F349175

General Info

Members Datasets Scaffolds Average Seq Length
236 163 472 215

Family's Representative Sequence

Representative Sequence 3300026118|Ga0207675_100438735|Ga0207675_1004387352
Length 242
Sequence MRNRLIALFVLALAASPGWSLAMTEVSAQTRTAPKAPARPPARRATAKPXXLXPLQTETATITCPNPLGNGVKTGRMFCDVLTGREPADGILVDLPPHVGPVTLSFDLHNRHMYSEELIKSNRAYRRYTASIGVLTMDNTLVSRAVVQSEFRTAGDLVDRIGGGAGPGGVKAVAPTGSEAITIEIPAETEERVSILGEKLAVERLDGVDSFTLPGQPVAIISNVMLEYRPAPPKRTPAPRKR

Samples

Sample ID Description Type Environment
1 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
90 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
91 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
94 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
95 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
96 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
97 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
98 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
99 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
102 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
103 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
104 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
105 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
106 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
107 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
108 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
109 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
110 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
111 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
112 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
113 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
114 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
115 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
116 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
117 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
118 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
119 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
120 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
121 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
122 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
123 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
124 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
125 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
126 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
127 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
128 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
129 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
134 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
138 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
139 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
140 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
141 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
142 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
143 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
144 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
145 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
146 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
147 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
150 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
151 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
152 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
153 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
154 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
155 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
156 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
157 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
158 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
159 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
160 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
161 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
162 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
163 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.69
Rhizosphere 98.31
Stem 0
Stem Tuber 0
Unclassified 17.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207675_100438735 3300026118 Bacteria 1292
2 JGI25406J46586_10001361 3300003203 Bacteria 11514
3 Ga0070666_10176650 3300005335 Bacteria 1497
4 Ga0070689_100032147 3300005340 Bacteria 3990
5 Ga0070691_10026714 3300005341 Bacteria 2692
6 Ga0070687_100284179 3300005343 Bacteria 1043
7 Ga0070687_100488908 3300005343 Bacteria 826
8 Ga0070692_10009004 3300005345 Bacteria 4480
9 Ga0070675_100000654 3300005354 Bacteria 23952
10 Ga0070675_100183130 3300005354 Bacteria 1812
11 Ga0070671_100022013 3300005355 Bacteria 5207
12 Ga0070671_100055390 3300005355 Bacteria 3299
13 Ga0070673_100238841 3300005364 Unclassified 1579
14 Ga0070688_100038840 3300005365 Bacteria 2910
15 Ga0070688_100041448 3300005365 Bacteria 2826
16 Ga0070713_100050217 3300005436 Unclassified 3444
17 Ga0070705_100000131 3300005440 Bacteria 43858
18 Ga0070705_100162468 3300005440 Bacteria 1495
19 Ga0070700_100098080 3300005441 Bacteria 1926
20 Ga0070700_100361942 3300005441 Bacteria 1079
21 Ga0070694_100018462 3300005444 Bacteria 4426
22 Ga0070694_100018715 3300005444 Bacteria 4399
23 Ga0070678_100165122 3300005456 Bacteria 1798
24 Ga0070707_100031172 3300005468 Bacteria 5078
25 Ga0070707_100119566 3300005468 Bacteria 2558
26 Ga0070698_100013183 3300005471 Bacteria 8746
27 Ga0070699_100000475 3300005518 Bacteria 38225
28 Ga0070699_100003521 3300005518 Bacteria 13842
29 Ga0070699_100095549 3300005518 Bacteria 2602
30 Ga0070679_100062466 3300005530 Unclassified 3713
31 Ga0070697_100057980 3300005536 Bacteria 3151
32 Ga0070697_100599835 3300005536 Unclassified 968
33 Ga0070672_100060225 3300005543 Unclassified 2989
34 Ga0070695_100000405 3300005545 Bacteria 22400
35 Ga0070696_100001112 3300005546 Bacteria 17404
36 Ga0070696_100002804 3300005546 Bacteria 11574
37 Ga0070696_100112571 3300005546 Bacteria 1961
38 Ga0070665_100018823 3300005548 Bacteria 6923
39 Ga0070704_100018173 3300005549 Bacteria 4488
40 Ga0070704_100045972 3300005549 Bacteria 3041
41 Ga0070704_100048133 3300005549 Unclassified 2982
42 Ga0070704_100049765 3300005549 Bacteria 2942
43 Ga0070704_100546082 3300005549 Bacteria 1012
44 Ga0068855_100758467 3300005563 Unclassified 1034
45 Ga0070664_100266363 3300005564 Bacteria 1542
46 Ga0070702_100015609 3300005615 Bacteria 3881
47 Ga0068864_100004385 3300005618 Bacteria 11587
48 Ga0068866_10216065 3300005718 Bacteria 1154
49 Ga0068863_100199912 3300005841 Bacteria 1922
50 Ga0068858_100011383 3300005842 Bacteria 8400
51 Ga0068860_100003350 3300005843 Bacteria 16499
52 Ga0068860_100343528 3300005843 Bacteria 1468
53 Ga0068862_100696667 3300005844 Unclassified 984
54 Ga0081539_10001868 3300005985 Bacteria 33083
55 Ga0070717_10531706 3300006028 Unclassified 1064
56 Ga0070712_100111042 3300006175 Bacteria 2046
57 Ga0097621_100056610 3300006237 Bacteria 3204
58 Ga0097621_100057630 3300006237 Bacteria 3177
59 Ga0068871_100003519 3300006358 Bacteria 10775
60 Ga0068871_100347525 3300006358 Bacteria 1311
61 Ga0075428_100001890 3300006844 Bacteria 22472
62 Ga0075428_100592661 3300006844 Bacteria 1184
63 Ga0075430_100236522 3300006846 Bacteria 1514
64 Ga0075431_100113820 3300006847 Bacteria 2793
65 Ga0075433_10101306 3300006852 Bacteria 2550
66 Ga0075433_10202056 3300006852 Unclassified 1767
67 Ga0075433_10259481 3300006852 Unclassified 1541
68 Ga0075434_100002826 3300006871 Bacteria 15377
69 Ga0075434_100037965 3300006871 Bacteria 4769
70 Ga0075434_100092416 3300006871 Bacteria 3028
71 Ga0075434_100106905 3300006871 Unclassified 2808
72 Ga0075434_100108346 3300006871 Bacteria 2788
73 Ga0075429_100033940 3300006880 Bacteria 4434
74 Ga0075429_100273559 3300006880 Bacteria 1479
75 Ga0068865_100001439 3300006881 Bacteria 13855
76 Ga0075436_100106673 3300006914 Unclassified 1954
77 Ga0075435_100004552 3300007076 Bacteria 9535
78 Ga0075435_100019488 3300007076 Bacteria 5184
79 Ga0075435_100038799 3300007076 Unclassified 3799
80 Ga0111539_10017689 3300009094 Bacteria 8824
81 Ga0111539_10729138 3300009094 Bacteria 1154
82 Ga0105245_10484295 3300009098 Bacteria 1251
83 Ga0105247_10026002 3300009101 Bacteria 3533
84 Ga0114129_10001462 3300009147 Bacteria 31921
85 Ga0114129_10006474 3300009147 Bacteria 16609
86 Ga0114129_10034767 3300009147 Bacteria 7119
87 Ga0105243_10551752 3300009148 Bacteria 1101
88 Ga0105242_10002481 3300009176 Bacteria 14471
89 Ga0105242_10646348 3300009176 Bacteria 1028
90 Ga0105248_10033247 3300009177 Bacteria 5760
91 Ga0105248_10107468 3300009177 Bacteria 3146
92 Ga0105248_10200163 3300009177 Bacteria 2250
93 Ga0157378_10229452 3300013297 Bacteria 1768
94 Ga0157375_10143778 3300013308 Bacteria 2514
95 Ga0157375_10651960 3300013308 Bacteria 1209
96 Ga0163163_10049876 3300014325 Bacteria 4120
97 Ga0157380_11336614 3300014326 Bacteria 765
98 Ga0157377_10024547 3300014745 Bacteria 3205
99 Ga0157379_10328011 3300014968 Bacteria 1398
100 Ga0157376_10011438 3300014969 Bacteria 6543
101 Ga0207692_10209573 3300025898 Bacteria 1150
102 Ga0207710_10025752 3300025900 Bacteria 2540
103 Ga0207646_10053321 3300025922 Bacteria 3617
104 Ga0207694_10456570 3300025924 Bacteria 1067
105 Ga0207659_10009804 3300025926 Bacteria 5995
106 Ga0207659_10263686 3300025926 Bacteria 1403
107 Ga0207700_10005946 3300025928 Bacteria 7342
108 Ga0207644_10053595 3300025931 Bacteria 2903
109 Ga0207644_10374356 3300025931 Unclassified 1160
110 Ga0207686_10105081 3300025934 Bacteria 1893
111 Ga0207686_10161720 3300025934 Bacteria 1570
112 Ga0207670_10008166 3300025936 Bacteria 5893
113 Ga0207704_10181525 3300025938 Bacteria 1521
114 Ga0207665_10497049 3300025939 Unclassified 942
115 Ga0207691_10034814 3300025940 Bacteria 4680
116 Ga0207691_10215244 3300025940 Unclassified 1667
117 Ga0207711_10433530 3300025941 Bacteria 1223
118 Ga0207689_10363068 3300025942 Bacteria 1204
119 Ga0207689_10399822 3300025942 Bacteria 1145
120 Ga0207651_10007901 3300025960 Bacteria 5699
121 Ga0207658_10424777 3300025986 Unclassified 1173
122 Ga0207703_10003067 3300026035 Bacteria 14130
123 Ga0207703_10107501 3300026035 Bacteria 2375
124 Ga0207708_10049616 3300026075 Unclassified 3196
125 Ga0207708_10109769 3300026075 Bacteria 2141
126 Ga0207641_10061956 3300026088 Bacteria 3191
127 Ga0207641_10226726 3300026088 Bacteria 1735
128 Ga0207648_10046458 3300026089 Bacteria 3807
129 Ga0207676_10015293 3300026095 Bacteria 5534
130 Ga0207683_10089603 3300026121 Bacteria 2738
131 Ga0207428_10497146 3300027907 Bacteria 886
132 Ga0268266_10015963 3300028379 Bacteria 6424
133 Ga0268264_10007157 3300028381 Bacteria 9349
134 Ga0268264_10057259 3300028381 Bacteria 3260
135 Ga0268264_10386295 3300028381 Bacteria 1342
136 Ga0307405_10059151 3300031731 Bacteria 2414
137 Ga0307410_10013093 3300031852 Bacteria 4826
138 Ga0307407_10279070 3300031903 Bacteria 1156
139 Ga0307412_10133132 3300031911 Bacteria 1809
140 Ga0307409_100035007 3300031995 Bacteria 3676
141 Ga0307409_100159730 3300031995 Bacteria 1969
142 Ga0307414_10068169 3300032004 Bacteria 2552
143 Ga0307411_10013855 3300032005 Bacteria 4466
144 Ga0307415_100435387 3300032126 Bacteria 1129
145 Ga0373957_0072759 3300035120 Bacteria 1347
146 Ga0373957_0101183 3300035120 Unclassified 1154
147 Ga0373946_0076167 3300035171 Unclassified 1460
148 Ga0373933_0197604 3300035724 Unclassified 1286
149 Ga0373937_0019538 3300036401 Bacteria 6063
150 Ga0373937_0022415 3300036401 Bacteria 5678
151 Ga0439462_0022494 3300042015 Bacteria 1650
152 Ga0439446_0133123 3300042156 Bacteria 807
153 Ga0451576_0024369 3300045051 Bacteria 6535
154 Ga0451576_0226115 3300045051 Bacteria 1954
155 Ga0495603_0031977 3300046455 Unclassified 3167
156 Ga0495651_0431232 3300046462 Unclassified 855
157 Ga0495580_0276118 3300046472 Bacteria 1147
158 Ga0495664_0237716 3300046477 Unclassified 1102
159 Ga0495584_0039653 3300046491 Bacteria 2379
160 Ga0495594_0044651 3300046499 Unclassified 2431
161 Ga0495628_0126046 3300046516 Unclassified 1962
162 Ga0495630_0605507 3300046517 Unclassified 840
163 Ga0495663_0022471 3300046525 Bacteria 1822
164 Ga0495642_0005919 3300046528 Bacteria 4692
165 Ga0495598_0024919 3300046537 Bacteria 1627
166 Ga0495621_0009275 3300046539 Bacteria 2984
167 Ga0495621_0061805 3300046539 Bacteria 1362
168 Ga0495621_0077259 3300046539 Bacteria 1236
169 Ga0495645_0003500 3300046543 Bacteria 10636
170 Ga0495633_0009635 3300046558 Bacteria 5316
171 Ga0495656_0173814 3300046615 Bacteria 1055
172 Ga0495659_0004226 3300046664 Bacteria 4530
173 Ga0495659_0008390 3300046664 Bacteria 3288
174 Ga0495659_0011152 3300046664 Unclassified 2895
175 Ga0495588_0059055 3300046674 Unclassified 1983
176 Ga0495658_0231022 3300046683 Bacteria 1160
177 Ga0495669_0006718 3300046684 Bacteria 4815
178 Ga0495669_0144232 3300046684 Archaea 1125
179 Ga0495670_0048656 3300046691 Bacteria 2121
180 Ga0495600_0056748 3300046809 Unclassified 2559
181 Ga0495636_0018883 3300047318 Bacteria 2768
182 Ga0495636_0057263 3300047318 Bacteria 1641
183 Ga0495674_0099645 3300047319 Unclassified 2473
184 Ga0495677_0008695 3300047445 Bacteria 3767
185 Ga0495677_0038639 3300047445 Bacteria 1744
186 Ga0495685_027714 3300047447 Bacteria 1949
187 Ga0495614_0154733 3300048089 Unclassified 1024
188 Ga0496108_0007507 3300048911 Bacteria 8841
189 Ga0496110_0498199 3300048913 Unclassified 1109
190 Ga0496112_0003973 3300048915 Bacteria 12386
191 Ga0496113_0081867 3300048916 Bacteria 2475
192 Ga0501039_0053158 3300049575 Bacteria 3134
193 Ga0501040_0329046 3300049576 Bacteria 1093
194 Ga0501041_0029044 3300049577 Bacteria 3336
195 Ga0501041_0356392 3300049577 Unclassified 925
196 Ga0501072_0011729 3300049588 Bacteria 6696
197 Ga0501073_0223393 3300049589 Bacteria 1301
198 Ga0501075_0125974 3300049591 Bacteria 1950
199 Ga0501076_0023002 3300049592 Bacteria 4797
200 Ga0501077_0076856 3300049593 Bacteria 2115
201 Ga0501079_0060366 3300049741 Bacteria 2925
202 Ga0501080_0199007 3300049742 Bacteria 1840
203 Ga0501081_0025581 3300049743 Bacteria 3972
204 Ga0501083_0239641 3300049744 Bacteria 1181
205 Ga0501283_015933 3300049779 Bacteria 1161
206 Ga0501045_0004821 3300049824 Bacteria 9327
207 nmdc:mga05p37_143516_c1 3300050507 Bacteria 2924
208 nmdc:mga05p37_19014_c1 3300050507 Bacteria 8307
209 nmdc:mga05p37_21406_c2 3300050507 Bacteria 7450
210 nmdc:mga05p37_35990_c1 3300050507 Bacteria 6074
211 nmdc:mga09592_119881_c1 3300050508 Bacteria 2259
212 nmdc:mga09592_56980_c1 3300050508 Bacteria 3302
213 nmdc:mga0qj67_1627_c1 3300050509 Bacteria 15797
214 nmdc:mga0qj67_466923_c1 3300050509 Bacteria 1016
215 nmdc:mga06r32_244986_c1 3300050510 Bacteria 1780
216 nmdc:mga08y16_111470_c1 3300050511 Bacteria 2848
217 nmdc:mga08y16_547209_c1 3300050511 Bacteria 1172
218 nmdc:mga0n895_16770_c1 3300050512 Bacteria 6731
219 nmdc:mga0n895_206352_c1 3300050512 Bacteria 1996
220 nmdc:mga0n895_36_c1 3300050512 Bacteria 78366
221 nmdc:mga0n895_77741_c1 3300050512 Bacteria 3302
222 nmdc:mga0n895_79250_c1 3300050512 Unclassified 3271
223 nmdc:mga0rr50_29_c1 3300050513 Bacteria 106517
224 nmdc:mga0rr50_99171_c1 3300050513 Unclassified 2285
225 nmdc:mga08x19_1015_c1 3300050514 Bacteria 17545
226 nmdc:mga0a205_222981_c1 3300050515 Unclassified 1770
227 nmdc:mga0a205_36267_c1 3300050515 Bacteria 4738
228 Ga0495619_0011939 3300053085 Bacteria 5472
229 Ga0501084_0357441 3300054114 Bacteria 1234
230 Ga0590071_000094 3300059421 Bacteria 24856
231 Ga0590071_005903 3300059421 Unclassified 2935
232 Ga0590074_000051 3300059423 Bacteria 11771
233 Ga0590075_000396 3300059424 Bacteria 11945
234 Ga0590077_000050 3300059426 Bacteria 27875
235 Ga0590077_041915 3300059426 Unclassified 1018
236 Ga0530510_0262016 3300061734 Unclassified 1289
237 Ga0207675_100438735
238 JGI25406J46586_10001361
239 Ga0070666_10176650
240 Ga0070689_100032147
241 Ga0070691_10026714
242 Ga0070687_100284179
243 Ga0070687_100488908
244 Ga0070692_10009004
245 Ga0070675_100000654
246 Ga0070675_100183130
247 Ga0070671_100022013
248 Ga0070671_100055390
249 Ga0070673_100238841
250 Ga0070688_100038840
251 Ga0070688_100041448
252 Ga0070713_100050217
253 Ga0070705_100000131
254 Ga0070705_100162468
255 Ga0070700_100098080
256 Ga0070700_100361942
257 Ga0070694_100018462
258 Ga0070694_100018715
259 Ga0070678_100165122
260 Ga0070707_100031172
261 Ga0070707_100119566
262 Ga0070698_100013183
263 Ga0070699_100000475
264 Ga0070699_100003521
265 Ga0070699_100095549
266 Ga0070679_100062466
267 Ga0070697_100057980
268 Ga0070697_100599835
269 Ga0070672_100060225
270 Ga0070695_100000405
271 Ga0070696_100001112
272 Ga0070696_100002804
273 Ga0070696_100112571
274 Ga0070665_100018823
275 Ga0070704_100018173
276 Ga0070704_100045972
277 Ga0070704_100048133
278 Ga0070704_100049765
279 Ga0070704_100546082
280 Ga0068855_100758467
281 Ga0070664_100266363
282 Ga0070702_100015609
283 Ga0068864_100004385
284 Ga0068866_10216065
285 Ga0068863_100199912
286 Ga0068858_100011383
287 Ga0068860_100003350
288 Ga0068860_100343528
289 Ga0068862_100696667
290 Ga0081539_10001868
291 Ga0070717_10531706
292 Ga0070712_100111042
293 Ga0097621_100056610
294 Ga0097621_100057630
295 Ga0068871_100003519
296 Ga0068871_100347525
297 Ga0075428_100001890
298 Ga0075428_100592661
299 Ga0075430_100236522
300 Ga0075431_100113820
301 Ga0075433_10101306
302 Ga0075433_10202056
303 Ga0075433_10259481
304 Ga0075434_100002826
305 Ga0075434_100037965
306 Ga0075434_100092416
307 Ga0075434_100106905
308 Ga0075434_100108346
309 Ga0075429_100033940
310 Ga0075429_100273559
311 Ga0068865_100001439
312 Ga0075436_100106673
313 Ga0075435_100004552
314 Ga0075435_100019488
315 Ga0075435_100038799
316 Ga0111539_10017689
317 Ga0111539_10729138
318 Ga0105245_10484295
319 Ga0105247_10026002
320 Ga0114129_10001462
321 Ga0114129_10006474
322 Ga0114129_10034767
323 Ga0105243_10551752
324 Ga0105242_10002481
325 Ga0105242_10646348
326 Ga0105248_10033247
327 Ga0105248_10107468
328 Ga0105248_10200163
329 Ga0157378_10229452
330 Ga0157375_10143778
331 Ga0157375_10651960
332 Ga0163163_10049876
333 Ga0157380_11336614
334 Ga0157377_10024547
335 Ga0157379_10328011
336 Ga0157376_10011438
337 Ga0207692_10209573
338 Ga0207710_10025752
339 Ga0207646_10053321
340 Ga0207694_10456570
341 Ga0207659_10009804
342 Ga0207659_10263686
343 Ga0207700_10005946
344 Ga0207644_10053595
345 Ga0207644_10374356
346 Ga0207686_10105081
347 Ga0207686_10161720
348 Ga0207670_10008166
349 Ga0207704_10181525
350 Ga0207665_10497049
351 Ga0207691_10034814
352 Ga0207691_10215244
353 Ga0207711_10433530
354 Ga0207689_10363068
355 Ga0207689_10399822
356 Ga0207651_10007901
357 Ga0207658_10424777
358 Ga0207703_10003067
359 Ga0207703_10107501
360 Ga0207708_10049616
361 Ga0207708_10109769
362 Ga0207641_10061956
363 Ga0207641_10226726
364 Ga0207648_10046458
365 Ga0207676_10015293
366 Ga0207683_10089603
367 Ga0207428_10497146
368 Ga0268266_10015963
369 Ga0268264_10007157
370 Ga0268264_10057259
371 Ga0268264_10386295
372 Ga0307405_10059151
373 Ga0307410_10013093
374 Ga0307407_10279070
375 Ga0307412_10133132
376 Ga0307409_100035007
377 Ga0307409_100159730
378 Ga0307414_10068169
379 Ga0307411_10013855
380 Ga0307415_100435387
381 Ga0373957_0072759
382 Ga0373957_0101183
383 Ga0373946_0076167
384 Ga0373933_0197604
385 Ga0373937_0019538
386 Ga0373937_0022415
387 Ga0439462_0022494
388 Ga0439446_0133123
389 Ga0451576_0024369
390 Ga0451576_0226115
391 Ga0495603_0031977
392 Ga0495651_0431232
393 Ga0495580_0276118
394 Ga0495664_0237716
395 Ga0495584_0039653
396 Ga0495594_0044651
397 Ga0495628_0126046
398 Ga0495630_0605507
399 Ga0495663_0022471
400 Ga0495642_0005919
401 Ga0495598_0024919
402 Ga0495621_0009275
403 Ga0495621_0061805
404 Ga0495621_0077259
405 Ga0495645_0003500
406 Ga0495633_0009635
407 Ga0495656_0173814
408 Ga0495659_0004226
409 Ga0495659_0008390
410 Ga0495659_0011152
411 Ga0495588_0059055
412 Ga0495658_0231022
413 Ga0495669_0006718
414 Ga0495669_0144232
415 Ga0495670_0048656
416 Ga0495600_0056748
417 Ga0495636_0018883
418 Ga0495636_0057263
419 Ga0495674_0099645
420 Ga0495677_0008695
421 Ga0495677_0038639
422 Ga0495685_027714
423 Ga0495614_0154733
424 Ga0496108_0007507
425 Ga0496110_0498199
426 Ga0496112_0003973
427 Ga0496113_0081867
428 Ga0501039_0053158
429 Ga0501040_0329046
430 Ga0501041_0029044
431 Ga0501041_0356392
432 Ga0501072_0011729
433 Ga0501073_0223393
434 Ga0501075_0125974
435 Ga0501076_0023002
436 Ga0501077_0076856
437 Ga0501079_0060366
438 Ga0501080_0199007
439 Ga0501081_0025581
440 Ga0501083_0239641
441 Ga0501283_015933
442 Ga0501045_0004821
443 nmdc:mga05p37_143516_c1
444 nmdc:mga05p37_19014_c1
445 nmdc:mga05p37_21406_c2
446 nmdc:mga05p37_35990_c1
447 nmdc:mga09592_119881_c1
448 nmdc:mga09592_56980_c1
449 nmdc:mga0qj67_1627_c1
450 nmdc:mga0qj67_466923_c1
451 nmdc:mga06r32_244986_c1
452 nmdc:mga08y16_111470_c1
453 nmdc:mga08y16_547209_c1
454 nmdc:mga0n895_16770_c1
455 nmdc:mga0n895_206352_c1
456 nmdc:mga0n895_36_c1
457 nmdc:mga0n895_77741_c1
458 nmdc:mga0n895_79250_c1
459 nmdc:mga0rr50_29_c1
460 nmdc:mga0rr50_99171_c1
461 nmdc:mga08x19_1015_c1
462 nmdc:mga0a205_222981_c1
463 nmdc:mga0a205_36267_c1
464 Ga0495619_0011939
465 Ga0501084_0357441
466 Ga0590071_000094
467 Ga0590071_005903
468 Ga0590074_000051
469 Ga0590075_000396
470 Ga0590077_000050
471 Ga0590077_041915
472 Ga0530510_0262016

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hmp-assembly2.cif.gz_B myosin vc pre-powerstroke state 0.6093 102 125
3k51-assembly1.cif.gz_A crystal structure of dcr3-tl1a complex 0.4441 69 205
5t99-assembly2.cif.gz_B crystal structure of bugh2awt in complex with galactoisofagomine 0.4369 69 206
5fi4-assembly1.cif.gz_A discovery of imidazo[1,2-a]-pyridine inhibitors of pan-pi3 kinases that are efficacious in a mouse xenograft model 0.4352 75 186
3osv-assembly3.cif.gz_D-3 the crytsal structure of flgd from p. aeruginosa 0.4299 74 200
ID Description Score Start End Superfamily
af_P38334_1_174_3.30.450.70 Alpha Beta;2-Layer Sandwich;Beta-Lactamase; 0.6192 106 132 3.30.450.70
1vomA01 Alpha Beta;3-Layer(aba) Sandwich;Kinesin;Kinesin motor domain 0.5788 100 125 3.40.850.10
af_B0S5B3_71_227_2.60.120.40 Mainly Beta;Sandwich;Jelly Rolls; 0.4958 58 204 2.60.120.40
3osvD02 Mainly Beta;Sandwich;Immunoglobulin-like; 0.486 69 199 2.60.40.4070
3m1hC00 Mainly Beta;Sandwich;Jelly Rolls; 0.4858 53 204 2.60.120.200
ID Description Score Start End GO Terms
AF-A0A2E9NLG8-F1-model_v4 Uncharacterized protein 0.964 25 207
AF-A0A2E9NLG8-F1-model_v4 Uncharacterized protein 0.9488 25 207
AF-A0A356IHS5-F1-model_v4 Uncharacterized protein 0.9393 30 192
AF-A0A2V8F1P2-F1-model_v4 Uncharacterized protein 0.9238 40 216
AF-A0A356IHS5-F1-model_v4 Uncharacterized protein 0.9172 30 192

Map