F349201

General Info

Members Datasets Scaffolds Average Seq Length
236 185 235 127

Family's Representative Sequence

Representative Sequence 3300031250|Ga0265331_10077210|Ga0265331_100772102
Length 155
Sequence VPSPVAKSFSNCTARGHRVAHWRLGDFMPIFIVQLGTKRKRGEGVRLGTVRRPPRGVPKSDFARLDYYDVWFPNLSPSADLVQEALGAADDRAWAAFARKFRREMSAPDLSRELDVLAALSHHTNLSVGCYCQEESRCHRSLLRELLAKRGAKVV

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
59 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
60 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
61 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
63 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
90 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
91 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
92 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
93 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
96 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
97 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
101 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
102 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
104 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
105 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
106 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
107 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
108 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
109 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
110 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
113 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
117 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
118 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
119 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
120 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
121 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
122 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
123 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
124 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
125 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
126 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
127 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
128 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
129 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
130 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
131 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
132 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
135 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
136 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
137 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
138 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
139 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
140 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
141 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
142 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
143 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
144 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
145 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
146 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
147 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
148 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
149 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
150 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
151 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
152 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
153 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
154 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
155 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
156 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
157 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
158 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
159 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
160 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
161 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
162 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
163 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
174 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
175 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
176 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
177 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
178 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
179 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
182 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
183 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
184 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
185 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0
Isolates 0.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.66
Nodule 0
Rhizoplane 2.54
Rhizosphere 85.59
Stem 0
Stem Tuber 0
Unclassified 7.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_1557594 2162886012 Bacteria 1092
2 MBSR1b_contig_5237604 2162886012 Bacteria 1245
3 MBSR1b_contig_9241257 2162886012 Bacteria 1233
4 JGI25152J39213_1005788 3300002773 Bacteria 3514
5 JGI25153J46596_10002231 3300003215 Bacteria 11305
6 JGI25153J46596_10007687 3300003215 Bacteria 5253
7 rootH1_10045451 3300003316 Bacteria 5306
8 rootL2_10044467 3300003322 Bacteria 4835
9 rootH1_10021944 3300003323 Bacteria 9851
10 rootH1_10032025 3300003323 Bacteria 2736
11 Ga0055526_1007506 3300003771 Bacteria 5649
12 Ga0065715_10169027 3300005293 Bacteria 1562
13 Ga0070658_10517034 3300005327 Bacteria 1032
14 Ga0070676_11428261 3300005328 Unclassified 531
15 Ga0070683_100002122 3300005329 Bacteria 15653
16 Ga0070670_100396845 3300005331 Unclassified 1217
17 Ga0070666_10782026 3300005335 Unclassified 702
18 Ga0070661_100011813 3300005344 Bacteria 6093
19 Ga0070661_100162475 3300005344 Bacteria 1692
20 Ga0070671_100041324 3300005355 Unclassified 3832
21 Ga0070673_100138187 3300005364 Bacteria 2053
22 Ga0070709_10212909 3300005434 Bacteria 1374
23 Ga0070713_100068324 3300005436 Unclassified 2994
24 Ga0070713_100882460 3300005436 Bacteria 860
25 Ga0070663_100083777 3300005455 Bacteria 2349
26 Ga0070678_100133187 3300005456 Bacteria 1978
27 Ga0070662_100004298 3300005457 Bacteria 8996
28 Ga0068867_101478253 3300005459 Bacteria 632
29 Ga0070684_100000667 3300005535 Bacteria 23730
30 Ga0070672_100186504 3300005543 Unclassified 1730
31 Ga0070686_100409389 3300005544 Bacteria 1033
32 Ga0070695_100951617 3300005545 Bacteria 696
33 Ga0070665_100104154 3300005548 Bacteria 2840
34 Ga0070665_100357844 3300005548 Bacteria 1465
35 Ga0070665_102085736 3300005548 Bacteria 572
36 Ga0070704_100875995 3300005549 Bacteria 806
37 Ga0070664_100003674 3300005564 Bacteria 12364
38 Ga0068852_100023657 3300005616 Bacteria 4949
39 Ga0068859_100002323 3300005617 Bacteria 19323
40 Ga0068864_100639803 3300005618 Bacteria 1035
41 Ga0068851_10268621 3300005834 Bacteria 972
42 Ga0068858_100391558 3300005842 Bacteria 1334
43 Ga0068860_100335246 3300005843 Bacteria 1486
44 Ga0081540_1126744 3300005983 Bacteria 1049
45 Ga0068871_101307130 3300006358 Bacteria 682
46 Ga0068871_101570784 3300006358 Unclassified 622
47 Ga0075434_100640686 3300006871 Bacteria 1081
48 Ga0068865_100877194 3300006881 Bacteria 779
49 Ga0075436_100102233 3300006914 Bacteria 1996
50 Ga0097620_100002323 3300006931 Bacteria 19323
51 Ga0075435_100951202 3300007076 Bacteria 750
52 Ga0105240_10891171 3300009093 Bacteria 958
53 Ga0105245_11363456 3300009098 Bacteria 759
54 Ga0105248_11311016 3300009177 Bacteria 819
55 Ga0105248_11820044 3300009177 Unclassified 691
56 Ga0105248_12045296 3300009177 Unclassified 651
57 Ga0105238_11390453 3300009551 Bacteria 729
58 Ga0105249_10221229 3300009553 Bacteria 1863
59 Ga0105239_10349972 3300010375 Bacteria 1668
60 Ga0157370_10653001 3300013104 Bacteria 961
61 Ga0157374_10060228 3300013296 Bacteria 3552
62 Ga0157378_10186477 3300013297 Bacteria 1954
63 Ga0157378_10995829 3300013297 Bacteria 872
64 Ga0163162_10590479 3300013306 Bacteria 1237
65 Ga0157375_10433082 3300013308 Unclassified 1481
66 Ga0157375_10640144 3300013308 Unclassified 1220
67 Ga0163163_10011651 3300014325 Bacteria 7988
68 Ga0157380_12533480 3300014326 Unclassified 579
69 Ga0157376_10780641 3300014969 Unclassified 967
70 Ga0157376_10990194 3300014969 Unclassified 863
71 Ga0157376_11044205 3300014969 Bacteria 841
72 Ga0157376_12591916 3300014969 Bacteria 547
73 Ga0213876_10001261 3300021384 Bacteria 15979
74 Ga0213875_10408648 3300021388 Unclassified 648
75 Ga0207425_1003919 3300025245 Bacteria 4609
76 Ga0209129_1000062 3300025258 Bacteria 240655
77 Ga0209564_1000176 3300025295 Bacteria 152363
78 Ga0209758_1000378 3300025297 Bacteria 77514
79 Ga0209758_1000517 3300025297 Bacteria 61999
80 Ga0209256_1019782 3300025299 Bacteria 2128
81 Ga0207699_10089436 3300025906 Bacteria 1930
82 Ga0207699_10122016 3300025906 Unclassified 1687
83 Ga0207705_10667095 3300025909 Bacteria 809
84 Ga0207695_10237311 3300025913 Bacteria 1725
85 Ga0207663_10346150 3300025916 Bacteria 1124
86 Ga0207649_10043142 3300025920 Bacteria 2756
87 Ga0207649_10084075 3300025920 Bacteria 2068
88 Ga0207650_10547516 3300025925 Bacteria 970
89 Ga0207650_10904453 3300025925 Unclassified 749
90 Ga0207687_11279151 3300025927 Bacteria 631
91 Ga0207700_10078536 3300025928 Unclassified 2568
92 Ga0207644_10027711 3300025931 Unclassified 3916
93 Ga0207706_10021837 3300025933 Bacteria 5745
94 Ga0207706_10123136 3300025933 Unclassified 2281
95 Ga0207709_10559766 3300025935 Bacteria 900
96 Ga0207669_11682337 3300025937 Unclassified 542
97 Ga0207691_10130544 3300025940 Bacteria 2220
98 Ga0207711_10281038 3300025941 Bacteria 1533
99 Ga0207661_10003548 3300025944 Bacteria 10840
100 Ga0207679_10001740 3300025945 Bacteria 13555
101 Ga0207667_10546224 3300025949 Bacteria 1172
102 Ga0207651_10103062 3300025960 Bacteria 2123
103 Ga0207651_10761411 3300025960 Unclassified 856
104 Ga0207658_10442900 3300025986 Bacteria 1149
105 Ga0207658_11020293 3300025986 Unclassified 755
106 Ga0207678_10022216 3300026067 Bacteria 5559
107 Ga0207648_11997030 3300026089 Bacteria 541
108 Ga0207683_10821391 3300026121 Unclassified 863
109 Ga0207698_10038546 3300026142 Bacteria 3532
110 Ga0207428_10443172 3300027907 Bacteria 947
111 Ga0268266_10154911 3300028379 Bacteria 2069
112 Ga0268266_10294918 3300028379 Unclassified 1511
113 Ga0268266_11148987 3300028379 Unclassified 751
114 Ga0265338_10163143 3300028800 Unclassified 1719
115 Ga0265328_10395600 3300031239 Unclassified 542
116 Ga0265331_10077210 3300031250 Unclassified 1552
117 Ga0265316_10433640 3300031344 Unclassified 944
118 Ga0265316_10497672 3300031344 Unclassified 871
119 Ga0307513_10024089 3300031456 Bacteria 7089
120 Ga0307408_100416885 3300031548 Bacteria 1157
121 Ga0265342_10065966 3300031712 Bacteria 2121
122 Ga0316576_10291188 3300031727 Bacteria 1221
123 Ga0307516_10005461 3300031730 Bacteria 15195
124 Ga0307412_10164307 3300031911 Bacteria 1653
125 Ga0307416_100048276 3300032002 Bacteria 3376
126 Ga0316585_10006820 3300032137 Bacteria 3275
127 Ga0316580_10024309 3300032139 Bacteria 1872
128 Ga0373923_0295213 3300035111 Unclassified 766
129 Ga0373923_0453472 3300035111 Bacteria 622
130 Ga0373954_0019447 3300035118 Bacteria 3064
131 Ga0373943_0163097 3300035170 Bacteria 1215
132 Ga0373946_0375930 3300035171 Bacteria 714
133 Ga0373955_0263045 3300035172 Unclassified 1036
134 Ga0373961_0005462 3300035241 Bacteria 3053
135 Ga0316574_0184340 3300035398 Bacteria 1342
136 Ga0373933_1026807 3300035724 Bacteria 543
137 Ga0373947_0835139 3300035725 Bacteria 629
138 Ga0373937_0779318 3300036401 Bacteria 904
139 Ga0373937_1535176 3300036401 Bacteria 613
140 Ga0373937_1908718 3300036401 Bacteria 540
141 Ga0316584_0077310 3300036712 Bacteria 2493
142 Ga0373925_0217325 3300037068 Bacteria 1525
143 Ga0373925_1080079 3300037068 Bacteria 660
144 Ga0373925_1285968 3300037068 Unclassified 600
145 Ga0436364_1166656 3300037853 Unclassified 2970
146 Ga0436364_1265831 3300037853 Bacteria 7128
147 Ga0436365_0415981 3300039437 Bacteria 3591
148 Ga0436365_0542915 3300039437 Bacteria 29518
149 Ga0436365_1920964 3300039437 Bacteria 655
150 Ga0436360_0230762 3300039438 Bacteria 766
151 Ga0436361_0756923 3300039447 Bacteria 5967
152 Ga0436363_0231105 3300039450 Bacteria 809
153 Ga0436363_0235082 3300039450 Bacteria 775
154 Ga0439436_0187430 3300041404 Bacteria 590
155 Ga0439453_0008302 3300041408 Bacteria 1666
156 Ga0439453_0024042 3300041408 Bacteria 1116
157 Ga0451853_1922364 3300041512 Bacteria 1872
158 Ga0450897_001879 3300042128 Bacteria 1499
159 Ga0450903_042699 3300042138 Bacteria 669
160 Ga0439446_0034577 3300042156 Bacteria 1471
161 Ga0439464_0044532 3300042439 Bacteria 1271
162 Ga0451577_0363903 3300042876 Unclassified 1312
163 Ga0466972_0001525 3300044658 Bacteria 11286
164 Ga0466972_0002976 3300044658 Bacteria 8386
165 Ga0453683_0007581 3300044673 Bacteria 7352
166 Ga0466965_0141693 3300044683 Bacteria 1252
167 Ga0466964_0799585 3300044706 Bacteria 533
168 Ga0453684_0701350 3300044712 Unclassified 1100
169 Ga0466960_0107517 3300044901 Bacteria 1445
170 Ga0466960_0200193 3300044901 Bacteria 1091
171 Ga0451576_0007461 3300045051 Bacteria 13055
172 Ga0451576_0056735 3300045051 Unclassified 4095
173 Ga0451576_0423311 3300045051 Unclassified 1397
174 Ga0495592_0234185 3300046454 Bacteria 1221
175 Ga0495592_0270669 3300046454 Bacteria 1115
176 Ga0495651_0101029 3300046462 Bacteria 2147
177 Ga0495653_0015590 3300046463 Bacteria 6195
178 Ga0495662_0003592 3300046476 Bacteria 7834
179 Ga0495664_0148345 3300046477 Bacteria 1422
180 Ga0495664_0541718 3300046477 Bacteria 694
181 Ga0495608_0153054 3300046511 Bacteria 1469
182 Ga0495628_0028462 3300046516 Bacteria 4540
183 Ga0495630_0037401 3300046517 Bacteria 3629
184 Ga0495652_0031401 3300046529 Bacteria 4652
185 Ga0495652_0568418 3300046529 Bacteria 777
186 Ga0495640_0307296 3300046533 Bacteria 984
187 Ga0495587_0003975 3300046536 Bacteria 9804
188 Ga0495645_0001951 3300046543 Bacteria 14008
189 Ga0495667_0018280 3300046559 Bacteria 4735
190 Ga0495667_0490257 3300046559 Bacteria 770
191 Ga0495634_0332797 3300046642 Bacteria 912
192 Ga0495657_0642338 3300046675 Bacteria 612
193 Ga0495657_0900059 3300046675 Bacteria 503
194 Ga0495599_0010251 3300046678 Bacteria 5735
195 Ga0495623_0106609 3300046679 Bacteria 1702
196 Ga0495646_0230678 3300046680 Bacteria 998
197 Ga0495658_0370070 3300046683 Bacteria 912
198 Ga0495613_0338077 3300046689 Bacteria 1036
199 Ga0495649_0077365 3300046694 Bacteria 1781
200 Ga0495600_0037483 3300046809 Bacteria 3152
201 Ga0495604_0048475 3300047317 Bacteria 3304
202 Ga0495604_0719212 3300047317 Bacteria 633
203 Ga0495674_0007107 3300047319 Bacteria 10710
204 Ga0495674_0035842 3300047319 Bacteria 4472
205 Ga0495674_0594081 3300047319 Bacteria 877
206 Ga0495672_0544292 3300047320 Bacteria 510
207 Ga0495680_0415079 3300047322 Bacteria 927
208 Ga0495687_000134 3300047443 Bacteria 113646
209 Ga0495675_0137636 3300047444 Bacteria 1515
210 Ga0495684_0057538 3300047471 Bacteria 2963
211 Ga0495684_0093998 3300047471 Bacteria 2270
212 Ga0495602_0195689 3300048088 Bacteria 1546
213 Ga0496104_0003484 3300048907 Bacteria 13574
214 Ga0496105_0859002 3300048908 Bacteria 686
215 Ga0496106_0556923 3300048909 Bacteria 920
216 Ga0496108_0052223 3300048911 Bacteria 3424
217 Ga0496109_0076925 3300048912 Bacteria 3070
218 Ga0496112_0040579 3300048915 Bacteria 4551
219 Ga0501036_0557470 3300049572 Bacteria 952
220 Ga0501041_0458036 3300049577 Unclassified 810
221 Ga0501042_0407451 3300049578 Bacteria 985
222 Ga0501042_0719951 3300049578 Bacteria 726
223 Ga0501071_1108382 3300049587 Bacteria 611
224 Ga0501072_0649606 3300049588 Bacteria 830
225 Ga0501075_0315704 3300049591 Bacteria 1191
226 Ga0501207_008025 3300049654 Bacteria 1519
227 Ga0501079_0039125 3300049741 Bacteria 3657
228 Ga0501081_0340771 3300049743 Bacteria 1104
229 Ga0501081_0822956 3300049743 Bacteria 699
230 Ga0501045_0330529 3300049824 Bacteria 1134
231 nmdc:mga08y16_365936_c1 3300050511 Bacteria 1480
232 nmdc:mga08x19_20949_c1 3300050514 Bacteria 4032
233 Ga0495612_0422455 3300053078 Bacteria 607
234 Ga0500651_0315238 3300053093 Bacteria 894
235 Ga0501082_0040287 3300060353 Bacteria 4030

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049572 Ga0501036_0557470 Ga0501036_0557470_346_705 105
2 3300049587 Ga0501071_1108382 Ga0501071_1108382_204_563 105
3 3300049588 Ga0501072_0649606 Ga0501072_0649606_365_724 105
4 3300049743 Ga0501081_0822956 Ga0501081_0822956_125_484 105
5 3300035111 Ga0373923_0295213 Ga0373923_0295213_268_642 111
6 iso_pu_bacteria 8001522603 8001525847 111
7 3300035725 Ga0373947_0835139 Ga0373947_0835139_74_454 113
8 3300049578 Ga0501042_0407451 Ga0501042_0407451_23_403 113
9 3300006914 Ga0075436_100102233 Ga0075436_1001022332 114
10 3300007076 Ga0075435_100951202 Ga0075435_1009512022 114
11 3300025906 Ga0207699_10089436 Ga0207699_100894364 114
12 3300035172 Ga0373955_0263045 Ga0373955_0263045_15_398 114
13 3300050514 nmdc:mga08x19_20949_c1 nmdc:mga08x19_20949_c1_2444_2830 114
14 3300002773 JGI25152J39213_1005788 JGI25152J39213_10057882 115
15 3300003215 JGI25153J46596_10002231 JGI25153J46596_100022318 115
16 3300003215 JGI25153J46596_10007687 JGI25153J46596_100076874 115
17 3300003323 rootH1_10032025 rootH1_100320254 115
18 3300003771 Ga0055526_1007506 Ga0055526_10075063 115
19 3300005327 Ga0070658_10517034 Ga0070658_105170341 115
20 3300005328 Ga0070676_11428261 Ga0070676_114282611 115
21 3300005335 Ga0070666_10782026 Ga0070666_107820262 115
22 3300005355 Ga0070671_100041324 Ga0070671_1000413244 115
23 3300005364 Ga0070673_100138187 Ga0070673_1001381872 115
24 3300005434 Ga0070709_10212909 Ga0070709_102129092 115
25 3300005436 Ga0070713_100068324 Ga0070713_1000683242 115
26 3300005456 Ga0070678_100133187 Ga0070678_1001331872 115
27 3300005459 Ga0068867_101478253 Ga0068867_1014782531 115
28 3300005548 Ga0070665_100104154 Ga0070665_1001041543 115
29 3300005548 Ga0070665_100357844 Ga0070665_1003578442 115
30 3300005549 Ga0070704_100875995 Ga0070704_1008759951 115
31 3300005616 Ga0068852_100023657 Ga0068852_1000236573 115
32 3300005617 Ga0068859_100002323 Ga0068859_1000023235 115
33 3300005843 Ga0068860_100335246 Ga0068860_1003352462 115
34 3300005983 Ga0081540_1126744 Ga0081540_11267442 115
35 3300006358 Ga0068871_101307130 Ga0068871_1013071301 115
36 3300006358 Ga0068871_101570784 Ga0068871_1015707841 115
37 3300006931 Ga0097620_100002323 Ga0097620_1000023235 115
38 3300009093 Ga0105240_10891171 Ga0105240_108911711 115
39 3300009177 Ga0105248_11311016 Ga0105248_113110162 115
40 3300009177 Ga0105248_11820044 Ga0105248_118200442 115
41 3300009177 Ga0105248_12045296 Ga0105248_120452961 115
42 3300009553 Ga0105249_10221229 Ga0105249_102212292 115
43 3300010375 Ga0105239_10349972 Ga0105239_103499722 115
44 3300013104 Ga0157370_10653001 Ga0157370_106530011 115
45 3300013297 Ga0157378_10186477 Ga0157378_101864772 115
46 3300013308 Ga0157375_10433082 Ga0157375_104330822 115
47 3300014326 Ga0157380_12533480 Ga0157380_125334802 115
48 3300014969 Ga0157376_10990194 Ga0157376_109901942 115
49 3300014969 Ga0157376_11044205 Ga0157376_110442052 115
50 3300014969 Ga0157376_12591916 Ga0157376_125919161 115
51 3300021384 Ga0213876_10001261 Ga0213876_100012614 115
52 3300021388 Ga0213875_10408648 Ga0213875_104086482 115
53 3300025245 Ga0207425_1003919 Ga0207425_10039193 115
54 3300025258 Ga0209129_1000062 Ga0209129_1000062193 115
55 3300025295 Ga0209564_1000176 Ga0209564_1000176113 115
56 3300025297 Ga0209758_1000378 Ga0209758_100037826 115
57 3300025297 Ga0209758_1000517 Ga0209758_100051726 115
58 3300025299 Ga0209256_1019782 Ga0209256_10197823 115
59 3300025906 Ga0207699_10122016 Ga0207699_101220162 115
60 3300025909 Ga0207705_10667095 Ga0207705_106670952 115
61 3300025913 Ga0207695_10237311 Ga0207695_102373112 115
62 3300025916 Ga0207663_10346150 Ga0207663_103461502 115
63 3300025928 Ga0207700_10078536 Ga0207700_100785364 115
64 3300025931 Ga0207644_10027711 Ga0207644_100277113 115
65 3300025937 Ga0207669_11682337 Ga0207669_116823371 115
66 3300025941 Ga0207711_10281038 Ga0207711_102810382 115
67 3300025949 Ga0207667_10546224 Ga0207667_105462242 115
68 3300025960 Ga0207651_10103062 Ga0207651_101030622 115
69 3300025960 Ga0207651_10761411 Ga0207651_107614112 115
70 3300025986 Ga0207658_10442900 Ga0207658_104429002 115
71 3300025986 Ga0207658_11020293 Ga0207658_110202932 115
72 3300026089 Ga0207648_11997030 Ga0207648_119970301 115
73 3300026121 Ga0207683_10821391 Ga0207683_108213912 115
74 3300026142 Ga0207698_10038546 Ga0207698_100385463 115
75 3300027907 Ga0207428_10443172 Ga0207428_104431723 115
76 3300028379 Ga0268266_10154911 Ga0268266_101549112 115
77 3300028379 Ga0268266_10294918 Ga0268266_102949183 115
78 3300028379 Ga0268266_11148987 Ga0268266_111489872 115
79 3300028800 Ga0265338_10163143 Ga0265338_101631432 115
80 3300031239 Ga0265328_10395600 Ga0265328_103956001 115
81 3300031250 Ga0265331_10077210 Ga0265331_100772102 115
82 3300031344 Ga0265316_10433640 Ga0265316_104336402 115
83 3300031344 Ga0265316_10497672 Ga0265316_104976722 115
84 3300031456 Ga0307513_10024089 Ga0307513_100240896 115
85 3300031712 Ga0265342_10065966 Ga0265342_100659662 115
86 3300031727 Ga0316576_10291188 Ga0316576_102911883 115
87 3300031730 Ga0307516_10005461 Ga0307516_100054615 115
88 3300031911 Ga0307412_10164307 Ga0307412_101643071 115
89 3300032002 Ga0307416_100048276 Ga0307416_1000482763 115
90 3300032137 Ga0316585_10006820 Ga0316585_100068203 115
91 3300032139 Ga0316580_10024309 Ga0316580_100243091 115
92 3300035111 Ga0373923_0453472 Ga0373923_0453472_105_491 115
93 3300035118 Ga0373954_0019447 Ga0373954_0019447_537_923 115
94 3300035170 Ga0373943_0163097 Ga0373943_0163097_796_1182 115
95 3300035171 Ga0373946_0375930 Ga0373946_0375930_218_604 115
96 3300035398 Ga0316574_0184340 Ga0316574_0184340_835_1221 115
97 3300035724 Ga0373933_1026807 Ga0373933_1026807_18_404 115
98 3300036401 Ga0373937_0779318 Ga0373937_0779318_351_737 115
99 3300036401 Ga0373937_1535176 Ga0373937_1535176_197_583 115
100 3300036401 Ga0373937_1908718 Ga0373937_1908718_85_471 115
101 3300036712 Ga0316584_0077310 Ga0316584_0077310_1986_2372 115
102 3300037068 Ga0373925_0217325 Ga0373925_0217325_366_752 115
103 3300037068 Ga0373925_1080079 Ga0373925_1080079_69_455 115
104 3300037068 Ga0373925_1285968 Ga0373925_1285968_100_486 115
105 3300037853 Ga0436364_1166656 Ga0436364_1166656_1396_1782 115
106 3300037853 Ga0436364_1265831 Ga0436364_1265831_1153_1539 115
107 3300039437 Ga0436365_0415981 Ga0436365_0415981_2946_3332 115
108 3300039437 Ga0436365_0542915 Ga0436365_0542915_10248_10634 115
109 3300039438 Ga0436360_0230762 Ga0436360_0230762_141_527 115
110 3300039450 Ga0436363_0231105 Ga0436363_0231105_371_757 115
111 3300039450 Ga0436363_0235082 Ga0436363_0235082_175_561 115
112 3300041408 Ga0439453_0008302 Ga0439453_0008302_856_1242 115
113 3300041408 Ga0439453_0024042 Ga0439453_0024042_289_675 115
114 3300042128 Ga0450897_001879 Ga0450897_001879_491_877 115
115 3300042138 Ga0450903_042699 Ga0450903_042699_240_626 115
116 3300042156 Ga0439446_0034577 Ga0439446_0034577_421_807 115
117 3300042439 Ga0439464_0044532 Ga0439464_0044532_828_1214 115
118 3300042876 Ga0451577_0363903 Ga0451577_0363903_138_539 115
119 3300044706 Ga0466964_0799585 Ga0466964_0799585_123_518 115
120 3300044712 Ga0453684_0701350 Ga0453684_0701350_233_619 115
121 3300045051 Ga0451576_0056735 Ga0451576_0056735_1433_1819 115
122 3300045051 Ga0451576_0423311 Ga0451576_0423311_496_882 115
123 3300046454 Ga0495592_0234185 Ga0495592_0234185_811_1197 115
124 3300046454 Ga0495592_0270669 Ga0495592_0270669_175_561 115
125 3300046462 Ga0495651_0101029 Ga0495651_0101029_1094_1480 115
126 3300046463 Ga0495653_0015590 Ga0495653_0015590_5563_5949 115
127 3300046476 Ga0495662_0003592 Ga0495662_0003592_3060_3446 115
128 3300046477 Ga0495664_0148345 Ga0495664_0148345_310_696 115
129 3300046477 Ga0495664_0541718 Ga0495664_0541718_86_472 115
130 3300046511 Ga0495608_0153054 Ga0495608_0153054_781_1167 115
131 3300046516 Ga0495628_0028462 Ga0495628_0028462_703_1089 115
132 3300046517 Ga0495630_0037401 Ga0495630_0037401_917_1303 115
133 3300046529 Ga0495652_0031401 Ga0495652_0031401_2746_3132 115
134 3300046529 Ga0495652_0568418 Ga0495652_0568418_268_654 115
135 3300046533 Ga0495640_0307296 Ga0495640_0307296_81_467 115
136 3300046536 Ga0495587_0003975 Ga0495587_0003975_6093_6479 115
137 3300046543 Ga0495645_0001951 Ga0495645_0001951_5511_5897 115
138 3300046559 Ga0495667_0018280 Ga0495667_0018280_676_1062 115
139 3300046559 Ga0495667_0490257 Ga0495667_0490257_13_399 115
140 3300046642 Ga0495634_0332797 Ga0495634_0332797_504_890 115
141 3300046675 Ga0495657_0642338 Ga0495657_0642338_136_522 115
142 3300046675 Ga0495657_0900059 Ga0495657_0900059_72_458 115
143 3300046678 Ga0495599_0010251 Ga0495599_0010251_2086_2472 115
144 3300046679 Ga0495623_0106609 Ga0495623_0106609_744_1130 115
145 3300046680 Ga0495646_0230678 Ga0495646_0230678_93_479 115
146 3300046683 Ga0495658_0370070 Ga0495658_0370070_148_534 115
147 3300046689 Ga0495613_0338077 Ga0495613_0338077_540_926 115
148 3300046694 Ga0495649_0077365 Ga0495649_0077365_118_504 115
149 3300046809 Ga0495600_0037483 Ga0495600_0037483_244_630 115
150 3300047317 Ga0495604_0048475 Ga0495604_0048475_2321_2707 115
151 3300047317 Ga0495604_0719212 Ga0495604_0719212_109_495 115
152 3300047319 Ga0495674_0007107 Ga0495674_0007107_9403_9789 115
153 3300047319 Ga0495674_0035842 Ga0495674_0035842_1258_1644 115
154 3300047319 Ga0495674_0594081 Ga0495674_0594081_132_518 115
155 3300047320 Ga0495672_0544292 Ga0495672_0544292_97_483 115
156 3300047322 Ga0495680_0415079 Ga0495680_0415079_441_827 115
157 3300047443 Ga0495687_000134 Ga0495687_000134_78169_78555 115
158 3300047444 Ga0495675_0137636 Ga0495675_0137636_391_777 115
159 3300047471 Ga0495684_0057538 Ga0495684_0057538_915_1301 115
160 3300047471 Ga0495684_0093998 Ga0495684_0093998_1050_1436 115
161 3300048088 Ga0495602_0195689 Ga0495602_0195689_816_1202 115
162 3300049577 Ga0501041_0458036 Ga0501041_0458036_36_422 115
163 3300049741 Ga0501079_0039125 Ga0501079_0039125_3171_3557 115
164 3300049743 Ga0501081_0340771 Ga0501081_0340771_423_809 115
165 3300049824 Ga0501045_0330529 Ga0501045_0330529_150_536 115
166 3300050511 nmdc:mga08y16_365936_c1 nmdc:mga08y16_365936_c1_494_880 115
167 3300053078 Ga0495612_0422455 Ga0495612_0422455_19_405 115
168 3300053093 Ga0500651_0315238 Ga0500651_0315238_282_683 115
169 3300060353 Ga0501082_0040287 Ga0501082_0040287_2931_3317 115
170 3300003316 rootH1_10045451 rootH1_100454512 116
171 3300003322 rootL2_10044467 rootL2_100444673 116
172 3300003323 rootH1_10021944 rootH1_100219444 116
173 3300005545 Ga0070695_100951617 Ga0070695_1009516172 116
174 3300005548 Ga0070665_102085736 Ga0070665_1020857361 116
175 3300006871 Ga0075434_100640686 Ga0075434_1006406861 116
176 3300006881 Ga0068865_100877194 Ga0068865_1008771942 116
177 3300009098 Ga0105245_11363456 Ga0105245_113634562 116
178 3300009551 Ga0105238_11390453 Ga0105238_113904532 116
179 3300013297 Ga0157378_10995829 Ga0157378_109958292 116
180 3300025925 Ga0207650_10547516 Ga0207650_105475161 116
181 3300025927 Ga0207687_11279151 Ga0207687_112791512 116
182 3300025935 Ga0207709_10559766 Ga0207709_105597661 116
183 3300031548 Ga0307408_100416885 Ga0307408_1004168852 116
184 3300035241 Ga0373961_0005462 Ga0373961_0005462_2444_2839 116
185 3300039437 Ga0436365_1920964 Ga0436365_1920964_255_644 116
186 3300039447 Ga0436361_0756923 Ga0436361_0756923_5083_5493 116
187 3300041404 Ga0439436_0187430 Ga0439436_0187430_45_434 116
188 3300041512 Ga0451853_1922364 Ga0451853_1922364_180_572 116
189 3300044658 Ga0466972_0002976 Ga0466972_0002976_6772_7161 116
190 3300044673 Ga0453683_0007581 Ga0453683_0007581_997_1392 116
191 3300044901 Ga0466960_0200193 Ga0466960_0200193_400_789 116
192 3300045051 Ga0451576_0007461 Ga0451576_0007461_11721_12116 116
193 3300049654 Ga0501207_008025 Ga0501207_008025_529_918 116
194 2162886012 MBSR1b_contig_1557594 MBSR1b_0810.00006150 117
195 2162886012 MBSR1b_contig_5237604 MBSR1b_0915.00006860 117
196 2162886012 MBSR1b_contig_9241257 MBSR1b_0817.00000100 117
197 3300005293 Ga0065715_10169027 Ga0065715_101690271 117
198 3300005329 Ga0070683_100002122 Ga0070683_1000021229 117
199 3300005331 Ga0070670_100396845 Ga0070670_1003968452 117
200 3300005344 Ga0070661_100011813 Ga0070661_1000118137 117
201 3300005344 Ga0070661_100162475 Ga0070661_1001624752 117
202 3300005436 Ga0070713_100882460 Ga0070713_1008824601 117
203 3300005455 Ga0070663_100083777 Ga0070663_1000837773 117
204 3300005457 Ga0070662_100004298 Ga0070662_1000042983 117
205 3300005535 Ga0070684_100000667 Ga0070684_10000066719 117
206 3300005543 Ga0070672_100186504 Ga0070672_1001865041 117
207 3300005544 Ga0070686_100409389 Ga0070686_1004093891 117
208 3300005564 Ga0070664_100003674 Ga0070664_1000036747 117
209 3300005618 Ga0068864_100639803 Ga0068864_1006398032 117
210 3300005834 Ga0068851_10268621 Ga0068851_102686211 117
211 3300005842 Ga0068858_100391558 Ga0068858_1003915582 117
212 3300013296 Ga0157374_10060228 Ga0157374_100602282 117
213 3300013306 Ga0163162_10590479 Ga0163162_105904792 117
214 3300013308 Ga0157375_10640144 Ga0157375_106401442 117
215 3300014325 Ga0163163_10011651 Ga0163163_100116517 117
216 3300014969 Ga0157376_10780641 Ga0157376_107806412 117
217 3300025920 Ga0207649_10043142 Ga0207649_100431422 117
218 3300025920 Ga0207649_10084075 Ga0207649_100840753 117
219 3300025925 Ga0207650_10904453 Ga0207650_109044532 117
220 3300025933 Ga0207706_10021837 Ga0207706_100218377 117
221 3300025933 Ga0207706_10123136 Ga0207706_101231362 117
222 3300025940 Ga0207691_10130544 Ga0207691_101305442 117
223 3300025944 Ga0207661_10003548 Ga0207661_100035488 117
224 3300025945 Ga0207679_10001740 Ga0207679_100017404 117
225 3300026067 Ga0207678_10022216 Ga0207678_100222162 117
226 3300044658 Ga0466972_0001525 Ga0466972_0001525_2905_3300 117
227 3300044683 Ga0466965_0141693 Ga0466965_0141693_615_1010 117
228 3300044901 Ga0466960_0107517 Ga0466960_0107517_53_448 117
229 3300048907 Ga0496104_0003484 Ga0496104_0003484_3756_4148 117
230 3300048908 Ga0496105_0859002 Ga0496105_0859002_83_475 117
231 3300048909 Ga0496106_0556923 Ga0496106_0556923_466_858 117
232 3300048911 Ga0496108_0052223 Ga0496108_0052223_2809_3201 117
233 3300048912 Ga0496109_0076925 Ga0496109_0076925_1398_1790 117
234 3300048915 Ga0496112_0040579 Ga0496112_0040579_3597_3989 117
235 3300049578 Ga0501042_0719951 Ga0501042_0719951_135_530 117
236 3300049591 Ga0501075_0315704 Ga0501075_0315704_145_540 117

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22751

DUF488-N3a

Active DUF488-N3 subclade

30

151

0.97

PF04343

DUF488

Domain of unknown function DUF488

33

147

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fn2-assembly1.cif.gz_Q the structure of a 50s ribosomal subunit in the lyme disease pathogen borreliella burgdorferi 0.4968 72 115
6rm3-assembly1.cif.gz_LEE evolutionary compaction and adaptation visualized by the structure of the dormant microsporidian ribosome 0.4772 69 117
5juo-assembly1.cif.gz_JA saccharomyces cerevisiae 80s ribosome bound with elongation factor eef2-gdp-sordarin and taura syndrome virus ires, structure i (fully rotated 40s subunit) 0.4439 75 117
5o5q-assembly1.cif.gz_A x-ray crystal structure of rapz from escherichia coli (p3221 space group) 0.4388 2 116
5o5q-assembly1.cif.gz_A x-ray crystal structure of rapz from escherichia coli (p3221 space group) 0.428 2 116
ID Description Score Start End Superfamily
af_E1B6W2_4_608_1.20.1280.170 Mainly Alpha;Up-down Bundle;Monooxygenase;Exocyst complex component Exo70 0.5277 40 83 1.20.1280.170
af_Q69XE4_1_153_1.10.490.10 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.4574 38 112 1.10.490.10
af_K7MRA2_1_71_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.4462 66 106 3.10.20.90
af_Q5JL19_1_88_1.20.58.400 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;t-snare proteins 0.437 39 110 1.20.58.400
af_B1AYL1_499_618_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.4197 66 111 1.20.120.350
ID Description Score Start End GO Terms
AF-A0A2V5N3N5-F1-model_v4 DUF488 domain-containing protein 0.9878 51 117
AF-A7A6Q1-F1-model_v4 DUF488 domain-containing protein 0.9767 49 117
AF-A0A1F4CW35-F1-model_v4 DUF488 domain-containing protein 0.9527 43 116
AF-A0A2N2JBK0-F1-model_v4 DUF488 domain-containing protein 0.948 47 116
AF-A0A2V5N3N5-F1-model_v4 DUF488 domain-containing protein 0.9328 51 117

Feature Viewer

pLDDT pTM Quality
89.7 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map