159433_968_1513 181
117 3300049575 Ga0501039_0003701 Ga0501039_0003701_1814_2359 181
118 3300049578 Ga0501042_0106667 Ga0501042_0106667_1433_1978 181
119 3300049579 Ga0501043_0075589 Ga0501043_0075589_1812_2369 181
120 3300049579 Ga0501043_0166959 Ga0501043_0166959_1135_1680 181
121 3300049579 Ga0501043_0884921 Ga0501043_0884921_38_583 181
122 3300049580 Ga0501046_0002257 Ga0501046_0002257_712_1257 181
123 3300049580 Ga0501046_0089922 Ga0501046_0089922_936_1490 181
124 3300049581 Ga0501047_0128745 Ga0501047_0128745_1491_2039 181
125 3300049581 Ga0501047_0151433 Ga0501047_0151433_1336_1881 181
126 3300049581 Ga0501047_0218251 Ga0501047_0218251_322_867 181
127 3300049581 Ga0501047_0542968 Ga0501047_0542968_132_683 181
128 3300049582 Ga0501048_0001840 Ga0501048_0001840_7619_8164 181
129 3300049583 Ga0501067_0001565 Ga0501067_0001565_1552_2097 181
130 3300049584 Ga0501068_0008788 Ga0501068_0008788_4586_5131 181
131 3300049585 Ga0501069_0015408 Ga0501069_0015408_2082_2627 181
132 3300049586 Ga0501070_0080249 Ga0501070_0080249_1452_1997 181
133 3300049588 Ga0501072_0084351 Ga0501072_0084351_1439_1984 181
134 3300049589 Ga0501073_0143699 Ga0501073_0143699_787_1332 181
135 3300049589 Ga0501073_0632603 Ga0501073_0632603_15_563 181
136 3300049590 Ga0501074_0007895 Ga0501074_0007895_6030_6575 181
137 3300049741 Ga0501079_0002732 Ga0501079_0002732_2211_2756 181
138 3300049742 Ga0501080_0086216 Ga0501080_0086216_820_1365 181
139 3300049744 Ga0501083_0002013 Ga0501083_0002013_10157_10702 181
140 3300049822 Ga0501035_0015315 Ga0501035_0015315_6234_6797 181
141 3300049822 Ga0501035_0116946 Ga0501035_0116946_1614_2159 181
142 3300049822 Ga0501035_0150189 Ga0501035_0150189_1240_1794 181
143 3300049822 Ga0501035_0402132 Ga0501035_0402132_548_1096 181
144 3300049823 Ga0501044_0056786 Ga0501044_0056786_321_884 181
145 3300049823 Ga0501044_0087341 Ga0501044_0087341_116_664 181
146 3300049823 Ga0501044_0107844 Ga0501044_0107844_39_584 181
147 3300049823 Ga0501044_0145609 Ga0501044_0145609_630_1175 181
148 3300049823 Ga0501044_0148977 Ga0501044_0148977_579_1130 181
149 3300049823 Ga0501044_0747351 Ga0501044_0747351_284_838 181
150 3300049824 Ga0501045_0075173 Ga0501045_0075173_1413_1958 181
151 3300053087 Ga0500643_000003 Ga0500643_000003_439824_440372 181
152 3300053090 Ga0500646_0038737 Ga0500646_0038737_43_591 181
153 3300054114 Ga0501084_0001552 Ga0501084_0001552_8867_9412 181
154 3300060353 Ga0501082_0005184 Ga0501082_0005184_9962_10507 181
155 3300060353 Ga0501082_0245895 Ga0501082_0245895_549_1097 181
156 3300005327 Ga0070658_10004431 Ga0070658_100044317 182
157 3300005329 Ga0070683_100219770 Ga0070683_1002197702 182
158 3300005339 Ga0070660_100015204 Ga0070660_1000152047 182
159 3300005458 Ga0070681_10051757 Ga0070681_100517574 182
160 3300005530 Ga0070679_100004972 Ga0070679_1000049727 182
161 3300005548 Ga0070665_100000162 Ga0070665_10000016260 182
162 3300005616 Ga0068852_100104053 Ga0068852_1001040533 182
163 3300009093 Ga0105240_10167660 Ga0105240_101676602 182
164 3300009093 Ga0105240_10669519 Ga0105240_106695192 182
165 3300009174 Ga0105241_10154513 Ga0105241_101545133 182
166 3300009551 Ga0105238_10395375 Ga0105238_103953752 182
167 3300013104 Ga0157370_10059085 Ga0157370_100590855 182
168 3300013104 Ga0157370_11267684 Ga0157370_112676841 182
169 3300013105 Ga0157369_10579333 Ga0157369_105793332 182
170 3300025909 Ga0207705_10005301 Ga0207705_100053017 182
171 3300025912 Ga0207707_10072413 Ga0207707_100724133 182
172 3300025913 Ga0207695_10050766 Ga0207695_100507663 182
173 3300025913 Ga0207695_10529944 Ga0207695_105299442 182
174 3300025919 Ga0207657_10076300 Ga0207657_100763003 182
175 3300025921 Ga0207652_10005256 Ga0207652_100052566 182
176 3300025924 Ga0207694_10042879 Ga0207694_100428793 182
177 3300025924 Ga0207694_10619632 Ga0207694_106196321 182
178 3300025949 Ga0207667_10207530 Ga0207667_102075302 182
179 3300025949 Ga0207667_10341865 Ga0207667_103418652 182
180 3300028379 Ga0268266_10000969 Ga0268266_1000096935 182
181 3300028800 Ga0265338_10050230 Ga0265338_100502302 182
182 3300031241 Ga0265325_10001990 Ga0265325_100019902 182
183 3300031249 Ga0265339_10023137 Ga0265339_100231371 182
184 3300031595 Ga0265313_10017186 Ga0265313_100171862 182
185 3300031711 Ga0265314_10055617 Ga0265314_100556172 182
186 3300031712 Ga0265342_10080212 Ga0265342_100802123 182
187 3300037466 Ga0395898_0158587 Ga0395898_0158587_729_1289 182
188 3300038443 Ga0395901_0071452 Ga0395901_0071452_2332_2892 182
189 3300045976 Ga0466967_0336062 Ga0466967_0336062_481_1029 182
190 3300049823 Ga0501044_0353046 Ga0501044_0353046_739_1299 182
191 3300053140 Ga0500573_0000008 Ga0500573_0000008_67844_68395 182
192 3300028800 Ga0265338_10010269 Ga0265338_100102697 183
193 3300031250 Ga0265331_10070671 Ga0265331_100706711 183
194 3300031250 Ga0265331_10176106 Ga0265331_101761062 183
195 3300005331 Ga0070670_100394492 Ga0070670_1003944921 184
196 3300005535 Ga0070684_100188554 Ga0070684_1001885542 184
197 3300025925 Ga0207650_10404834 Ga0207650_104048341 184
198 3300025961 Ga0207712_10057231 Ga0207712_100572314 184
199 3300046680 Ga0495646_0100856 Ga0495646_0100856_1017_1574 184
200 3300003214 JGI25165J46597_1000003 JGI25165J46597_1000003150 185
201 3300005335 Ga0070666_10314275 Ga0070666_103142752 185
202 3300005338 Ga0068868_100394502 Ga0068868_1003945022 185
203 3300005364 Ga0070673_100580197 Ga0070673_1005801972 185
204 3300005455 Ga0070663_100354421 Ga0070663_1003544212 185
205 3300005456 Ga0070678_100428938 Ga0070678_1004289382 185
206 3300005456 Ga0070678_100573244 Ga0070678_1005732441 185
207 3300005457 Ga0070662_100705695 Ga0070662_1007056952 185
208 3300005564 Ga0070664_100488501 Ga0070664_1004885012 185
209 3300005615 Ga0070702_100284730 Ga0070702_1002847302 185
210 3300005618 Ga0068864_100925049 Ga0068864_1009250492 185
211 3300005841 Ga0068863_100091459 Ga0068863_1000914592 185
212 3300006237 Ga0097621_100262643 Ga0097621_1002626432 185
213 3300006358 Ga0068871_100138300 Ga0068871_1001383001 185
214 3300009093 Ga0105240_10568564 Ga0105240_105685642 185
215 3300009098 Ga0105245_10145282 Ga0105245_101452823 185
216 3300009101 Ga0105247_10173286 Ga0105247_101732863 185
217 3300009174 Ga0105241_10557691 Ga0105241_105576912 185
218 3300009177 Ga0105248_10084400 Ga0105248_100844002 185
219 3300010375 Ga0105239_10200287 Ga0105239_102002873 185
220 3300011119 Ga0105246_10034489 Ga0105246_100344896 185
221 3300013296 Ga0157374_10765790 Ga0157374_107657901 185
222 3300025261 Ga0209233_1000015 Ga0209233_1000015630 185
223 3300025903 Ga0207680_10193347 Ga0207680_101933473 185
224 3300025911 Ga0207654_10408872 Ga0207654_104088722 185
225 3300025913 Ga0207695_10564677 Ga0207695_105646772 185
226 3300025919 Ga0207657_10323006 Ga0207657_103230062 185
227 3300025924 Ga0207694_10910344 Ga0207694_109103441 185
228 3300025927 Ga0207687_10077891 Ga0207687_100778913 185
229 3300025941 Ga0207711_10030760 Ga0207711_100307606 185
230 3300025942 Ga0207689_10232141 Ga0207689_102321412 185
231 3300025945 Ga0207679_10565377 Ga0207679_105653772 185
232 3300026067 Ga0207678_10144550 Ga0207678_101445503 185
233 3300026088 Ga0207641_10182295 Ga0207641_101822952 185
234 3300026121 Ga0207683_10576766 Ga0207683_105767662 185
235 3300028379 Ga0268266_10124817 Ga0268266_101248173 185
236 3300031730 Ga0307516_10037319 Ga0307516_100373193 185

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02630

SCO1-SenC

SCO1/SenC

36

168

0.94

PF00578

AhpC-TSA

AhpC/TSA family

33

170

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wp0-assembly1.cif.gz_A human sco1 0.9239 37 182
6n5u-assembly3.cif.gz_C crystal structure of arabidopsis thaliana scoi with copper bound 0.9137 35 184
6n5u-assembly2.cif.gz_B crystal structure of arabidopsis thaliana scoi with copper bound 0.9091 35 184
4wbr-assembly1.cif.gz_D structure of bradyrhizobium japonicum scoi with copper bound 0.8936 35 184
2b7k-assembly4.cif.gz_D crystal structure of yeast sco1 0.8929 35 182
ID Description Score Start End Superfamily
af_Q54TT7_154_312_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9417 37 180 3.40.30.10
af_Q17557_120_303_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9234 35 182 3.40.30.10
af_Q4DE34_85_262_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.922 32 182 3.40.30.10
af_K7MTL0_161_316_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9201 50 184 3.40.30.10
af_Q8IC00_108_304_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9114 35 182 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7G3CZI5-F1-model_v4 deleted 0.9717 33 184
AF-A0A522SH69-F1-model_v4 SCO family protein 0.966 20 184 GO:0046872
AF-A0A7V8TSW7-F1-model_v4 SCO family protein 0.963 33 185 GO:0046872
AF-T1BVV9-F1-model_v4 Electron transport protein SCO1/SenC 0.9511 26 184
AF-A0A1Q3KP24-F1-model_v4 Thioredoxin domain-containing protein 0.9486 37 184 GO:0046872

Feature Viewer

pLDDT pTM Quality
90.59 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map